Kunitz-type serine protease inhibitor C4

Overview
NameKunitz-type serine protease inhibitor C4
Smed IDSMED30018720
Length (bp)329
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kunitz-type serine protease inhibitor C4 (SMED30018720) t-SNE clustered cells

Violin plots show distribution of expression levels for Kunitz-type serine protease inhibitor C4 (SMED30018720) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kunitz-type serine protease inhibitor C4 (SMED30018720) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kunitz-type serine protease inhibitor C4 (SMED30018720) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018720

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30018720SMESG000013911.1 dd_Smed_v4_886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018720SMESG000013911.1 dd_Smed_v6_886_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018720SMESG000013911.1 OX_Smed_1.0.09545ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 57.7658 bits (138), Expect = 1.095e-11
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +S C     +G C+   + FFFN  + +CEE +YGGC GN+NRF ++EEC + C +
Sbjct:   51 HSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTR 106          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 57.7658 bits (138), Expect = 1.095e-11
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +S C     +G C+   + FFFN  + +CEE +YGGC GN+NRF ++EEC + C +
Sbjct:   51 HSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTR 106          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 57.3806 bits (137), Expect = 1.756e-11
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S C     +G C+   + FFFN  + +CEE +YGGC GN+NRF ++EEC + C
Sbjct:   51 HSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 60.4622 bits (145), Expect = 1.887e-11
Identity = 21/56 (37.50%), Postives = 33/56 (58.93%), Query Frame = 1
Query:   73 SRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +   +C LPK EG CR +   ++++  +  C    YGGC GNEN+F + +EC + C
Sbjct: 2499 TETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2554          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 60.4622 bits (145), Expect = 1.887e-11
Identity = 21/56 (37.50%), Postives = 33/56 (58.93%), Query Frame = 1
Query:   73 SRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +   +C LPK EG CR +   ++++  +  C    YGGC GNEN+F + +EC + C
Sbjct: 2500 TETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2555          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 65.0846 bits (157), Expect = 1.926e-13
Identity = 28/60 (46.67%), Postives = 37/60 (61.67%), Query Frame = 1
Query:   67 CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C++    C LPK +G C G    +++N  S +CE   YGGC GN NRF+TIEEC  +C K
Sbjct: 1497 CQNHKDACQLPKVQGPCSGKHSYYYYNTASHQCETFTYGGCLGNTNRFATIEECQARCPK 1556          

HSP 2 Score: 49.2914 bits (116), Expect = 6.469e-8
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C   +  G C  Y + +F+N  S +CE   YGGC GN NRF + +EC ++C
Sbjct: 1265 QSMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRC 1321          

HSP 3 Score: 47.7506 bits (112), Expect = 2.355e-7
Identity = 21/55 (38.18%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NSVC   K  G C  +   +++NK  G C    YGGC G  NRF   ++C   C+
Sbjct: 1444 NSVCDEAKDTGPCTNFVTKWYYNKADGTCNRFHYGGCQGTNNRFDNEQQCKAACQ 1498          

HSP 4 Score: 46.595 bits (109), Expect = 5.813e-7
Identity = 19/57 (33.33%), Postives = 32/57 (56.14%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +   C L   +G C+G F+++++   +G C    Y GC GN NRF++ ++C   C K
Sbjct: 1371 QRDACHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVK 1427          

HSP 5 Score: 45.8246 bits (107), Expect = 1.181e-6
Identity = 18/53 (33.96%), Postives = 28/53 (52.83%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C L +  G C      ++F+     C+   YGGC GN+NRF + E+C + C+ 
Sbjct: 1853 CTLERSAGPCTDSISMWYFDSTHLDCKPFTYGGCRGNQNRFVSKEQCQQSCRP 1905          

HSP 6 Score: 45.0542 bits (105), Expect = 1.811e-6
Identity = 20/54 (37.04%), Postives = 29/54 (53.70%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C+LP+Q G C      + F+ E  +C   +Y GCN N N F++ E C   C K
Sbjct: 1730 LCMLPEQRGSCYDNILRWRFDSEKSQCVTFMYSGCNPNANHFTSQETCERACGK 1783          

HSP 7 Score: 43.8986 bits (102), Expect = 5.478e-6
Identity = 17/54 (31.48%), Postives = 32/54 (59.26%), Query Frame = 1
Query:   82 SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +VC LP + G C+     ++ + ++ +C+ M++ GC GN N FS+  +C   C+
Sbjct: 1788 AVCELPAEHGDCQLAIPRWYHDPKTSQCQMMMWTGCGGNGNAFSSKADCESLCR 1841          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 65.0846 bits (157), Expect = 1.926e-13
Identity = 28/60 (46.67%), Postives = 37/60 (61.67%), Query Frame = 1
Query:   67 CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C++    C LPK +G C G    +++N  S +CE   YGGC GN NRF+TIEEC  +C K
Sbjct: 1497 CQNHKDACQLPKVQGPCSGKHSYYYYNTASHQCETFTYGGCLGNTNRFATIEECQARCPK 1556          

HSP 2 Score: 49.2914 bits (116), Expect = 6.469e-8
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C   +  G C  Y + +F+N  S +CE   YGGC GN NRF + +EC ++C
Sbjct: 1265 QSMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRC 1321          

HSP 3 Score: 47.7506 bits (112), Expect = 2.355e-7
Identity = 21/55 (38.18%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NSVC   K  G C  +   +++NK  G C    YGGC G  NRF   ++C   C+
Sbjct: 1444 NSVCDEAKDTGPCTNFVTKWYYNKADGTCNRFHYGGCQGTNNRFDNEQQCKAACQ 1498          

HSP 4 Score: 46.595 bits (109), Expect = 5.813e-7
Identity = 19/57 (33.33%), Postives = 32/57 (56.14%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +   C L   +G C+G F+++++   +G C    Y GC GN NRF++ ++C   C K
Sbjct: 1371 QRDACHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVK 1427          

HSP 5 Score: 45.8246 bits (107), Expect = 1.181e-6
Identity = 18/53 (33.96%), Postives = 28/53 (52.83%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C L +  G C      ++F+     C+   YGGC GN+NRF + E+C + C+ 
Sbjct: 1853 CTLERSAGPCTDSISMWYFDSTHLDCKPFTYGGCRGNQNRFVSKEQCQQSCRP 1905          

HSP 6 Score: 45.0542 bits (105), Expect = 1.811e-6
Identity = 20/54 (37.04%), Postives = 29/54 (53.70%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C+LP+Q G C      + F+ E  +C   +Y GCN N N F++ E C   C K
Sbjct: 1730 LCMLPEQRGSCYDNILRWRFDSEKSQCVTFMYSGCNPNANHFTSQETCERACGK 1783          

HSP 7 Score: 43.8986 bits (102), Expect = 5.478e-6
Identity = 17/54 (31.48%), Postives = 32/54 (59.26%), Query Frame = 1
Query:   82 SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +VC LP + G C+     ++ + ++ +C+ M++ GC GN N FS+  +C   C+
Sbjct: 1788 AVCELPAEHGDCQLAIPRWYHDPKTSQCQMMMWTGCGGNGNAFSSKADCESLCR 1841          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 63.1586 bits (152), Expect = 1.066e-12
Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 1
Query:   67 CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C++    C LPK +G C G    +++N  S +CE   YGGC GN NRF+TIEEC  +C 
Sbjct: 1497 CQNHKDACQLPKVQGPCSGKHSYYYYNTASHQCETFTYGGCLGNTNRFATIEECQARCP 1555          

HSP 2 Score: 48.9062 bits (115), Expect = 8.246e-8
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C   +  G C  Y + +F+N  S +CE   YGGC GN NRF + +EC ++C
Sbjct: 1265 QSMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRC 1321          

HSP 3 Score: 47.7506 bits (112), Expect = 2.496e-7
Identity = 21/55 (38.18%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NSVC   K  G C  +   +++NK  G C    YGGC G  NRF   ++C   C+
Sbjct: 1444 NSVCDEAKDTGPCTNFVTKWYYNKADGTCNRFHYGGCQGTNNRFDNEQQCKAACQ 1498          

HSP 4 Score: 46.595 bits (109), Expect = 6.405e-7
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 1
Query:   13 NMKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            N+ S      S +      + R++ C L   +G C+G F+++++   +G C    Y GC GN NRF++ ++C   C K
Sbjct: 1351 NIVSPPQQSASPVVVPSNSKQRDA-CHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVK 1427          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 63.1586 bits (152), Expect = 1.066e-12
Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 1
Query:   67 CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C++    C LPK +G C G    +++N  S +CE   YGGC GN NRF+TIEEC  +C 
Sbjct: 1497 CQNHKDACQLPKVQGPCSGKHSYYYYNTASHQCETFTYGGCLGNTNRFATIEECQARCP 1555          

HSP 2 Score: 48.9062 bits (115), Expect = 8.246e-8
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C   +  G C  Y + +F+N  S +CE   YGGC GN NRF + +EC ++C
Sbjct: 1265 QSMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRC 1321          

HSP 3 Score: 47.7506 bits (112), Expect = 2.496e-7
Identity = 21/55 (38.18%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NSVC   K  G C  +   +++NK  G C    YGGC G  NRF   ++C   C+
Sbjct: 1444 NSVCDEAKDTGPCTNFVTKWYYNKADGTCNRFHYGGCQGTNNRFDNEQQCKAACQ 1498          

HSP 4 Score: 46.595 bits (109), Expect = 6.405e-7
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 1
Query:   13 NMKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            N+ S      S +      + R++ C L   +G C+G F+++++   +G C    Y GC GN NRF++ ++C   C K
Sbjct: 1351 NIVSPPQQSASPVVVPSNSKQRDA-CHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVK 1427          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 63.1586 bits (152), Expect = 1.066e-12
Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 1
Query:   67 CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C++    C LPK +G C G    +++N  S +CE   YGGC GN NRF+TIEEC  +C 
Sbjct: 1497 CQNHKDACQLPKVQGPCSGKHSYYYYNTASHQCETFTYGGCLGNTNRFATIEECQARCP 1555          

HSP 2 Score: 48.9062 bits (115), Expect = 8.246e-8
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C   +  G C  Y + +F+N  S +CE   YGGC GN NRF + +EC ++C
Sbjct: 1265 QSMEDICRSRQDAGPCETYSDQWFYNAFSQECETFTYGGCGGNLNRFRSKDECEQRC 1321          

HSP 3 Score: 47.7506 bits (112), Expect = 2.496e-7
Identity = 21/55 (38.18%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NSVC   K  G C  +   +++NK  G C    YGGC G  NRF   ++C   C+
Sbjct: 1444 NSVCDEAKDTGPCTNFVTKWYYNKADGTCNRFHYGGCQGTNNRFDNEQQCKAACQ 1498          

HSP 4 Score: 46.595 bits (109), Expect = 6.405e-7
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 1
Query:   13 NMKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            N+ S      S +      + R++ C L   +G C+G F+++++   +G C    Y GC GN NRF++ ++C   C K
Sbjct: 1351 NIVSPPQQSASPVVVPSNSKQRDA-CHLNVDQGRCKGAFDSWYYEVATGSCVTFKYTGCGGNANRFASKDQCESLCVK 1427          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Match: CG2816 (gene:FBgn0031564 transcript:FBtr0300299)

HSP 1 Score: 56.9954 bits (136), Expect = 6.661e-12
Identity = 26/56 (46.43%), Postives = 33/56 (58.93%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            R  +CL P   G C GY E++ +N     CE  +YGGC GN+NRFST  EC   C+
Sbjct:   27 RVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCR 82          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0077546)

HSP 1 Score: 56.225 bits (134), Expect = 1.493e-11
Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLP---KQEGM--CRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            MK I  +   F         ++ +C LP      G+  C  +  +F ++ E+  CE+ +YGGC GNENRF T E C +KCK+
Sbjct:    1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCKE 82          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0345610)

HSP 1 Score: 56.225 bits (134), Expect = 1.493e-11
Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLP---KQEGM--CRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            MK I  +   F         ++ +C LP      G+  C  +  +F ++ E+  CE+ +YGGC GNENRF T E C +KCK+
Sbjct:    1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCKE 82          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0300337)

HSP 1 Score: 58.5362 bits (140), Expect = 5.712e-11
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            VCLLPK  G C G+ + ++F+ +  +CEE  YGGC G  NRF ++E+C   C
Sbjct: 1670 VCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTC 1721          

HSP 2 Score: 53.5286 bits (127), Expect = 2.556e-9
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            E     C LPK+ G C  Y   ++F+   G C    YGGC+GN+NRF +  EC + C+
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 3 Score: 48.521 bits (114), Expect = 1.685e-7
Identity = 20/54 (37.04%), Postives = 30/54 (55.56%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
             C  P + G C G FE ++++ E+  C    YGGC GN+N + T   CN  C++
Sbjct: 1729 TCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301839)

HSP 1 Score: 58.151 bits (139), Expect = 5.859e-11
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            VCLLPK  G C G+ + ++F+ +  +CEE  YGGC G  NRF ++E+C   C
Sbjct: 1670 VCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTC 1721          

HSP 2 Score: 53.9138 bits (128), Expect = 2.356e-9
Identity = 23/58 (39.66%), Postives = 32/58 (55.17%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            E     C LPK+ G C  Y   ++F+   G C    YGGC+GN+NRF +  EC + C+
Sbjct: 1606 EPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 3 Score: 52.373 bits (124), Expect = 7.862e-9
Identity = 20/54 (37.04%), Postives = 32/54 (59.26%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C +P + G C  Y  +++++ +   C +  YGGC GNENRF T E C  +C +
Sbjct: 1791 ICEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDR 1844          

HSP 4 Score: 50.8322 bits (120), Expect = 2.781e-8
Identity = 21/51 (41.18%), Postives = 31/51 (60.78%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            C  P   G C  +   + +N+  G+C+   YGGC GN+NRF+T EEC+ +C
Sbjct: 1944 CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARC 1994          

HSP 5 Score: 49.2914 bits (116), Expect = 8.100e-8
Identity = 21/61 (34.43%), Postives = 34/61 (55.74%), Query Frame = 1
Query:   73 SRNSVCLLPKQEGMCRG---YFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            S   +CLLP   G C G   +   ++++ E+G C   +Y GC+GN+N F + E C  +C+ 
Sbjct: 2256 SAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFIYAGCSGNQNNFRSFEACTNQCRP 2316          

HSP 6 Score: 48.521 bits (114), Expect = 1.494e-7
Identity = 20/54 (37.04%), Postives = 30/54 (55.56%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
             C  P + G C G FE ++++ E+  C    YGGC GN+N + T   CN  C++
Sbjct: 1729 TCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 7 Score: 46.9802 bits (110), Expect = 5.282e-7
Identity = 22/52 (42.31%), Postives = 27/52 (51.92%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            VC  P   G C  +   ++FN  S  CE   YGGC+G  NRFS + EC   C
Sbjct: 2195 VCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQTVC 2246          

HSP 8 Score: 46.2098 bits (108), Expect = 9.100e-7
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            E   S C L  + G C      +F+N   G C+E VY GC GN N ++T EEC  +C
Sbjct: 2008 EHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCGGNANNYATEEECQNEC 2064          

HSP 9 Score: 45.0542 bits (105), Expect = 2.427e-6
Identity = 20/53 (37.74%), Postives = 28/53 (52.83%), Query Frame = 1
Query:   82 SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            SVC  P + G C      +F++ E+  C    Y GC GN NRF T ++C  +C
Sbjct: 2135 SVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQC 2187          

HSP 10 Score: 44.2838 bits (103), Expect = 4.697e-6
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 1
Query:   73 SRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            SR  VC      G C  +   + F+++ G C +  YG C GN NRF T  +C ++C
Sbjct: 1860 SRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRC 1915          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Match: CR545476.3 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:23915065:23940181:-1 gene:ENSDARG00000114020.1 transcript:ENSDART00000190370.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR545476.3)

HSP 1 Score: 62.3882 bits (150), Expect = 2.826e-12
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LPK+EG C  +   + ++  SG C    YGGC GN+NRF T +EC + C K
Sbjct: 2755 ICKLPKEEGSCAKFVLKWHYDPLSGNCTRFWYGGCGGNQNRFDTQDECEKACGK 2808          

HSP 2 Score: 52.7582 bits (125), Expect = 7.952e-9
Identity = 21/54 (38.89%), Postives = 34/54 (62.96%), Query Frame = 1
Query:   88 CLLPKQEGM-CRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C L    G+ C+ Y   ++F++++G C +  YGGC GN+NRF T  +C ++C K
Sbjct: 2671 CSLDFDTGLPCKDYQAKWYFDRKNGFCTQFWYGGCGGNDNRFETESDCLKRCMK 2724          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Match: col6a3 (collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070501-8])

HSP 1 Score: 62.3882 bits (150), Expect = 2.826e-12
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LPK+EG C  +   + ++  SG C    YGGC GN+NRF T +EC + C K
Sbjct: 2787 ICKLPKEEGSCAKFVLKWHYDPLSGNCTRFWYGGCGGNQNRFDTQDECEKACGK 2840          

HSP 2 Score: 52.7582 bits (125), Expect = 7.953e-9
Identity = 21/54 (38.89%), Postives = 34/54 (62.96%), Query Frame = 1
Query:   88 CLLPKQEGM-CRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            C L    G+ C+ Y   ++F++++G C +  YGGC GN+NRF T  +C ++C K
Sbjct: 2703 CSLDFDTGLPCKDYQAKWYFDRKNGFCTQFWYGGCGGNDNRFETESDCLKRCMK 2756          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Match: col6a3 (collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070501-8])

HSP 1 Score: 62.3882 bits (150), Expect = 2.839e-12
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LPK+EG C  +   + ++  SG C    YGGC GN+NRF T +EC + C K
Sbjct: 3666 ICKLPKEEGSCAKFVLKWHYDPLSGNCTRFWYGGCGGNQNRFDTQDECEKACGK 3719          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 60.4622 bits (145), Expect = 5.977e-12
Identity = 29/53 (54.72%), Postives = 33/53 (62.26%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +C   K+EG CRG F  +FFN  S +CE   YGGC GNEN F   EEC E CK
Sbjct:   89 ICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYCK 141          

HSP 2 Score: 52.373 bits (124), Expect = 6.398e-9
Identity = 27/76 (35.53%), Postives = 39/76 (51.32%), Query Frame = 1
Query:   34 ILTSFIFFVKYCESR-------NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +L + + F+   ES          VCLL  +EG C    + F++N  S +CEE  Y GC GN+N F +  EC + C
Sbjct:    5 LLGALLLFISVLESAVGLTLQPKEVCLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRSFVECQKTC 80          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 60.4622 bits (145), Expect = 5.977e-12
Identity = 29/53 (54.72%), Postives = 33/53 (62.26%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +C   K+EG CRG F  +FFN  S +CE   YGGC GNEN F   EEC E CK
Sbjct:   89 ICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYCK 141          

HSP 2 Score: 52.373 bits (124), Expect = 6.398e-9
Identity = 27/76 (35.53%), Postives = 39/76 (51.32%), Query Frame = 1
Query:   34 ILTSFIFFVKYCESR-------NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +L + + F+   ES          VCLL  +EG C    + F++N  S +CEE  Y GC GN+N F +  EC + C
Sbjct:    5 LLGALLLFISVLESAVGLTLQPKEVCLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRSFVECQKTC 80          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 63.929 bits (154), Expect = 1.063e-12
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*ITPT*LNQKI 279
            VC L K+EG CR +   ++++ E+  C    YGGC GNENRFST +EC + C     P  LN  +
Sbjct: 2828 VCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC----IPVPLNSSV 2888          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 63.929 bits (154), Expect = 1.065e-12
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*ITPT*LNQKI 279
            VC L K+EG CR +   ++++ E+  C    YGGC GNENRFST +EC + C     P  LN  +
Sbjct: 3008 VCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC----IPVPLNSSV 3068          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Match: itch (itchy E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-976485])

HSP 1 Score: 63.929 bits (154), Expect = 1.065e-12
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*ITPT*LNQKI 279
            VC L K+EG CR +   ++++ E+  C    YGGC GNENRFST +EC + C     P  LN  +
Sbjct: 3025 VCNLQKEEGTCRDFVLKWYYDPETKSCARFWYGGCGGNENRFSTQKECEKIC----IPVPLNSSV 3085          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:548483])

HSP 1 Score: 59.3066 bits (142), Expect = 2.081e-11
Identity = 23/78 (29.49%), Postives = 46/78 (58.97%), Query Frame = 1
Query:   13 NMKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            ++++++        F    +   +VCLLP  EG C+     +++++ +  C+E +YGGC+GN N+F ++E+C + C K
Sbjct:    4 SLQALMAASLLIQVFGSPMQGNTTVCLLPPDEGPCKALIPHYYYDRYTQTCQEFLYGGCDGNSNKFLSMEDCEKFCWK 81          

HSP 2 Score: 56.9954 bits (136), Expect = 1.487e-10
Identity = 29/66 (43.94%), Postives = 36/66 (54.55%), Query Frame = 1
Query:   58 VKYCESRN---SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            + +C  R    S C  PK EG C      ++FN ES  CEE VY GC GN N F  +E+C+  CKK
Sbjct:  136 MDFCSPRRDAPSFCYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNFVKMEDCDSVCKK 201          

HSP 3 Score: 47.3654 bits (111), Expect = 4.922e-7
Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
             C +   EG CRG+ + + +N ++ KCE+  YGGC GN+N F     C + C
Sbjct:   88 ACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFKDKASCMDFC 139          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Match: ric8a (RIC8 guanine nucleotide exchange factor A [Source:Xenbase;Acc:XB-GENE-5745094])

HSP 1 Score: 52.7582 bits (125), Expect = 5.589e-10
Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++ C L   +G CR Y   ++++K++  C +  +GGCNGN NRF T EEC + C
Sbjct:   10 DARCTLILDQGPCRTYIIKWYYDKQANSCAQFWFGGCNGNSNRFDTEEECKKIC 63          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Match: Spint3 (serine peptidase inhibitor, Kunitz type, 3 [Source:MGI Symbol;Acc:MGI:3651470])

HSP 1 Score: 58.5362 bits (140), Expect = 3.230e-12
Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +S   +C+LPK  G CR  F  +++N ++GKCE   YGGC GNEN F +  +C   C
Sbjct:   29 KSLPPMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 60.8474 bits (146), Expect = 4.274e-12
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++ C +   +G C+    ++FFN  + +CEE +YGGC GNENRF T+EEC + C
Sbjct:   47 HTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          

HSP 2 Score: 59.3066 bits (142), Expect = 1.557e-11
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            R   C L +  G+CRGY + + +N ++ +CE  VYGGC GN N F T++EC + C+
Sbjct:  117 RPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 60.8474 bits (146), Expect = 4.274e-12
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++ C +   +G C+    ++FFN  + +CEE +YGGC GNENRF T+EEC + C
Sbjct:   47 HTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          

HSP 2 Score: 59.3066 bits (142), Expect = 1.557e-11
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            R   C L +  G+CRGY + + +N ++ +CE  VYGGC GN N F T++EC + C+
Sbjct:  117 RPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 60.8474 bits (146), Expect = 4.274e-12
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++ C +   +G C+    ++FFN  + +CEE +YGGC GNENRF T+EEC + C
Sbjct:   47 HTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 100          

HSP 2 Score: 59.3066 bits (142), Expect = 1.557e-11
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            R   C L +  G+CRGY + + +N ++ +CE  VYGGC GN N F T++EC + C+
Sbjct:  117 RPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICE 172          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 60.8474 bits (146), Expect = 6.185e-12
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++ C +   +G C+    ++FFN  + +CEE +YGGC GNENRF T+EEC + C
Sbjct:   40 HTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC 93          

HSP 2 Score: 59.3066 bits (142), Expect = 1.919e-11
Identity = 26/67 (38.81%), Postives = 43/67 (64.18%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*I-TPT*LNQ 273
            R   C L +  G+CRGY + + +N ++ +CE  VYGGC GN N F T++EC + C+  + +P+ +N+
Sbjct:  110 RPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNE 176          
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Match: sp|P0DMW6|VKT3A_ACTEQ (PI-actitoxin-Aeq3a OS=Actinia equina OX=6106 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.096e-16
Identity = 28/55 (50.91%), Postives = 37/55 (67.27%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            NS C LP   G CRGYF  +++N E+GKC++ +YGGC GN N F T+E+C   C 
Sbjct:    3 NSFCQLPAVVGKCRGYFPRYYYNTEAGKCQQFIYGGCGGNRNNFETVEDCRATCH 57          
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Match: sp|P0DMW7|VKT3B_ACTEQ (PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.586e-15
Identity = 28/55 (50.91%), Postives = 37/55 (67.27%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +S C LP   G CRGYF  F++N E+GKC++ +YGGC GN N F T+E+C   C 
Sbjct:    3 SSFCQLPAVVGKCRGYFPRFYYNTEAGKCQQFIYGGCGGNRNNFETVEDCRATCH 57          
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Match: sp|Q8WPI2|BOOH2_RHIMP (Boophilin-H2 OS=Rhipicephalus microplus OX=6941 GN=H2 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.690e-15
Identity = 34/75 (45.33%), Postives = 43/75 (57.33%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MK I+++      F +    RN  C LP  EG+C+     F+FN E+GKC    YGGC GNEN F TIEEC + C
Sbjct:    1 MKCIILLAVLGTAFAQ----RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKAC 71          

HSP 2 Score: 51.6026 bits (122), Expect = 3.011e-8
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C      G C G  E +F+N +SG+CE  VYGGC GN+N + + EEC   CK
Sbjct:   89 CEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELVCK 140          
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Match: sp|P0DMX0|VKT3_ANTAF (PI-actitoxin-Axm2b OS=Anthopleura aff. xanthogrammica OX=152178 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.207e-15
Identity = 29/57 (50.88%), Postives = 35/57 (61.40%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
             S N  C LP   G CRGYF  +FF+ E+GKCE  +YGGC GN N F + +EC   C
Sbjct:    1 HSSNDFCYLPAVRGRCRGYFPRYFFSSETGKCERFIYGGCGGNRNNFESAQECGSTC 57          
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Match: sp|Q8WPI3|BOOG2_RHIMP (Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN=G2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.021e-14
Identity = 32/75 (42.67%), Postives = 43/75 (57.33%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MK ++++      F +    RN  C LP  EG+C+     F+FN E+GKC    YGGC GNEN F TIE+C + C
Sbjct:    1 MKYLILLAVLGTAFAQ----RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEDCQKAC 71          

HSP 2 Score: 49.6766 bits (117), Expect = 1.679e-7
Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C      G C G  E +F+N  SG+CE  VYGGC GN+N + + EEC   CK
Sbjct:   89 CEPAADSGSCAGQLERWFYNVRSGECETFVYGGCGGNDNNYESEEECELVCK 140          
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Match: C8YJ95 (Serine protease inhibitor 3 OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.657e-17
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            MK + +I   F   V +  +++ VC  PK  G C   F  F+FN  SG+CE  +YGGC GNEN FST+EECN KC 
Sbjct:    1 MKVLSLIFVIFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYFNSSSGQCEAFIYGGCGGNENNFSTLEECNAKCA 76          
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Match: G3MS35 (BPTI/Kunitz inhibitor domain-containing protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.040e-17
Identity = 31/73 (42.47%), Postives = 44/73 (60.27%), Query Frame = 1
Query:   22 SIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++V++L S        + R   C LP  +G CRGYF +F+F+  SG C + +YGGC GN NRFS++ EC   C
Sbjct:    6 AVVVLLLSIAIAGTSAQGRPRQCFLPPVQGTCRGYFPSFYFDSRSGSCRQFIYGGCGGNANRFSSVRECRRVC 78          
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Match: C1IBY4 (Tabserpin OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 9.529e-17
Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            MK + +I   F   V +  +++ VC  PK  G C   F  F+FN  SG+CE  +YGGC GNEN F+T+EECN KC 
Sbjct:    1 MKVLSLIFVLFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYFNSSSGQCEAFIYGGCGGNENNFNTLEECNAKCA 76          
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Match: C8YJ94 (Serine protease inhibitor 2 OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.706e-16
Identity = 33/75 (44.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MK + +I   F   V +  +++ VC  PK  G C   F  F++N  SG+C+  +YGGC GNEN F+T+EECN KC
Sbjct:    1 MKVLSLIFVIFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYYNSSSGQCQAFIYGGCGGNENNFNTLEECNAKC 75          
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Match: B8QPD3 (Chymotrypsin inhibitor OS=Rhipicephalus microplus OX=6941 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.504e-15
Identity = 30/76 (39.47%), Postives = 47/76 (61.84%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKY-CESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            M ++ ++L   IF        + S+C LP+  G+C  YF +++++  SG C++ +YGGC GNENRFS+ EEC   C
Sbjct:    4 MSALAVLLVLAIFLQNASAHGKPSLCYLPRSRGLCYAYFPSYYYDSSSGTCQDFIYGGCQGNENRFSSREECLRTC 79          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Match: ENSAMXT00000039940.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000999.1:23065:40314:1 gene:ENSAMXG00000037874.1 transcript:ENSAMXT00000039940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 8.515e-13
Identity = 25/54 (46.30%), Postives = 34/54 (62.96%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LPK+EG C  +   +F++  S  C    YGGC GN NRF+T EEC ++C K
Sbjct:  437 ICKLPKEEGTCIKFVLKWFYDSVSNSCTRFWYGGCGGNLNRFNTQEECEKECGK 490          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:103023332])

HSP 1 Score: 61.2326 bits (147), Expect = 2.392e-12
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            VCLLP  EG CRG    +F+N  + +CEE  YGGC GN N F T +EC++ C
Sbjct:   26 VCLLPAVEGPCRGLVSRYFYNTLTQRCEEFSYGGCGGNANNFVTFQECHKMC 77          

HSP 2 Score: 53.5286 bits (127), Expect = 1.827e-9
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            +C  P + G CR     +FFN  + +CE+  YGGC GNEN F + + C E C+
Sbjct:   86 ICRFPSEVGPCRALLSRYFFNMTTMQCEQFYYGGCQGNENNFQSHQSCMEYCR 138          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Match: ENSAMXT00000052324.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000957.1:1173:9398:1 gene:ENSAMXG00000040083.1 transcript:ENSAMXT00000052324.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 4.278e-11
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            CL P   GMCRG F   +F+  +  C+   YGGC GN NR+++ EEC  +CK
Sbjct:  123 CLAPAHTGMCRGSFTMLYFDASTQSCKFFTYGGCGGNRNRYTSEEECMSQCK 174          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Match: ENSAMXT00000002208.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:36140062:36218718:1 gene:ENSAMXG00000002013.2 transcript:ENSAMXT00000002208.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 4.405e-11
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            C LP  EG C  Y   ++FN + G C   VY GC GN NR++  EEC + C
Sbjct: 2228 CALPLDEGDCSRYTLHWYFNSQVGACRPFVYSGCGGNANRYTQKEECEKHC 2278          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Match: spint2 (kunitz-type protease inhibitor 2-like [Source:NCBI gene;Acc:103047885])

HSP 1 Score: 58.5362 bits (140), Expect = 5.681e-11
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            CL P   GMCRG F   +F+  +  C+   YGGC GN NR+++ EEC  +CK
Sbjct:  300 CLAPAHTGMCRGSFTMLYFDASTQSCKFFTYGGCGGNRNRYTSEEECMSQCK 351          

HSP 2 Score: 43.8986 bits (102), Expect = 7.504e-6
Identity = 22/51 (43.14%), Postives = 28/51 (54.90%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            C   K+ G CR     FF+N  SG C+   YGGC GN N + + EEC + C
Sbjct:  223 CQAEKKVGPCRASMPRFFYN--SGTCQRFTYGGCKGNNNNYLSEEECMKTC 271          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 61.2326 bits (147), Expect = 5.099e-13
Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            E +   C LP + G CR  F  +FFN+ + +CE  +YGGC+ NEN F T++EC   C
Sbjct:   21 EDQRVTCTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAAC 77          

HSP 2 Score: 47.3654 bits (111), Expect = 7.676e-8
Identity = 21/52 (40.38%), Postives = 27/52 (51.92%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +C    + G CR +   +F+N   G C   VYGGC GN NRF  +E C   C
Sbjct:   86 LCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESCVFSC 137          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 4.351e-10
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:   82 SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            S C++    G CR Y    F+N+ + +CE   YGGC GN N F ++ ECN KC
Sbjct:    1 SSCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 2 Score: 51.2174 bits (121), Expect = 2.804e-9
Identity = 24/64 (37.50%), Postives = 31/64 (48.44%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*ITPT*LNQK 276
             C L  + G+CR     +FFN  SG CEE  YGGC GN N F     C + C     P  + ++
Sbjct:   74 ACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKR 137          

HSP 3 Score: 45.4394 bits (106), Expect = 3.345e-7
Identity = 19/52 (36.54%), Postives = 26/52 (50.00%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +CL+    G C      F +N ++  CE   YGGC GN+N FS+   C   C
Sbjct:  166 ICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 217          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 4.451e-10
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
Query:   82 SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            S C++    G CR Y    F+N+ + +CE   YGGC GN N F ++ ECN KC
Sbjct:    1 SSCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 2 Score: 50.8322 bits (120), Expect = 3.050e-9
Identity = 24/64 (37.50%), Postives = 31/64 (48.44%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK*ITPT*LNQK 276
             C L  + G+CR     +FFN  SG CEE  YGGC GN N F     C + C     P  + ++
Sbjct:   73 ACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKR 136          

HSP 3 Score: 45.4394 bits (106), Expect = 3.330e-7
Identity = 19/52 (36.54%), Postives = 26/52 (50.00%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +CL+    G C      F +N ++  CE   YGGC GN+N FS+   C   C
Sbjct:  165 ICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 216          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 50.447 bits (119), Expect = 6.798e-9
Identity = 22/61 (36.07%), Postives = 38/61 (62.30%), Query Frame = 1
Query:   61 KYCESRN-SVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            ++C+++  ++C LP  +G CR +   + +N    +C+ +VYGGC GNEN F + E C + C
Sbjct:  389 RWCQNQTVNICHLPPVQGPCRDWERHWAYNPLIKQCQLLVYGGCEGNENNFESREACEDNC 449          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 50.0618 bits (118), Expect = 8.972e-9
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            N+ C LP Q+G C+ +   + +N    +C+  +YGGC GNEN F + E C + C 
Sbjct:  371 NNTCSLPVQQGPCKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDNCP 425          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 69.3218 bits (168), Expect = 2.684e-17
Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 1
Query:   73 SRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            S NS C LPK+ G CR      FFN +SGKCE+ +YGGC GN N F T+EEC + C
Sbjct:    9 SGNSACTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 62.3882 bits (150), Expect = 1.240e-14
Identity = 28/51 (54.90%), Postives = 35/51 (68.63%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            CL PK  G CR YFE +F+N+ S KC++ VYGGC GN N F +  EC +KC
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 62.3882 bits (150), Expect = 1.240e-14
Identity = 28/51 (54.90%), Postives = 35/51 (68.63%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            CL PK  G CR YFE +F+N+ S KC++ VYGGC GN N F +  EC +KC
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Match: EDO41922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S322])

HSP 1 Score: 58.9214 bits (141), Expect = 3.192e-13
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 1
Query:   76 RNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            + S C LP   G C  Y  +F+++ +  KC+E +YGGCNGN NRF T E+C E C
Sbjct:    5 QPSFCSLPAVTGRCMAYIPSFYYDMKEEKCKEFIYGGCNGNLNRFDTQEKCEEAC 59          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Match: EDO38467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV4])

HSP 1 Score: 58.151 bits (139), Expect = 6.329e-13
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LP + G C G+   +F N  SG CE+  Y GC GN NRF T+ +C  KC K
Sbjct:    1 ICDLPAEAGSCDGHMPLYFHNSTSGLCEKFHYSGCEGNANRFPTMRKCQRKCMK 54          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Match: COL6A3 (collagen type VI alpha 3 chain [Source:NCBI gene;Acc:101161016])

HSP 1 Score: 67.781 bits (164), Expect = 3.143e-14
Identity = 26/54 (48.15%), Postives = 35/54 (64.81%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            +C LPKQEG C  +   ++++  S  C    YGGC+GN+NRF T EEC E C+K
Sbjct: 2638 ICQLPKQEGSCAEFALKWYYDTTSKSCTRFWYGGCDGNQNRFDTQEECKEACEK 2691          

HSP 2 Score: 47.3654 bits (111), Expect = 4.766e-7
Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 1
Query:   88 CLLPKQEGM-CRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            C L    GM C+ Y   +++ +++G C +  YGGC GN+NRF +   C ++C
Sbjct: 2551 CSLGFDPGMPCKDYQAKWYYERQNGFCTQFWYGGCGGNDNRFDSEALCLKRC 2602          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:101174930])

HSP 1 Score: 58.151 bits (139), Expect = 4.823e-11
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +C  PK+EG CR  F ++FFN  + +CE   YGGC GN NRF  +  C + C
Sbjct:  143 ICRFPKEEGHCRALFPSYFFNMSTMQCEPFSYGGCGGNSNRFRDLTSCMDFC 194          

HSP 2 Score: 53.9138 bits (128), Expect = 1.697e-9
Identity = 29/73 (39.73%), Postives = 39/73 (53.42%), Query Frame = 1
Query:   34 ILTSFIFFVKYCESRNSV----CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            +LT F  F       + V    CLL   EG CRG  E +F+N  + KCE   YGGC+GN N F + ++C + C
Sbjct:   62 MLTLFALFSSLPGGLSLVPKGACLLRVDEGPCRGQIERYFYNTITQKCEVFYYGGCHGNANNFMSFQKCQKTC 134          

HSP 3 Score: 49.2914 bits (116), Expect = 7.710e-8
Identity = 26/70 (37.14%), Postives = 36/70 (51.43%), Query Frame = 1
Query:   37 LTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            LTS + F    +S   +CL P  +G C      F++NK +  CEE  Y GC G+ N F + E C + C K
Sbjct:  187 LTSCMDFCSPQKSVPILCLDPLDKGKCSASMRRFYYNKATKTCEEFAYSGCGGSSNNFVSRESCEDVCLK 256          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Match: ENSORLT00000012975.2 (pep primary_assembly:ASM223467v1:12:15740273:15760140:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000012975.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 7.278e-11
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:   85 VCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            VC      G+C GYFE +F+N   G+CE  +YGGC GN+N F T +EC ++C
Sbjct:  124 VCAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQRC 175          

HSP 2 Score: 54.6842 bits (130), Expect = 3.642e-10
Identity = 25/61 (40.98%), Postives = 35/61 (57.38%), Query Frame = 1
Query:   55 FVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEK 237
             V    +   VC      G+C GYFE +F+N   G+CE  +YGGC GN+N F T +EC ++
Sbjct:   62 LVSLPSASTGVCAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQR 122          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Match: ENSORLT00000018112.2 (tissue factor pathway inhibitor [Source:NCBI gene;Acc:101174546])

HSP 1 Score: 56.9954 bits (136), Expect = 1.666e-10
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:   79 NSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            N +C +    G CR   + +FFN  + +CEE  YGGC+GN N F T++EC E C
Sbjct:   37 NELCAMKADPGPCRAIKDRYFFNVSTARCEEFEYGGCSGNSNNFVTLQECEETC 90          

HSP 2 Score: 49.6766 bits (117), Expect = 6.796e-8
Identity = 21/52 (40.38%), Postives = 30/52 (57.69%), Query Frame = 1
Query:   88 CLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCK 243
            C L +  G CRG    +FF+ ++ +C    YGGC GN N F ++ EC  KC+
Sbjct:   99 CHLEEAPGPCRGLLSRYFFDSKTRQCRRFFYGGCFGNANNFWSMAECQAKCQ 150          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Match: ENSORLT00000044137.1 (pep primary_assembly:ASM223467v1:2:16334979:16376346:1 gene:ENSORLG00000025630.1 transcript:ENSORLT00000044137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 2.466e-10
Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 1
Query:   70 ESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            + R S+ L+P   G CR Y   ++++K++  C +  YGGCNGN NRF T EEC   C
Sbjct:  955 DPRCSLVLVP---GTCRDYNIRWYYDKQANACAQFWYGGCNGNGNRFDTEEECKRTC 1008          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Match: SMESG000013911.1 (SMESG000013911.1)

HSP 1 Score: 151.754 bits (382), Expect = 2.414e-49
Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            MKS VIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK
Sbjct:    1 MKSFVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 77          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Match: SMESG000013909.1 (SMESG000013909.1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.509e-20
Identity = 39/77 (50.65%), Postives = 47/77 (61.04%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKCKK 246
            M  I+      IF +++ E R   CLL   +G CR  F  FFFN E+GKCEE VYGGC GN+N F T EEC E C+K
Sbjct:    1 MNFIITFSIFVIFAIQFIECRKPECLLEMDQGPCRAAFPMFFFNTETGKCEEFVYGGCLGNDNLFGTYEECQENCEK 77          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Match: SMESG000037999.1 (SMESG000037999.1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.439e-19
Identity = 36/75 (48.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MKS +++L       +  ESR   C  PKQ GMC  YF+ F+FN E+GKCE  +YGGC  N N F T +EC E C
Sbjct:    1 MKSKILVLVVLFSLSQLLESRLKECNEPKQSGMCEAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 75          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Match: SMESG000037999.1 (SMESG000037999.1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.243e-19
Identity = 36/75 (48.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MKS +++L       +  ESR   C  PKQ GMC  YF+ F+FN E+GKCE  +YGGC  N N F T +EC E C
Sbjct:    3 MKSKILVLVVLFSLSQLLESRLKECNEPKQSGMCEAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 77          
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Match: SMESG000037995.1 (SMESG000037995.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.038e-18
Identity = 36/75 (48.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:   16 MKSIVIILTSFIFFVKYCESRNSVCLLPKQEGMCRGYFETFFFNKESGKCEEMVYGGCNGNENRFSTIEECNEKC 240
            MKS +++L       +  ESR   C  PKQ GMC  YF+ F+FN E+GKCE  +YGGC  N N F T +EC E C
Sbjct:    3 MKSKILVLVVLFSLSQLLESRLKECNEPKQSGMCMAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 77          
The following BLAST results are available for this feature:
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TFPI1.095e-1142.86tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI1.095e-1142.86tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI1.756e-1144.44tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
COL6A31.887e-1137.50collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
COL6A31.887e-1137.50collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-61.926e-1346.67Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-61.926e-1346.67Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-61.066e-1245.76Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-61.066e-1245.76Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-61.066e-1245.76Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG28166.661e-1246.43gene:FBgn0031564 transcript:FBtr0300299[more]
IM331.493e-1135.37gene:FBgn0031561 transcript:FBtr0077546[more]
IM331.493e-1135.37gene:FBgn0031561 transcript:FBtr0345610[more]
Ppn5.712e-1146.15gene:FBgn0003137 transcript:FBtr0300337[more]
Ppn5.859e-1146.15gene:FBgn0003137 transcript:FBtr0301839[more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR545476.32.826e-1244.44pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:23915065:2... [more]
col6a32.826e-1244.44collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GE... [more]
col6a32.839e-1244.44collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GE... [more]
tfpi25.977e-1254.72tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
tfpi25.977e-1254.72tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itch1.063e-1243.08itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch1.065e-1243.08itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
itch1.065e-1243.08itchy E3 ubiquitin protein ligase [Source:Xenbase;... [more]
tfpi22.081e-1129.49tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
ric8a5.589e-1040.74RIC8 guanine nucleotide exchange factor A [Source:... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spint33.230e-1243.86serine peptidase inhibitor, Kunitz type, 3 [Source... [more]
Tfpi4.274e-1244.44tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi4.274e-1244.44tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi4.274e-1244.44tissue factor pathway inhibitor [Source:MGI Symbol... [more]
Tfpi6.185e-1244.44tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DMW6|VKT3A_ACTEQ9.096e-1650.91PI-actitoxin-Aeq3a OS=Actinia equina OX=6106 PE=1 ... [more]
sp|P0DMW7|VKT3B_ACTEQ1.586e-1550.91PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 ... [more]
sp|Q8WPI2|BOOH2_RHIMP2.690e-1545.33Boophilin-H2 OS=Rhipicephalus microplus OX=6941 GN... [more]
sp|P0DMX0|VKT3_ANTAF4.207e-1550.88PI-actitoxin-Axm2b OS=Anthopleura aff. xanthogramm... [more]
sp|Q8WPI3|BOOG2_RHIMP1.021e-1442.67Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C8YJ952.657e-1747.37Serine protease inhibitor 3 OS=Tabanus yao OX=4855... [more]
G3MS357.040e-1742.47BPTI/Kunitz inhibitor domain-containing protein OS... [more]
C1IBY49.529e-1746.05Tabserpin OS=Tabanus yao OX=485572 PE=2 SV=1[more]
C8YJ945.706e-1644.00Serine protease inhibitor 2 OS=Tabanus yao OX=4855... [more]
B8QPD32.504e-1539.47Chymotrypsin inhibitor OS=Rhipicephalus microplus ... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039940.18.515e-1346.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tfpi22.392e-1251.92tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
ENSAMXT00000052324.14.278e-1146.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000002208.24.405e-1145.10pep primary_assembly:Astyanax_mexicanus-2.0:13:361... [more]
spint25.681e-1146.15kunitz-type protease inhibitor 2-like [Source:NCBI... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi25.099e-1343.86tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005038.14.351e-1043.40pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.14.451e-1043.40pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
WFIKKN16.798e-936.07WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
WFIKKN18.972e-938.18WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298192.684e-1755.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416961.240e-1454.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262631.240e-1454.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419223.192e-1347.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384676.329e-1346.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL6A33.143e-1448.15collagen type VI alpha 3 chain [Source:NCBI gene;A... [more]
tfpi24.823e-1146.15tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
ENSORLT00000012975.27.278e-1148.08pep primary_assembly:ASM223467v1:12:15740273:15760... [more]
ENSORLT00000018112.21.666e-1044.44tissue factor pathway inhibitor [Source:NCBI gene;... [more]
ENSORLT00000044137.12.466e-1043.86pep primary_assembly:ASM223467v1:2:16334979:163763... [more]
back to top
BLAST of Kunitz-type serine protease inhibitor C4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013911.12.414e-4998.70SMESG000013911.1[more]
SMESG000013909.11.509e-2050.65SMESG000013909.1[more]
SMESG000037999.16.439e-1948.00SMESG000037999.1[more]
SMESG000037999.17.243e-1948.00SMESG000037999.1[more]
SMESG000037995.11.038e-1848.00SMESG000037995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018720 ID=SMED30018720|Name=Kunitz-type serine protease inhibitor C4|organism=Schmidtea mediterranea sexual|type=transcript|length=329bp
ATAAATTGGTAGAACATGAAATCAATTGTAATAATTTTAACTTCCTTCAT
ATTTTTTGTGAAATATTGTGAAAGTCGAAATTCTGTATGTCTTTTACCAA
AACAAGAAGGAATGTGTAGGGGTTACTTTGAAACGTTCTTCTTCAATAAA
GAAAGTGGTAAATGCGAAGAAATGGTGTATGGAGGATGTAATGGAAATGA
AAATAGATTTTCAACAATTGAAGAATGCAATGAAAAGTGTAAAAAATAAA
TAACGCCAACTTAATTAAATCAGAAAATTTGAGAAAATTCTTTTAAAATT
CTTTTATTTTTATCTAAAATTGAATTCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0006508proteolysis
GO:0010951negative regulation of endopeptidase activity
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
GO:0004867serine-type endopeptidase inhibitor activity
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 60..75
score: 47.96
coord: 22..36
score: 34.85
coord: 50..60
score: 54.67
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 23..76
e-value: 2.5E-20
score: 83.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 24..76
e-value: 6.5E-18
score: 64.7
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 25..75
score: 14.471
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 23..76
e-value: 3.28809E-18
score: 68.4306
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 19..77
e-value: 4.1E-21
score: 76.7
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 14..76
NoneNo IPR availablePANTHERPTHR10083:SF328TISSUE FACTOR PATHWAY INHIBITORcoord: 18..76
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 18..76
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.712