Acidic leucine-rich nuclear phosphoprotein 32 family member A

Overview
NameAcidic leucine-rich nuclear phosphoprotein 32 family member A
Smed IDSMED30018716
Length (bp)888
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acidic leucine-rich nuclear phosphoprotein 32 family member A (SMED30018716) t-SNE clustered cells

Violin plots show distribution of expression levels for Acidic leucine-rich nuclear phosphoprotein 32 family member A (SMED30018716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acidic leucine-rich nuclear phosphoprotein 32 family member A (SMED30018716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acidic leucine-rich nuclear phosphoprotein 32 family member A (SMED30018716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018716SMESG000065271.1 SmedASXL_006949SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018716SMESG000065271.1 SmedASXL_006949SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30018716SMESG000065271.1 Contig37540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018716SMESG000065271.1 Contig37540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018716SMESG000081257.1 SMESG000080555.1 SMESG000077456.1 SMESG000074204.1 SMESG000068555.1 SMESG000065302.1 SMESG000065271.1 SMESG000065270.1 SMESG000062997.1 SMESG000055549.1 SMESG000054414.1 SMESG000052064.1 SMESG000048177.1 SMESG000038955.1 SMESG000036077.1 SMESG000026249.1 SMESG000014275.1 SMESG000013145.1 SMESG000010313.1 Contig28899newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018716SMESG000081257.1 SMESG000080555.1 SMESG000077456.1 SMESG000074204.1 SMESG000068555.1 SMESG000065302.1 SMESG000065271.1 SMESG000065270.1 SMESG000062997.1 SMESG000055549.1 SMESG000054414.1 SMESG000052064.1 SMESG000048177.1 SMESG000038955.1 SMESG000036077.1 SMESG000026249.1 SMESG000014275.1 SMESG000013145.1 SMESG000010313.1 Contig28899uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30018716SMESG000065271.1 SMED30018716smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30018716SMESG000065271.1 SMED30018716smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30018716SMESG000065271.1 CUFF.261724.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30018716SMESG000065271.1 dd_Smed_v6_1396_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30018716SMESG000065271.1 dd_Smed_v4_1396_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30018716SMESG000065271.1 H.48.9hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 1 cellSMED30018716SMESG000065271.1 H.48.9hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30018716SMESG000065271.1 SMED_02790_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018716SMESG000065271.1 SMED_02790_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Match: ANP32A (acidic nuclear phosphoprotein 32 family member A [Source:HGNC Symbol;Acc:HGNC:13233])

HSP 1 Score: 91.2781 bits (225), Expect = 1.050e-21
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN++  GLE L + C NL  + LSGNK K L  I+ L + ENLK L+  +C+++ + +YRE VFKLLP+L YLDG +R+ K
Sbjct:   41 FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Match: ANP32A (acidic nuclear phosphoprotein 32 family member A [Source:HGNC Symbol;Acc:HGNC:13233])

HSP 1 Score: 90.8929 bits (224), Expect = 6.578e-21
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN++  GLE L + C NL  + LSGNK K L  I+ L + ENLK L+  +C+++ + +YRE VFKLLP+L YLDG +R+ K
Sbjct:   41 FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Match: ANP32E (acidic nuclear phosphoprotein 32 family member E [Source:HGNC Symbol;Acc:HGNC:16673])

HSP 1 Score: 91.2781 bits (225), Expect = 6.864e-21
Identity = 53/123 (43.09%), Postives = 76/123 (61.79%), Query Frame = 2
Query:  131 CKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            C N  +  +   F  L+ LS+ N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:   29 CVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Match: ANP32E (acidic nuclear phosphoprotein 32 family member E [Source:HGNC Symbol;Acc:HGNC:16673])

HSP 1 Score: 86.2705 bits (212), Expect = 1.877e-19
Identity = 47/103 (45.63%), Postives = 67/103 (65.05%), Query Frame = 2
Query:  188 IVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            + N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:    1 MANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 103          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Match: ANP32B (acidic nuclear phosphoprotein 32 family member B [Source:HGNC Symbol;Acc:HGNC:16677])

HSP 1 Score: 80.8777 bits (198), Expect = 2.900e-17
Identity = 50/113 (44.25%), Postives = 77/113 (68.14%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F NL+ LS++N GL S+   P++  L+KL+LS+N+I  GL+ L +   NL  + LSGNK K +  ++ L + E LK L+  +C+++ + +YRE VFKLLP+L YLDG +RE +
Sbjct:   41 FVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQ 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Celegans
Match: F33H2.3 (Acidic leucine-rich nuclear phosphoprotein 32-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O62220])

HSP 1 Score: 71.633 bits (174), Expect = 1.579e-14
Identity = 42/108 (38.89%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  170 NLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEH---LKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFI-SCDISQIENYREEVFKLLPKLEYLDG 481
            NL+ LS+V  GL++L GFP + +L  LD+SDN++GD       +K   +LK+I L+ NK  +LD ++ L    NL  L+   +  +  +E+YRE++F+++P L+ LDG
Sbjct:   42 NLEMLSMVKCGLTTLAGFPTLPALTYLDISDNQLGDNASFDVLVKNAPDLKKITLASNKL-SLDNLRCLKVLPNLFELDLSNNPSLGLLEDYREKMFEMIPSLKILDG 148          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Celegans
Match: T19H12.2 (Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:O01615])

HSP 1 Score: 68.9366 bits (167), Expect = 1.411e-13
Identity = 41/115 (35.65%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEH---LKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFI-SCDISQIENYREEVFKLLPKLEYLDGENREG 496
             + L+ LS+V  GL++L+G P + +L  LDLSDN++GD       +K    +K+I LSGN+  TLD ++ L    NL  L+   +  +  +++YR ++F+++P L+ LDG + +G
Sbjct:   40 LTKLELLSMVKCGLTTLKGMPVLPALNYLDLSDNELGDDASFDVLIKCAPEIKKITLSGNRL-TLDNVRTLKMLPNLMELDLSNNSSLGLLDDYRVKMFEMIPSLKILDGCDVDG 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Celegans
Match: F09G8.5 (pep chromosome:WBcel235:III:8254975:8257638:1 gene:WBGene00017320.1 transcript:F09G8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09G8.5)

HSP 1 Score: 50.8322 bits (120), Expect = 5.468e-7
Identity = 33/105 (31.43%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  170 NLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLK--FLEFISCDISQIENYREEVFKLLPKLEYLD 478
            N+K L++   G+  ++   ++  LE L LS N++   L  L+ C NLK++ L  N  ++LD+++ L E  NL+  +++   C     + YR +V ++LP L  LD
Sbjct:  119 NVKKLNLWGCGIDDIQVCEKMSLLEVLSLSVNEV-KSLAPLQHCKNLKEVYLRKNCLESLDELEYLKELPNLRTLWIDENPCVGEGGQEYRRKVIRVLPNLTKLD 222          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 46.9802 bits (110), Expect = 8.366e-6
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 2
Query:  146 VADIKVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIG--DGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEF-ISCDISQIENYREEVFKLLPKLEYLDG 481
            +  +   S LK++S+   G+  ++G   + +L+ LDL+DN I   + +E  KG S+L   ++  NK      ++ L + ENL  L   ++   S    YR  V ++LP ++ LDG
Sbjct:  196 IEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSL---MIRKNKLNCWQDVRQLKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLDG 307          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Match: Mapmodulin (gene:FBgn0034282 transcript:FBtr0086822)

HSP 1 Score: 110.153 bits (274), Expect = 2.641e-28
Identity = 52/120 (43.33%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF+NL  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Match: Mapmodulin (gene:FBgn0034282 transcript:FBtr0086823)

HSP 1 Score: 110.153 bits (274), Expect = 2.641e-28
Identity = 52/120 (43.33%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF+NL  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Match: Mapmodulin (gene:FBgn0034282 transcript:FBtr0113091)

HSP 1 Score: 110.538 bits (275), Expect = 1.170e-27
Identity = 52/120 (43.33%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF+NL  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Match: Mapmodulin (gene:FBgn0034282 transcript:FBtr0300410)

HSP 1 Score: 110.538 bits (275), Expect = 1.170e-27
Identity = 52/120 (43.33%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF+NL  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Match: CG15208 (gene:FBgn0030247 transcript:FBtr0073383)

HSP 1 Score: 53.5286 bits (127), Expect = 8.490e-8
Identity = 35/102 (34.31%), Postives = 54/102 (52.94%), Query Frame = 2
Query:  182 LSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFI--SCDISQIENYREEVFKLLPKLEYLDG 481
            L+  N GL+ +    ++  LE L LS NKI   L+ L  C+ LK++ L  N+    D++K L   ++L  L  +   C I+   NYR  V ++LP L+ LD 
Sbjct:   25 LNFCNCGLNDISLCLKMPYLEVLSLSMNKIT-SLKSLVRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAAGSNYRASVLRMLPNLKKLDN 125          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Match: anp32e (acidic (leucine-rich) nuclear phosphoprotein 32 family, member E [Source:NCBI gene;Acc:406562])

HSP 1 Score: 97.8265 bits (242), Expect = 1.063e-23
Identity = 51/107 (47.66%), Postives = 72/107 (67.29%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            F  L+ LS+VN GL+SL   P +  L KL+LSDN I   LE L + C+NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LLP++ YLDG
Sbjct:   41 FKELEFLSMVNVGLTSLAKLPSLPKLRKLELSDNNISGTLETLAEKCANLTYLNLSGNKIKELSTLEALQNLKNLKSLDLFNCEITTLEDYRESIFELLPQVTYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Match: anp32a (acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [Source:NCBI gene;Acc:335907])

HSP 1 Score: 92.4337 bits (228), Expect = 6.207e-22
Identity = 55/113 (48.67%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKG-CSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN+I  GLE L G C NL  + LSGNK K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG ++E K
Sbjct:   50 FEELEFLSTINVGLTSVTNLPKLNKLKKLELSDNRISGGLEVLAGKCPNLTHLNLSGNKIKDLSTIEPLKKLESLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDKEDK 162          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Match: anp32a (acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [Source:NCBI gene;Acc:335907])

HSP 1 Score: 92.0485 bits (227), Expect = 1.759e-21
Identity = 55/113 (48.67%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKG-CSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN+I  GLE L G C NL  + LSGNK K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG ++E K
Sbjct:   41 FEELEFLSTINVGLTSVTNLPKLNKLKKLELSDNRISGGLEVLAGKCPNLTHLNLSGNKIKDLSTIEPLKKLESLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDKEDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Match: anp32b (acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:ZFIN;Acc:ZDB-GENE-030131-719])

HSP 1 Score: 76.6406 bits (187), Expect = 7.758e-16
Identity = 48/107 (44.86%), Postives = 74/107 (69.16%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            F NL+ LS++N GL S+   P++  L+KL+LSDN+I  GL+ L +   NL  + LSGNK K +  ++ L + ++LK L+  +C+++ + +YRE VFKLLP+L YLDG
Sbjct:   41 FVNLEFLSLINVGLLSVSNLPKLGKLKKLELSDNRISGGLDVLAEKLPNLTHLNLSGNKLKDISTLEPLKKLDHLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Match: adgra2 (adhesion G protein-coupled receptor A2 [Source:NCBI gene;Acc:560700])

HSP 1 Score: 50.0618 bits (118), Expect = 2.107e-6
Identity = 40/100 (40.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  173 LKNLSIVNAGLSSLE---------------GFPEIKSLEKLDLSDNKIGD-GLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFL----EFISCD 412
            LKN S   AGLSSLE                F  + +L KLDLS N+IG    E  +G +NL ++ +SGN F +LD   V  E  +LK +    EF+SCD
Sbjct:   11 LKNGSF--AGLSSLEKLDLRNNLISTIMPGAFLGLTALRKLDLSSNRIGCLTPEMFQGLTNLTKLNISGNIFSSLDP-NVFMELHSLKLVNFHSEFLSCD 107          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Match: anp32a (acidic nuclear phosphoprotein 32 family member A [Source:NCBI gene;Acc:549500])

HSP 1 Score: 85.8853 bits (211), Expect = 3.239e-19
Identity = 53/113 (46.90%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N  LSS+   P++  L+KL+LSDN I  GLE L + C NL  + LSGN+ K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG +R+ K
Sbjct:   41 FEGLEFLSTINVCLSSIANLPKLNKLKKLELSDNNISGGLEVLAEKCPNLTHLNLSGNRIKDLSTIEPLKKLEHLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Match: anp32e (acidic nuclear phosphoprotein 32 family member E [Source:NCBI gene;Acc:734114])

HSP 1 Score: 85.5001 bits (210), Expect = 6.404e-19
Identity = 46/112 (41.07%), Postives = 71/112 (63.39%), Query Frame = 2
Query:  161 VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
             +  L+ LS+ N  L SL   P++  L KL+LSDN I  GL+ L + C N+  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+ L ++ YLDG ++E
Sbjct:   40 TYKELEFLSMANVELKSLSKLPKLPKLRKLELSDNSISGGLDVLTERCPNITYLNLSGNKIKDLSTVESLANLKNLKSLDLFNCEITNLEDYRENIFQRLSQITYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Match: hyou1 (hypoxia up-regulated 1 [Source:Xenbase;Acc:XB-GENE-921821])

HSP 1 Score: 83.5741 bits (205), Expect = 3.689e-18
Identity = 52/113 (46.02%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F NL+ LS++N  L S+   P++  L+KL+LSDN+I  GL+ L +  SNL  + LSGNK K +  ++ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG +RE K
Sbjct:   41 FVNLEFLSLINVLLMSVSNLPKLPKLKKLELSDNRISGGLDVLAEKLSNLTHLNLSGNKIKDISTLEPLKKLESLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Match: anp32c (acidic nuclear phosphoprotein 32 family member C [Source:NCBI gene;Acc:395041])

HSP 1 Score: 75.485 bits (184), Expect = 1.762e-15
Identity = 46/107 (42.99%), Postives = 72/107 (67.29%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            F NL+ LS++N  L S+   P++  L+KL+LSDN+I  GLE L +   NL  + LSGNK K ++ ++ L +  +L  L+  +C+++ + NYRE VF+LLP+L +LDG
Sbjct:   41 FENLEFLSMINVNLLSVANLPKLPKLKKLELSDNRISGGLEVLAERTPNLTHLNLSGNKIKEINTLEPLKKLPHLMSLDLFNCEVTMLNNYRESVFELLPQLTFLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:394985])

HSP 1 Score: 52.7582 bits (125), Expect = 3.841e-7
Identity = 35/108 (32.41%), Postives = 59/108 (54.63%), Query Frame = 2
Query:  158 KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            K    LK L + N  +  +E   ++K LE L+L+ N I + +E+L+GC +L+++ L+ N    L  I  L E   L+    +    ++ E YR+ V   LP+L++LDG
Sbjct:   90 KWCRELKILYLQNNLIGKIENVSKLKKLEYLNLALNNI-EKIENLEGCESLQKLDLTVNFVGDLSSINSLQENRQLREFYLVGNPCAEYEGYRQYVVATLPQLKWLDG 196          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Match: Anp32e (acidic (leucine-rich) nuclear phosphoprotein 32 family, member E [Source:MGI Symbol;Acc:MGI:1913721])

HSP 1 Score: 91.6633 bits (226), Expect = 2.020e-21
Identity = 53/123 (43.09%), Postives = 76/123 (61.79%), Query Frame = 2
Query:  131 CKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            C N  +  +   F  L+ LS+ N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:   29 CVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Match: Anp32e (acidic (leucine-rich) nuclear phosphoprotein 32 family, member E [Source:MGI Symbol;Acc:MGI:1913721])

HSP 1 Score: 91.6633 bits (226), Expect = 3.085e-21
Identity = 53/123 (43.09%), Postives = 76/123 (61.79%), Query Frame = 2
Query:  131 CKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            C N  +  +   F  L+ LS+ N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:   29 CVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Match: Anp32e (acidic (leucine-rich) nuclear phosphoprotein 32 family, member E [Source:MGI Symbol;Acc:MGI:1913721])

HSP 1 Score: 86.6557 bits (213), Expect = 5.866e-21
Identity = 47/103 (45.63%), Postives = 67/103 (65.05%), Query Frame = 2
Query:  188 IVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            + N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:    1 MANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 103          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Match: Anp32e (acidic (leucine-rich) nuclear phosphoprotein 32 family, member E [Source:MGI Symbol;Acc:MGI:1913721])

HSP 1 Score: 86.6557 bits (213), Expect = 2.729e-20
Identity = 47/103 (45.63%), Postives = 67/103 (65.05%), Query Frame = 2
Query:  188 IVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            + N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:    1 MANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 103          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Match: Anp32a (acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [Source:MGI Symbol;Acc:MGI:108447])

HSP 1 Score: 86.6557 bits (213), Expect = 5.257e-20
Identity = 53/113 (46.90%), Postives = 77/113 (68.14%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LS+N+I   LE L + C NLK + LSGNK K L  I+ L + ENLK L+  +C+++ +  YRE VFKLLP++ YLDG +R+ K
Sbjct:   44 FEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNK 156          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Match: sp|Q9V895|AN32A_DROME (Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Drosophila melanogaster OX=7227 GN=Anp32a PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.647e-27
Identity = 52/120 (43.33%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF+NL  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Match: sp|Q28XE2|AN32A_DROPS (Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Anp32a PE=3 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 7.582e-27
Identity = 51/120 (42.50%), Postives = 89/120 (74.17%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   ++ L++LS++N GL++L+GFP++ +L+KL+LSDN+I  GL +L     L+ + LSGNK K L+ +K L EF++L  L+  + D +Q++NYRE++FK+LP L +LDG
Sbjct:   23 DNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKSLAVLDLFNNDATQVDNYREKIFKMLPSLNFLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Match: sp|Q6NUW5|AN32E_DANRE (Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Danio rerio OX=7955 GN=anp32e PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.021e-23
Identity = 51/107 (47.66%), Postives = 72/107 (67.29%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            F  L+ LS+VN GL+SL   P +  L KL+LSDN I   LE L + C+NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LLP++ YLDG
Sbjct:   41 FKELEFLSMVNVGLTSLAKLPSLPKLRKLELSDNNISGTLETLAEKCANLTYLNLSGNKIKELSTLEALQNLKNLKSLDLFNCEITTLEDYRESIFELLPQVTYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Match: sp|Q7ZUP0|AN32A_DANRE (Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Danio rerio OX=7955 GN=anp32a PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.328e-20
Identity = 55/113 (48.67%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKG-CSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN+I  GLE L G C NL  + LSGNK K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG ++E K
Sbjct:   41 FEELEFLSTINVGLTSVTNLPKLNKLKKLELSDNRISGGLEVLAGKCPNLTHLNLSGNKIKDLSTIEPLKKLESLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDKEDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Match: sp|Q5XIE0|AN32E_RAT (Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Rattus norvegicus OX=10116 GN=Anp32e PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.805e-20
Identity = 53/123 (43.09%), Postives = 76/123 (61.79%), Query Frame = 2
Query:  131 CKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            C N  +  +   F  L+ LS+ N  LSSL   P +  L KL+LSDN I  GLE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E+YRE +F+LL ++ YLDG ++E
Sbjct:   29 CVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Match: A0A3S3PCR6 (Acidic leucine-rich nuclear phosphoprotein 32 family member B-like isoform X3 (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_13937 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.034e-31
Identity = 63/126 (50.00%), Postives = 95/126 (75.40%), Query Frame = 2
Query:  125 DDCKNSTVADI-KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            D+C+++T+  + + F NLK+LS++N GL+SL+GFP++ +LEKL+LSDN+I  GL  L G   L  + LSGNK K L+ ++ L EF+NLK L+  +CD++ I+NYRE+VF L+P L+YLDG +R+ K
Sbjct:    9 DNCRSTTIVGLTEEFVNLKSLSLINVGLTSLKGFPKLPNLEKLELSDNRILGGLNLLHGSPKLTHLNLSGNKLKDLETLEPLKEFKNLKNLDLFNCDVTSIDNYREKVFNLIPSLKYLDGFDRDDK 134          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Match: A0A443SPV2 (Acidic leucine-rich nuclear phosphoprotein 32 family member B-like isoform X3 OS=Leptotrombidium deliense OX=299467 GN=B4U80_00915 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.137e-30
Identity = 62/126 (49.21%), Postives = 91/126 (72.22%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            D+C+++T+  +   F NLK+LS++N GL+SL GFP++ +LEKL+LSDN+I  GL  L G   L  + LSGNK K LD +  L EF+ LK L+  +CD++ I++YRE+VF L+P L+YLDG +R+ K
Sbjct:    9 DNCRSTTIVGLTDEFCNLKSLSLINVGLTSLRGFPKLPNLEKLELSDNRITGGLNLLHGSPKLTHLNLSGNKIKDLDTLDPLKEFKTLKNLDLFNCDVTSIDSYREKVFNLIPSLKYLDGFDRDDK 134          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Match: A0A0M3JR85 (Uncharacterized protein OS=Anisakis simplex OX=6269 GN=ASIM_LOCUS9954 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.084e-29
Identity = 56/120 (46.67%), Postives = 87/120 (72.50%), Query Frame = 2
Query:  125 DDCKNSTVADI-KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+ +++A + + F++L+ LS++N GL+SL+G P + SL++L++SDN+I  GLE L GC NL  ++LSGNK   +  +  LTE +NL  L+  +CD+S  +NYR +VFK LP L+YLDG
Sbjct:   23 DNCRATSIAGLNEEFTSLQTLSMINVGLTSLKGLPALNSLKRLEVSDNRIAGGLEVLHGCPNLTHLVLSGNKIADIQSLAPLTELKNLISLDLFNCDVSHADNYRADVFKALPNLKYLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Match: K1QRM9 (Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Crassostrea gigas OX=29159 GN=CGI_10011146 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 8.151e-29
Identity = 57/120 (47.50%), Postives = 90/120 (75.00%), Query Frame = 2
Query:  125 DDCKNSTVADI-KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D C+  ++  + + FS L++LS++N GL+SL+GFP +  L+KL+LSDN+I  GL++L+GC NL  + LSGNK K +D ++ L  F  LK L+  +C+++Q+++YRE+VF+LLP L+YLDG
Sbjct:   63 DICRAPSIDGLSEEFSELESLSLINVGLTSLKGFPSLPKLQKLELSDNRIQSGLQNLQGCPNLTHLSLSGNKIKEIDTLEPLKNFSELKHLDLFNCEVTQLDDYREQVFELLPNLKYLDG 182          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Match: A0A1S3HNR7 (acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Lingula unguis OX=7574 GN=LOC106156794 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.162e-28
Identity = 58/120 (48.33%), Postives = 91/120 (75.83%), Query Frame = 2
Query:  125 DDCKNSTVADIKV-FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   F NL++LS++N GL+SL+ FP++ +L+KL+LSDN+I  GLE+L  C+NL  + LSGNK K +  ++ L    NLK L+  +C+++ +ENYREEVF+LLPKL+YLDG
Sbjct:   23 DNCRSTSIEGLTSDFVNLESLSLINVGLTSLKKFPKLTNLKKLELSDNRISCGLENLSECTNLTYLNLSGNKIKDISTLEALQGMPNLKNLDLFNCEVTNLENYREEVFRLLPKLQYLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Match: anp32e (acidic nuclear phosphoprotein 32 family member E [Source:NCBI gene;Acc:103027189])

HSP 1 Score: 97.4413 bits (241), Expect = 1.579e-23
Identity = 51/107 (47.66%), Postives = 70/107 (65.42%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            F  L+ LS+VN GL+SL   P +  L KL+LSDN I   LE L + C NL  + LSGNK K L  ++ L   +NLK L+  +C+I+ +E YRE +F+LLP++ YLDG
Sbjct:   41 FKELEFLSMVNVGLTSLAMLPSLPKLRKLELSDNNISGSLETLSEKCPNLTYLNLSGNKIKELSTVEALQNLKNLKSLDLFNCEITTLEEYRESIFELLPQITYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Match: anp32a (acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [Source:NCBI gene;Acc:335907])

HSP 1 Score: 89.3521 bits (220), Expect = 3.350e-21
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN+I  GLE L + C NL  + LSGNK K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG ++E K
Sbjct:   41 FEELEFLSTINVGLTSVANLPKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLESLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDKEDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Match: anp32a (acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [Source:NCBI gene;Acc:335907])

HSP 1 Score: 89.7373 bits (221), Expect = 3.378e-21
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+S+   P++  L+KL+LSDN+I  GLE L + C NL  + LSGNK K L  I+ L + E+LK L+  +C+++ + +YRE VFKLLP+L YLDG ++E K
Sbjct:   41 FEELEFLSTINVGLTSVANLPKLNKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLESLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDKEDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Match: ENSAMXT00000056868.1 (acidic leucine-rich nuclear phosphoprotein 32 family member B-like [Source:NCBI gene;Acc:103035064])

HSP 1 Score: 76.6406 bits (187), Expect = 5.395e-16
Identity = 50/114 (43.86%), Postives = 76/114 (66.67%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG---ENRE 493
            F NL+ LS++N GL+S+   P++  L+KL+LSDN+I  GLE L +   N+  + LSGNK K L  ++ L     LK L+  +C+++ +++YR  VFKLLP++ YLDG   E+RE
Sbjct:   41 FVNLEFLSLINVGLTSISNLPKLAKLKKLELSDNRISGGLEVLAEKLPNITHLNLSGNKLKDLSTLEPLRNLNRLKSLDLFNCEVTTLDDYRGSVFKLLPQITYLDGYDPEDRE 154          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Match: anp32b (acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:ZFIN;Acc:ZDB-GENE-030131-719])

HSP 1 Score: 75.0998 bits (183), Expect = 7.207e-16
Identity = 48/113 (42.48%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F NL+ LS++N GL S+   P++  L+KL+LSDN+I   L+ L +   NL  + LSGNK K +  ++ L + ++LK L+  +C+++ + +YRE VFKLLP+L YLDG + E +
Sbjct:   41 FVNLEFLSLINVGLISVSNLPKLGKLKKLELSDNRISGSLDVLAEKLPNLTHLNLSGNKLKDISTLEPLKKLDHLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDMEDR 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 48.1358 bits (113), Expect = 1.253e-6
Identity = 31/105 (29.52%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  170 NLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGE 484
            +LK L + N  +  +E    +K LE ++L+ N + + +E+L+GC +L+++ L+ N    L  ++ L     L+ L  +    +  E YR  V   LP+L+ LDG+
Sbjct:   42 HLKTLYLHNNVIPRIENLSRLKELEYINLALNNV-ERIENLQGCESLQKLDLTVNFVGELSSVETLRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQ 145          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 46.595 bits (109), Expect = 3.058e-6
Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  173 LKNLSIVNAGLSSLE----GFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQ-IKVLTEFENLKF----LEFISCDISQIENYR 436
            L NL+I+N   + LE    GF E+K+L+ LDLS NK     E +  C+NL QI LS NK ++L Q  K L +   +      L FI  D+S++ + R
Sbjct:  885 LSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFIG-DLSEMTDLR 980          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Nematostella
Match: EDO41464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S469])

HSP 1 Score: 102.834 bits (255), Expect = 3.264e-27
Identity = 48/120 (40.00%), Postives = 85/120 (70.83%), Query Frame = 2
Query:  125 DDCKNSTVADIK-VFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            D+C+++++  +   F  L+ LS++N GL++L+ FP++ +L KL+LSDN+I  GL++L G   L  + LSGNK K L+ ++ L +  NLK L+  +C+++ +++Y+ +VF+L+P L YLDG
Sbjct:   23 DNCRSTSIVGLTDEFVKLEILSMINVGLTTLKNFPKLPNLRKLELSDNRISSGLQNLTGSPKLTHLSLSGNKIKDLETLEPLEKLSNLKSLDLFNCEVTNVDDYKNKVFELIPSLRYLDG 142          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Nematostella
Match: EDO45841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRY6])

HSP 1 Score: 50.8322 bits (120), Expect = 2.343e-7
Identity = 36/107 (33.64%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  158 KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLD 478
            K   ++KNL+   + LS +    E+ ++E L LS N I   L+    C  LK++ L  N    L +I  L +   L+ L          ENYRE V K LP+L  LD
Sbjct:   16 KSLESVKNLNFWGSSLSDVSLVRELPNVEVLSLSVNSIA-SLKDFAFCPRLKELYLRRNCINDLKEIGFLKKLPKLRVLWLSDNPCCTTENYRETVLKNLPRLIRLD 121          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Nematostella
Match: EDO45144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTT8])

HSP 1 Score: 49.6766 bits (117), Expect = 3.752e-7
Identity = 31/118 (26.27%), Postives = 60/118 (50.85%), Query Frame = 2
Query:  131 CKNSTVADI-KVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGC-SNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLD 478
            CK S + ++         +   +  +  +EGFP +K L+ + L++N++    E L  C  NL+ I+L+ N  + L  ++ L   ++L++L  +   ++   +YR  V   LP+L  LD
Sbjct:   28 CKISVIENMGATLDQFDTIDFSDNDIRKIEGFPLLKRLKTILLNNNRVCRVAEGLGECLPNLESIILTNNAMQELKDLEPLESVKSLRYLSLLRNPVTNKPHYRLFVINSLPQLRVLD 145          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Nematostella
Match: EDO33388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSD9])

HSP 1 Score: 49.6766 bits (117), Expect = 7.151e-7
Identity = 41/131 (31.30%), Postives = 75/131 (57.25%), Query Frame = 2
Query:  128 DCKNSTVADIKVF---SNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIG--DGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFEN---LKFLEFI---SCDISQ-IENYREEVFKLLPKLEYLDGE 484
            D  N  + D+ +    + L  L++ +  ++SL     +K LE LDLS NKI   +G+E+L   +NL  + L+ N   ++D+++ L++ EN   L+  +F+   S  + Q  ++Y++ V ++LP L+ LDGE
Sbjct:   30 DLSNMGIQDLSIVGQCTGLLYLNLSSNNITSLTQLGNLKLLEMLDLSSNKISSLNGMENL---TNLGSVNLASNMVMSIDELQCLSDLENLTKLRLQDFVRKQSNPVCQSTKDYKKRVQEILPNLKVLDGE 157          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Match: anp32e (acidic nuclear phosphoprotein 32 family member E [Source:NCBI gene;Acc:101170937])

HSP 1 Score: 97.0561 bits (240), Expect = 1.080e-23
Identity = 56/126 (44.44%), Postives = 81/126 (64.29%), Query Frame = 2
Query:  137 NSTVADIKV------FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            NS  AD +V      F+ L+ LS+VN GLSSL   P +  L KL+LSDN +   LE L + C NL  + LSGNK K L  ++ L   ++L+ L+  +C+I+ +E+YRE VF+LLP++ YLDG ++E
Sbjct:   26 NSRSADGEVEGLTDEFTELEFLSMVNVGLSSLTKLPPLPKLRKLELSDNNLSGSLETLAEKCPNLTYLNLSGNKIKELSTLEALQNLKSLQSLDLFNCEITSLEDYRESVFELLPQVTYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Match: ENSORLT00000025810.2 (acidic leucine-rich nuclear phosphoprotein 32 family member E [Source:NCBI gene;Acc:101164877])

HSP 1 Score: 95.5153 bits (236), Expect = 2.718e-23
Identity = 51/111 (45.95%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENRE 493
            F+ L+ LS+VN GLSSL   P +  L+KL++S+N IG GL  L + C  L  + LS NK K L  ++ L   + LK L+   CD+S +++YRE VF+LLP+L YLDG ++E
Sbjct:   41 FTELEVLSMVNVGLSSLSKMPLLPKLQKLEVSENSIGGGLNTLVEKCPGLTHLNLSSNKLKELSSLEPLQSLKALKSLDLYGCDVSSLDDYRERVFQLLPQLTYLDGFDQE 151          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Match: ENSORLT00000025081.2 (acidic leucine-rich nuclear phosphoprotein 32 family member B [Source:NCBI gene;Acc:101156393])

HSP 1 Score: 89.3521 bits (220), Expect = 9.425e-21
Identity = 50/107 (46.73%), Postives = 76/107 (71.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            FSNL+ LS++N GL+S+ G P++  L+KL+LSDN+I  GLE L +   NL  + LSGNKFK +  ++ L +   LK L+  +C+++ + +YR+ +FKLLP+L YLDG
Sbjct:   41 FSNLEVLSLINVGLTSMAGIPKLDKLKKLELSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLADYRDSIFKLLPQLTYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Match: ENSORLT00000030046.1 (acidic leucine-rich nuclear phosphoprotein 32 family member B [Source:NCBI gene;Acc:101156393])

HSP 1 Score: 89.3521 bits (220), Expect = 1.279e-20
Identity = 50/107 (46.73%), Postives = 76/107 (71.03%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            FSNL+ LS++N GL+S+ G P++  L+KL+LSDN+I  GLE L +   NL  + LSGNKFK +  ++ L +   LK L+  +C+++ + +YR+ +FKLLP+L YLDG
Sbjct:   41 FSNLEVLSLINVGLTSMAGIPKLDKLKKLELSDNRISGGLEVLAERLVNLTHLNLSGNKFKDISTLEPLKKLPQLKSLDLFNCEVTNLADYRDSIFKLLPQLTYLDG 147          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Match: anp32a (acidic nuclear phosphoprotein 32 family member A [Source:NCBI gene;Acc:101167939])

HSP 1 Score: 79.7221 bits (195), Expect = 4.533e-17
Identity = 52/113 (46.02%), Postives = 75/113 (66.37%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHL-KGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK 499
            F  L+ LS +N GL+++   P++K L+KL+LSDN+I  GLE L + C NL  + LSGNK K L  I  L E   LK L+  +C+++ +  YR+ VFKLLP+L YLDG +++ K
Sbjct:   41 FEELEFLSTINVGLTTVAHLPKLKKLKKLELSDNRISGGLEVLAEKCPNLTHLNLSGNKIKDLSTIGPLKELGALKSLDLFNCEVTNLNEYRDNVFKLLPQLTYLDGYDKDDK 153          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Planmine SMEST
Match: SMESG000065271.1 (SMESG000065271.1)

HSP 1 Score: 369.777 bits (948), Expect = 5.636e-130
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 2
Query:   50 MSSFKERXXXXXXXXXXXXXXXXXXDDCKNSTVADIKVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGKXXXXXXXXXXXXXXXXXXXXFGMADLLKADHSNDFLDDEEPYVPNDNXXXXXXXXXXXXXXXXPVTVLSPAGVAGERRAVKRKVDNGDVENSPCKKSN 793
            MSSFKERIEEVLSSSDESEVSILILDDCKNSTVADIKVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGKEYDYDDDSEYEESNEEEEESFGMADLLKADHSNDFLDDEEPYVPNDNEQEESDESDYSDEEMEPVTVLSPAGVAGERRAVKRKVDNGDVENSPCKKSN
Sbjct:    1 MSSFKERIEEVLSSSDESEVSILILDDCKNSTVADIKVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGKEYDYDDDSEYEESNEEEEESFGMADLLKADHSNDFLDDEEPYVPNDNEQEESDESDYSDEEMEPVTVLSPAGVAGERRAVKRKVDNGDVENSPCKKSN 248          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Planmine SMEST
Match: SMESG000019672.1 (SMESG000019672.1)

HSP 1 Score: 119.398 bits (298), Expect = 2.183e-31
Identity = 60/119 (50.42%), Postives = 87/119 (73.11%), Query Frame = 2
Query:  137 NSTVADIKVFSN----LKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            NS   DI+  SN    L++LS+VN GL SL+ FP + SLEKLDLSDN+I  GLE+LK C  L  + LS NK ++L++IK L++  NL+ L+  +C++S+ ENYR++VF+++P L+YLDG
Sbjct:   27 NSKATDIEGLSNEYKKLRHLSLVNVGLMSLKNFPSLPSLEKLDLSDNRISCGLEYLKCCPKLNHLYLSNNKLRSLNEIKCLSQLPNLETLDLSNCELSESENYRKKVFEMIPSLKYLDG 145          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Planmine SMEST
Match: SMESG000022991.1 (SMESG000022991.1)

HSP 1 Score: 110.923 bits (276), Expect = 8.374e-28
Identity = 52/106 (49.06%), Postives = 77/106 (72.64%), Query Frame = 2
Query:  164 FSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDG 481
            + NL+ LS+VN GL++L+GFP + +LEKLDLSDNKI  GLE+L  C+ + Q+LL+ N+ K +  I+ L  F  L+ L+  +C +S  ENYR+E+F ++P L+YLDG
Sbjct:   40 YINLRELSLVNVGLTTLKGFPSLPNLEKLDLSDNKISTGLENLTKCNKISQLLLTNNRIKNIKDIECLGNFYQLEILDLFNCAVSFEENYRKEIFGIVPTLKYLDG 145          
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Planmine SMEST
Match: SMESG000041196.1 (SMESG000041196.1)

HSP 1 Score: 52.7582 bits (125), Expect = 6.187e-8
Identity = 39/104 (37.50%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  203 LSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFI------SCDISQIENYREEVFKLLPKLEYLDGENREG 496
            L+S+  F     L  LDLS NKI + LE ++ C +L+ + + GN    ++ IK L   ENL  L  +      +  I    NYR ++ K+LPKLE LDGE   G
Sbjct:   58 LNSISDFNCFVKLRVLDLSQNKIFN-LEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNEVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTG 160          
The following BLAST results are available for this feature:
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANP32A1.050e-2147.79acidic nuclear phosphoprotein 32 family member A [... [more]
ANP32A6.578e-2147.79acidic nuclear phosphoprotein 32 family member A [... [more]
ANP32E6.864e-2143.09acidic nuclear phosphoprotein 32 family member E [... [more]
ANP32E1.877e-1945.63acidic nuclear phosphoprotein 32 family member E [... [more]
ANP32B2.900e-1744.25acidic nuclear phosphoprotein 32 family member B [... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F33H2.31.579e-1438.89Acidic leucine-rich nuclear phosphoprotein 32-rela... [more]
T19H12.21.411e-1335.65Acidic leucine-rich nuclear phosphoprotein 32-rela... [more]
F09G8.55.468e-731.43pep chromosome:WBcel235:III:8254975:8257638:1 gene... [more]
K10D2.88.366e-629.57pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapmodulin2.641e-2843.33gene:FBgn0034282 transcript:FBtr0086822[more]
Mapmodulin2.641e-2843.33gene:FBgn0034282 transcript:FBtr0086823[more]
Mapmodulin1.170e-2743.33gene:FBgn0034282 transcript:FBtr0113091[more]
Mapmodulin1.170e-2743.33gene:FBgn0034282 transcript:FBtr0300410[more]
CG152088.490e-834.31gene:FBgn0030247 transcript:FBtr0073383[more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anp32e1.063e-2347.66acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
anp32a6.207e-2248.67acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
anp32a1.759e-2148.67acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
anp32b7.758e-1644.86acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
adgra22.107e-640.00adhesion G protein-coupled receptor A2 [Source:NCB... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anp32a3.239e-1946.90acidic nuclear phosphoprotein 32 family member A [... [more]
anp32e6.404e-1941.07acidic nuclear phosphoprotein 32 family member E [... [more]
hyou13.689e-1846.02hypoxia up-regulated 1 [Source:Xenbase;Acc:XB-GENE... [more]
anp32c1.762e-1542.99acidic nuclear phosphoprotein 32 family member C [... [more]
lrrc63.841e-732.41leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Anp32e2.020e-2143.09acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
Anp32e3.085e-2143.09acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
Anp32e5.866e-2145.63acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
Anp32e2.729e-2045.63acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
Anp32a5.257e-2046.90acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V895|AN32A_DROME2.647e-2743.33Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
sp|Q28XE2|AN32A_DROPS7.582e-2742.50Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
sp|Q6NUW5|AN32E_DANRE8.021e-2347.66Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
sp|Q7ZUP0|AN32A_DANRE1.328e-2048.67Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
sp|Q5XIE0|AN32E_RAT1.805e-2043.09Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S3PCR63.034e-3150.00Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
A0A443SPV21.137e-3049.21Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
A0A0M3JR852.084e-2946.67Uncharacterized protein OS=Anisakis simplex OX=626... [more]
K1QRM98.151e-2947.50Acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
A0A1S3HNR71.162e-2848.33acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anp32e1.579e-2347.66acidic nuclear phosphoprotein 32 family member E [... [more]
anp32a3.350e-2147.79acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
anp32a3.378e-2147.79acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
ENSAMXT00000056868.15.395e-1643.86acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
anp32b7.207e-1642.48acidic (leucine-rich) nuclear phosphoprotein 32 fa... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrrc61.253e-629.52leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CYR13.058e-639.18Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO414643.264e-2740.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458412.343e-733.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451443.752e-726.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333887.151e-731.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anp32e1.080e-2344.44acidic nuclear phosphoprotein 32 family member E [... [more]
ENSORLT00000025810.22.718e-2345.95acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
ENSORLT00000025081.29.425e-2146.73acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
ENSORLT00000030046.11.279e-2046.73acidic leucine-rich nuclear phosphoprotein 32 fami... [more]
anp32a4.533e-1746.02acidic nuclear phosphoprotein 32 family member A [... [more]
back to top
BLAST of Acidic leucine-rich nuclear phosphoprotein 32 family member A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000065271.15.636e-130100.00SMESG000065271.1[more]
SMESG000019672.12.183e-3150.42SMESG000019672.1[more]
SMESG000022991.18.374e-2849.06SMESG000022991.1[more]
SMESG000041196.16.187e-837.50SMESG000041196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018716 ID=SMED30018716|Name=Acidic leucine-rich nuclear phosphoprotein 32 family member A|organism=Schmidtea mediterranea sexual|type=transcript|length=888bp
CCTTGTTTAAGTAGTTAATCATTTCAAAAGTCTGCACCATTTTTTACAAA
TGTCGAGTTTTAAAGAAAGAATAGAAGAAGTTTTGTCGTCATCTGACGAA
TCTGAGGTATCAATCTTAATACTAGATGACTGCAAAAATTCAACTGTTGC
TGACATTAAAGTGTTTTCTAACTTGAAAAATTTGAGCATTGTTAATGCTG
GTTTAAGTTCACTTGAAGGATTTCCAGAAATAAAATCTTTAGAAAAGTTG
GATTTGAGTGATAATAAAATTGGCGACGGGTTAGAACATTTGAAAGGATG
CTCGAATTTAAAGCAAATATTGCTCAGTGGAAATAAATTTAAAACTTTAG
ATCAGATTAAAGTGTTAACTGAATTTGAAAATCTTAAATTTTTGGAATTT
ATAAGTTGCGATATTAGTCAAATTGAAAATTACAGAGAAGAAGTATTTAA
ATTATTGCCTAAGTTGGAATATCTTGATGGTGAGAACAGAGAAGGGAAAG
AATATGATTATGATGATGACTCGGAATACGAAGAGTCGAATGAGGAAGAG
GAAGAAAGTTTTGGTATGGCTGATCTCTTGAAAGCGGATCATTCTAATGA
TTTCCTTGATGACGAAGAACCTTATGTACCAAATGATAACGAACAGGAAG
AATCGGACGAGTCAGATTATTCTGATGAAGAAATGGAACCAGTTACAGTT
TTAAGCCCAGCTGGAGTTGCTGGAGAAAGAAGAGCAGTAAAGCGTAAAGT
TGATAATGGGGATGTTGAAAATTCACCGTGTAAAAAATCAAATTAATTAT
GTATTATGTTAAGATCATTTGTTAAAAGGCATTTAATCATATAATAGACA
ATAAATGTTATTTTGTTAACTGATTTTTTATATTTAAT
back to top

protein sequence of SMED30018716-orf-1

>SMED30018716-orf-1 ID=SMED30018716-orf-1|Name=SMED30018716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MSSFKERIEEVLSSSDESEVSILILDDCKNSTVADIKVFSNLKNLSIVNA
GLSSLEGFPEIKSLEKLDLSDNKIGDGLEHLKGCSNLKQILLSGNKFKTL
DQIKVLTEFENLKFLEFISCDISQIENYREEVFKLLPKLEYLDGENREGK
EYDYDDDSEYEESNEEEEESFGMADLLKADHSNDFLDDEEPYVPNDNEQE
ESDESDYSDEEMEPVTVLSPAGVAGERRAVKRKVDNGDVENSPCKKSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0048471perinuclear region of cytoplasm
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005875microtubule associated complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0006913nucleocytoplasmic transport
GO:0007017microtubule-based process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF14580LRR_9coord: 50..146
e-value: 5.1E-12
score: 45.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 171..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..248
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 189..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 154..170
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..240
NoneNo IPR availablePANTHERPTHR11375:SF2ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32 FAMILY MEMBER Bcoord: 4..209
NoneNo IPR availablePANTHERPTHR11375ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32coord: 4..209
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 19..147
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 2..161
e-value: 2.0E-35
score: 123.4
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 111..132
score: 5.325
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 86..107
score: 6.611
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 41..62
score: 5.425
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 63..85
score: 7.673