solute carrier family 52, riboflavin transporter, member 3

Overview
Namesolute carrier family 52, riboflavin transporter, member 3
Smed IDSMED30018709
Length (bp)1570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of solute carrier family 52, riboflavin transporter, member 3 (SMED30018709) t-SNE clustered cells

Violin plots show distribution of expression levels for solute carrier family 52, riboflavin transporter, member 3 (SMED30018709) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of solute carrier family 52, riboflavin transporter, member 3 (SMED30018709) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for solute carrier family 52, riboflavin transporter, member 3 (SMED30018709) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018709

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018709h1SMcG0011391 Contig41GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018709h1SMcG0011391 PL05001A1H05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30018709h1SMcG0011391 dd_Smed_v4_5546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30018709h1SMcG0011391 dd_Smed_v4_5546_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Match: SLC52A3 (solute carrier family 52 member 3 [Source:HGNC Symbol;Acc:HGNC:16187])

HSP 1 Score: 189.119 bits (479), Expect = 1.625e-53
Identity = 134/451 (29.71%), Postives = 217/451 (48.12%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNG----------------------------TSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRK--YQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  ++QL NI PL+   +H  +     E   I+ +  +G + C + +  WN T  +    +    S+ F +L + L++VD TSSVTFLP++   P +++T  +VGEGLSG +P +V L QG  G   C N T  ++                                +   S+  P     +  F L   +M    +  F L    RC+      L  +Q+ + S     EN       + SS+ +  +   +         F   LVA++N  TNG LPS+Q YS + YG V YH+   +S + NPLA L++++    ++  + +++  G+    Y +  A  SP P++  +  G+++I   W L S   S+ K +L + L+      L  CG   Q+GS LG++++F LV +L  F S  
Sbjct:   16 SWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWV----LDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQG-SGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVVLRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSAD 461          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Match: SLC52A3 (solute carrier family 52 member 3 [Source:HGNC Symbol;Acc:HGNC:16187])

HSP 1 Score: 189.119 bits (479), Expect = 1.625e-53
Identity = 134/451 (29.71%), Postives = 217/451 (48.12%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNG----------------------------TSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRK--YQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  ++QL NI PL+   +H  +     E   I+ +  +G + C + +  WN T  +    +    S+ F +L + L++VD TSSVTFLP++   P +++T  +VGEGLSG +P +V L QG  G   C N T  ++                                +   S+  P     +  F L   +M    +  F L    RC+      L  +Q+ + S     EN       + SS+ +  +   +         F   LVA++N  TNG LPS+Q YS + YG V YH+   +S + NPLA L++++    ++  + +++  G+    Y +  A  SP P++  +  G+++I   W L S   S+ K +L + L+      L  CG   Q+GS LG++++F LV +L  F S  
Sbjct:   16 SWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWV----LDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQG-SGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVVLRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSAD 461          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Match: SLC52A3 (solute carrier family 52 member 3 [Source:HGNC Symbol;Acc:HGNC:16187])

HSP 1 Score: 189.119 bits (479), Expect = 1.625e-53
Identity = 134/451 (29.71%), Postives = 217/451 (48.12%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNG----------------------------TSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRK--YQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  ++QL NI PL+   +H  +     E   I+ +  +G + C + +  WN T  +    +    S+ F +L + L++VD TSSVTFLP++   P +++T  +VGEGLSG +P +V L QG  G   C N T  ++                                +   S+  P     +  F L   +M    +  F L    RC+      L  +Q+ + S     EN       + SS+ +  +   +         F   LVA++N  TNG LPS+Q YS + YG V YH+   +S + NPLA L++++    ++  + +++  G+    Y +  A  SP P++  +  G+++I   W L S   S+ K +L + L+      L  CG   Q+GS LG++++F LV +L  F S  
Sbjct:   16 SWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWV----LDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQG-SGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVVLRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSAD 461          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Match: SLC52A3 (solute carrier family 52 member 3 [Source:HGNC Symbol;Acc:HGNC:16187])

HSP 1 Score: 157.918 bits (398), Expect = 2.062e-42
Identity = 112/388 (28.87%), Postives = 184/388 (47.42%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIG---------------------------GEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRK--YQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIII 1273
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  ++QL NI PL+   +H  +     E   I+ +  +G + C + +  WN T  +    +    S+ F +L + L++VD TSSVTFLP++   P +++T  +VGEGLSG +P +V L QG G                           G P      +       +   S+  P     +  F L   +M    +  F L    RC+      L  +Q+ + S     EN       + SS+ +  +   +         F   LVA++N  TNG LPS+Q YS + YG V YH+   +S + NPLA L++++    ++  + +++  G+    Y +  A  SP P++  +  G+++I
Sbjct:   16 SWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLSEVPIIFTLLGVGTVTCIIFAFLWNMTSWV----LDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASLVSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLI 399          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Match: SLC52A1 (solute carrier family 52 member 1 [Source:HGNC Symbol;Acc:HGNC:30225])

HSP 1 Score: 139.428 bits (350), Expect = 1.521e-35
Identity = 125/444 (28.15%), Postives = 210/444 (47.30%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKE---------KLPVFSASEGQS--------------NKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW  +NG+WVE+P+++ +LPEG  LP+Y+  +V LGN+  L+      +   +  E+  I ++  +  +  ALL+  W+H   +      +  S+ F  L  +L++   TS+VTFLP+L + P  F+ + ++G+GLS  +P ++ L+QG+ G   C       NGT    +   +  P RF  S FF  L  +         LV +   FR        + + S  ++T   S  E+++ S             LP+       +              +    F + L+A+ +  TNG LPS+Q++S +PYG + YH+ V +    NPLAC L +     ++  ++ ++  G L  AY++  A  SP P +     G +++ L W L   +FS+ K   +  L   G   L   GV  QVGS LG+  +F    I + F S +
Sbjct:   23 SWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRQLAPGKG-EQVPIQVVQVLSVVGTALLAPLWHHVAPV----AGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGV-GRLECPPAP--TNGT----SGPPLDFPERFPASTFFWALTAL---------LVTSAAAFRGLL-----LLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRK 440          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Match: rft-1 (Riboflavin transporter rft-1 [Source:UniProtKB/Swiss-Prot;Acc:Q3LFN0])

HSP 1 Score: 151.754 bits (382), Expect = 1.905e-40
Identity = 132/424 (31.13%), Postives = 195/424 (45.99%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEP---NQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQK--QGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            SWI  N +W+E+ LL   LPEG  LP+Y+ AIVQ+  + PLIY  +H   K        I++   + CIC   L  FW+ T  I   G  R  S P ++L++ L++VD  SSV FLP++  +   F+ A +VG GLS  IP ++ LIQG        NKT               YPP       F +  F           L          Q+EP   + I I+   + T+ +       F     +P  S++ G    +  F +L  A +N   NG + S+Q+Y+ + Y    YH  V +S +++PLA  L  +    ++  +  +T   SL  A II  A  SP  I NS   G II      + + L S+ + + A  L++  Q    L  CG   Q+GS  GS ++F LV +   FHS
Sbjct:   18 SWIGTNSVWMELSLLTAKLPEGWNLPSYLSAIVQIACLGPLIYSIIHKGIKMTIPTVPLIFIFMVLACICQLGLCFFWDDTGYI--FGAIR--SWPLYLLLFGLAIVDAISSVLFLPFMAQFHPSFLNAYFVGMGLSALIPSLLSLIQGTSNYWCDDNKT------------PHYYPPRFSVSMFFLINFFFTCAAVAAFLVLYKIGAHKNSSQVEPEPKHSIQIIQGDSTTDVNEVNTESSFQETSSIPDSSSATG---ARLAFLLLTTALVNAQMNGIVTSVQSYATLVYSQNTYHYAVTLSNVISPLASYLQFFVKIRSLPILAFLTLCSSLTTAVIIYLAALSPNWIFNSETAGTIISIASSLIAAGLHSYLRVMFAALLREGNQKESRLFWCGAFIQIGSFTGSAIMFPLVNVWKLFHS 422          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Match: rft-2 (Riboflavin transporter rft-2 [Source:UniProtKB/Swiss-Prot;Acc:G4SDH4])

HSP 1 Score: 122.094 bits (305), Expect = 1.034e-29
Identity = 123/455 (27.03%), Postives = 207/455 (45.49%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVH-CIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVD---NCRCFRKYQLEPNQ-------IDIVSSATITENSSDREIEIFSS----------------KEKLPVFSASEGQSNKKWI------FYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGH---VWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            SW+  N +W+++PLL + LPE   LP+Y+  +VQ+  I PLIY  +H  +K F       I  + S+ C C   LS FW+   +I   G  R  S P + L++ L++V+  S+V F+P++  +   ++ A +VG GLS   P ++ L QG      C  K +           ++ +PP       FF+      V      +L     +       + EPN+       ++  SS+   ++  +  IEI  +                +E+  + +         +I      F +   A +N   NG + S+Q+Y+ +PY    YH  V +S +++PL+  L  +    +I  + I+T   +   A+I+  A  SP  I NS  IG  +      + + L S+ + + A  L ++GH     L  CGV  Q+GS +GS V+F LV I + F S
Sbjct:   18 SWMGTNSVWMQLPLLTSELPEQWNLPSYLAGVVQIACIVPLIYTILHKGVKSFTIPTAPLIIALLSLACCCQLGLSFFWSDYSEI--FGAPR--SWPLYSLLFGLAIVNAMSNVLFMPFMAQFHPAYLNAYFVGMGLSSLAPSLLSLAQGTSMFK-CDEKGV-----------AERFPPNFSVSIFFFVIFSFTCVALFAFIALYRSGAHTHFATPNKKEPNEGTPLKKDLNNTSSSRKGDDEDESPIEIHETGAPAIDAIVSELDVTFRERSAMINDDSEPHPVDYITGVKFTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNSVTIGSALSIGGSLIAAGLHSYLRVVFA-SLLREGHQSESRLFWCGVFIQIGSFIGSAVMFPLVNIAHLFTS 455          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Match: rft-2 (Riboflavin transporter rft-2 [Source:UniProtKB/Swiss-Prot;Acc:G4SDH4])

HSP 1 Score: 79.7221 bits (195), Expect = 1.191e-15
Identity = 47/136 (34.56%), Postives = 77/136 (56.62%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVH-CIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEG 601
            SW+  N +W+++PLL + LPE   LP+Y+  +VQ+  I PLIY  +H  +K F       I  + S+ C C   LS FW+   +I   G  R  S P + L++ L++V+  S+V F+P++  +   ++ A +VG G
Sbjct:   18 SWMGTNSVWMQLPLLTSELPEQWNLPSYLAGVVQIACIVPLIYTILHKGVKSFTIPTAPLIIALLSLACCCQLGLSFFWSDYSEI--FGAPR--SWPLYSLLFGLAIVNAMSNVLFMPFMAQFHPAYLNAYFVGMG 149          

HSP 2 Score: 75.0998 bits (183), Expect = 3.513e-14
Identity = 58/189 (30.69%), Postives = 93/189 (49.21%), Query Frame = 2
Query:  896 DREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGH---VWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            +R   I    E  PV    +  +  K+ F +   A +N   NG + S+Q+Y+ +PY    YH  V +S +++PL+  L  +    +I  + I+T   +   A+I+  A  SP  I NS  IG  +      + + L S+ + + A  L ++GH     L  CGV  Q+GS +GS V+F LV I + F S
Sbjct:  285 ERSAMINDDSEPHPV----DYITGVKFTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNSVTIGSALSIGGSLIAAGLHSYLRVVFA-SLLREGHQSESRLFWCGVFIQIGSFIGSAVMFPLVNIAHLFTS 468          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Match: rft-2 (Riboflavin transporter rft-2 [Source:UniProtKB/Swiss-Prot;Acc:G4SDH4])

HSP 1 Score: 72.7886 bits (177), Expect = 1.091e-14
Identity = 53/164 (32.32%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  971 KWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGH---VWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            K+ F +   A +N   NG + S+Q+Y+ +PY    YH  V +S +++PL+  L  +    +I  + I+T   +   A+I+  A  SP  I NS  IG  +      + + L S+ + + A  L ++GH     L  CGV  Q+GS +GS V+F LV I + F S
Sbjct:   18 KFTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNSVTIGSALSIGGSLIAAGLHSYLRVVFA-SLLREGHQSESRLFWCGVFIQIGSFIGSAVMFPLVNIAHLFTS 180          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Match: rft-2 (Riboflavin transporter rft-2 [Source:UniProtKB/Swiss-Prot;Acc:G4SDH4])

HSP 1 Score: 74.7146 bits (182), Expect = 2.141e-14
Identity = 53/164 (32.32%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  971 KWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGH---VWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            K+ F +   A +N   NG + S+Q+Y+ +PY    YH  V +S +++PL+  L  +    +I  + I+T   +   A+I+  A  SP  I NS  IG  +      + + L S+ + + A  L ++GH     L  CGV  Q+GS +GS V+F LV I + F S
Sbjct:  170 KFTFLLFTTALVNAQMNGIITSVQSYAALPYSQATYHFAVTLSNVVSPLSSFLPFFISVRSIPVLAILTACSTAMTAFIVYLAALSPNLIFNSVTIGSALSIGGSLIAAGLHSYLRVVFA-SLLREGHQSESRLFWCGVFIQIGSFIGSAVMFPLVNIAHLFTS 332          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Fly
Match: Rift (gene:FBgn0039882 transcript:FBtr0085852)

HSP 1 Score: 192.2 bits (487), Expect = 9.968e-55
Identity = 123/424 (29.01%), Postives = 221/424 (52.12%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            +W+ +NG ++++PLL++  PEG  LP+Y+  +VQ+GN+ PL+Y  +      +  + +TI+ +  +G I C L + F+N T  +         SL  F+L    ++   TSSV F+PY+  +   ++   ++GEGLSG +P +  LIQGIG    C    +  +G    +       PPRF   +FFL LF ++V+  V ++L+++    R+   E  Q+ +          +D + +     EKL     S+GQ    + + +LL+  I+ F+NG   SIQ+YS  PYG   YH+   +S I NP+AC + ++    ++  + +++    L  +Y+   A  SPLP ++   +G +++   W L+  + S+ K  +   ++ QG   L   G +TQ+GS +G++ IF  +   + F + +  C
Sbjct:   87 TWLGVNGTFIQLPLLVDEAPEGWSLPSYLSVMVQIGNLGPLLYTAIQKYSPKKLNDGWTIHGVLLVGAISCLLTAFFYNQTASVAG----TDHSLALFLLTCFTALNACTSSVLFMPYMGRFKEQYMVTYFIGEGLSGLLPSVTALIQGIGESGDCVLVNVTESGEEVYALRKT---PPRFDTRVFFLILFALMVLAYVGYALLNSLPLARR---EYAQVTVSEGNKYVYGEADNQPK----AEKL-----SKGQ----YTYLLLLIGAISLFSNGMFGSIQSYSSAPYGSQAYHLAATLSVIANPVACFMAMFLHFTSLRIITVLSILAGLLTSYVFTTAALSPLPPLHDQTVGAVLVVTAWTLLVGIVSYTKLGITTVMRAQGGQSLVWVGAITQLGSAIGAVAIFFAINYSDLFQAAESNC 487          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Match: slc52a3 (solute carrier family 52 member 3 [Source:NCBI gene;Acc:678609])

HSP 1 Score: 239.58 bits (610), Expect = 5.349e-73
Identity = 161/437 (36.84%), Postives = 242/437 (55.38%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKT-IFNNGTSYNSTSSKV---YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATIT-----------ENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            SW+ +NGLWVE+PL++N LPEG  LP+Y+  I+Q  N+ PL+    H     R  E   IY + SIG + C LL+VFWN+T    T+   +  S  FFIL + L++VD TSSVTFLP+++  P  +IT  ++GEGLSG +PG+V L QG+G    C N T + +N T     +  V   Y PP FS  IFF FL VM  + L +F +++  R  R ++L    +   S A  T           + +   E+E   ++  LP        S+ +  F  ++V ++N  TNG LPS+Q +S MPYG + YH+   +S + NP+AC++ ++  + ++  + I+   GS    Y +  A  SP P++   P+GD II L W   + L S+ K ++ + L+ + H  L  CG   Q GS LGSI++F LV + + F S  I
Sbjct:   16 SWVSINGLWVELPLIVNVLPEGWDLPSYLTVIIQFANLGPLLVTLAHKFCPGRLRENLAIYAVLSIGVVACILLAVFWNYT----TVIFGQPRSTAFFILTFFLALVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGLVPGLVALAQGVGMSK-CVNVTNVSDNVTDPGPPTFIVETQYLPPNFSTEIFFSFLAVMTTISLGAFLILN--RLPRTFELSTENLVSDSDAVATVCRGLEGPMDPKTNCPEEVEQKQNEVLLP----KPQHSSYQLAFIYVMVLWVNSATNGLLPSVQTFSCMPYGNMAYHLSAALSAVANPVACIIAMFFPKRSLVFLGILCLLGSTFGGYNMAMAAMSPCPLLQDTPLGDAIIVLSWVFFTGLLSYVKVMVGVILRDRSHSALVWCGAAVQTGSLLGSIIMFPLVNVYHLFKSGDI 441          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Match: slc52a3 (solute carrier family 52 member 3 [Source:NCBI gene;Acc:678609])

HSP 1 Score: 239.58 bits (610), Expect = 5.349e-73
Identity = 161/437 (36.84%), Postives = 242/437 (55.38%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKT-IFNNGTSYNSTSSKV---YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATIT-----------ENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            SW+ +NGLWVE+PL++N LPEG  LP+Y+  I+Q  N+ PL+    H     R  E   IY + SIG + C LL+VFWN+T    T+   +  S  FFIL + L++VD TSSVTFLP+++  P  +IT  ++GEGLSG +PG+V L QG+G    C N T + +N T     +  V   Y PP FS  IFF FL VM  + L +F +++  R  R ++L    +   S A  T           + +   E+E   ++  LP        S+ +  F  ++V ++N  TNG LPS+Q +S MPYG + YH+   +S + NP+AC++ ++  + ++  + I+   GS    Y +  A  SP P++   P+GD II L W   + L S+ K ++ + L+ + H  L  CG   Q GS LGSI++F LV + + F S  I
Sbjct:   16 SWVSINGLWVELPLIVNVLPEGWDLPSYLTVIIQFANLGPLLVTLAHKFCPGRLRENLAIYAVLSIGVVACILLAVFWNYT----TVIFGQPRSTAFFILTFFLALVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGLVPGLVALAQGVGMSK-CVNVTNVSDNVTDPGPPTFIVETQYLPPNFSTEIFFSFLAVMTTISLGAFLILN--RLPRTFELSTENLVSDSDAVATVCRGLEGPMDPKTNCPEEVEQKQNEVLLP----KPQHSSYQLAFIYVMVLWVNSATNGLLPSVQTFSCMPYGNMAYHLSAALSAVANPVACIIAMFFPKRSLVFLGILCLLGSTFGGYNMAMAAMSPCPLLQDTPLGDAIIVLSWVFFTGLLSYVKVMVGVILRDRSHSALVWCGAAVQTGSLLGSIIMFPLVNVYHLFKSGDI 441          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Match: si:ch73-196l6.5 (si:ch73-196l6.5 [Source:ZFIN;Acc:ZDB-GENE-140106-79])

HSP 1 Score: 211.075 bits (536), Expect = 3.845e-62
Identity = 140/432 (32.41%), Postives = 242/432 (56.02%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIF--NNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKW---IFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ + GL+VE+PL++ ++PEG  LP+Y+  I+Q+ NI PL    +H  +     E   IY I + G +   LL+ FW+  + +   G+ R  S+P  +LI+ +S+VD TSSVTFLP++      ++   Y+GEGLSG +P ++ ++QG+G    C N ++   +N + +NS+          Y P  FS+  +F FL  M+V+CLV+F L++      + +  PN     S  +  +N    +  + +S+  +    +S G     W   ++  +++ ++N  TN  LPS+Q+YS +PYG   YH    ++ + NP+AC +T++  + ++  + ++T+ GSL   YI+  A  SP P++     G +II L WFL  ++ S+ K + A+ L+ +GH  L  CG + Q+GS LG++ +F LV + + F S  
Sbjct:   18 SWVTICGLFVELPLIVPHVPEGWYLPSYISVIIQMANIGPLFVTLMHRFRPGTLSETAVIYFIIAFGILASLLLAFFWSERVVVQ--GVER--SVPLLLLIFFISIVDCTSSVTFLPFMTQLKAEYLMTYYIGEGLSGLVPALMAMVQGVGVME-CVNASLILRSNQSHFNSSEENANYLVPSYQPANFSVEAYFFFLTAMMVVCLVAFLLLNYHPAVARER--PNG----SPVSRWKNKKSEKKPMMNSQRTVQKARSSFGTGTYTWVQVVYIYIIITWVNALTNTGLPSVQSYSCLPYGDQAYHWSATMANVANPIACFITIFYTQRSLVLMGVLTSLGSLIGVYIMAMAVLSPCPLLVHDTSGAVIIVLAWFLFILVLSYVKVIAAVILRDEGHSALVWCGAVVQLGSMLGAVTMFPLVNVFDFFTSGD 438          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Match: si:ch73-196l6.5 (si:ch73-196l6.5 [Source:ZFIN;Acc:ZDB-GENE-140106-79])

HSP 1 Score: 211.075 bits (536), Expect = 3.845e-62
Identity = 140/432 (32.41%), Postives = 242/432 (56.02%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIF--NNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKW---IFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ + GL+VE+PL++ ++PEG  LP+Y+  I+Q+ NI PL    +H  +     E   IY I + G +   LL+ FW+  + +   G+ R  S+P  +LI+ +S+VD TSSVTFLP++      ++   Y+GEGLSG +P ++ ++QG+G    C N ++   +N + +NS+          Y P  FS+  +F FL  M+V+CLV+F L++      + +  PN     S  +  +N    +  + +S+  +    +S G     W   ++  +++ ++N  TN  LPS+Q+YS +PYG   YH    ++ + NP+AC +T++  + ++  + ++T+ GSL   YI+  A  SP P++     G +II L WFL  ++ S+ K + A+ L+ +GH  L  CG + Q+GS LG++ +F LV + + F S  
Sbjct:   18 SWVTICGLFVELPLIVPHVPEGWYLPSYISVIIQMANIGPLFVTLMHRFRPGTLSETAVIYFIIAFGILASLLLAFFWSERVVVQ--GVER--SVPLLLLIFFISIVDCTSSVTFLPFMTQLKAEYLMTYYIGEGLSGLVPALMAMVQGVGVME-CVNASLILRSNQSHFNSSEENANYLVPSYQPANFSVEAYFFFLTAMMVVCLVAFLLLNYHPAVARER--PNG----SPVSRWKNKKSEKKPMMNSQRTVQKARSSFGTGTYTWVQVVYIYIIITWVNALTNTGLPSVQSYSCLPYGDQAYHWSATMANVANPIACFITIFYTQRSLVLMGVLTSLGSLIGVYIMAMAVLSPCPLLVHDTSGAVIIVLAWFLFILVLSYVKVIAAVILRDEGHSALVWCGAVVQLGSMLGAVTMFPLVNVFDFFTSGD 438          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Match: zgc:91890 (zgc:91890 [Source:NCBI gene;Acc:431729])

HSP 1 Score: 199.519 bits (506), Expect = 1.161e-57
Identity = 148/444 (33.33%), Postives = 242/444 (54.50%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTI---FNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVD-NCRCFRKYQLEPNQIDI---VSSATITENSSDREIEIFSSKEKLPVFSASEGQ-------------SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIM---TTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NG+WVE+PL++  +PEG  LP+Y+  I+Q+ NI PL    +H  +     ER  IY I ++G +   LL+  W HTL   T G    S+     L +LLSVVD TSSVTFLP+++     ++T  ++GEGLSG +P +V L+QG+ G  +C N +    F+ G    S     Y P  FS   FFLFL  M+++CL +F L++ +    R+++     ID    V    ++++ +D       + E+ P+    EG              S  + +F  +++A++N  TN  LPS+Q+YS +PYG   YH+   +S + NP+AC + ++   V I S+++M   T  G+   AYI+  A  SP P++ +  +G  +I + W +  +  S+ K ++ + L+ +GH  L  CG + Q+GS LG++ +F L+ +   F S  
Sbjct:   16 SWVAINGMWVELPLIVTAIPEGWLLPSYLTIIIQMANIGPLFITLMHRFRPGVLDERPVIYTIVAVGVVATFLLAFLWKHTL---TFGDGEHSAA-LLSLSFLLSVVDCTSSVTFLPFMMRLQPQYLTTYFIGEGLSGLVPALVALVQGV-GVVHCKNASANANFSLGNISQSLLETHYQPANFSTQGFFLFLSAMMMVCLGAFLLLNLHPAVAREHKSMKGYIDDSRRVEKIDLSQSPNDE------TPEQRPMLDFPEGSAIKQRSSFGKGTYSRTELVFIFVVLAWVNALTNAVLPSVQSYSCLPYGNQAYHLAATLSSVANPVACFIAMF---VPIRSLVLMGVLTVTGTGFGAYIMAMAALSPCPLLINDDLGAALIVITWVIFVLSLSYVKVIIGVILRDEGHSALVWCGAVVQLGSMLGALSMFPLISVYRLFQSGD 445          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Xenopus
Match: SLC52A3 (solute carrier family 52 (riboflavin transporter), member 3 [Source:NCBI gene;Acc:100486825])

HSP 1 Score: 212.616 bits (540), Expect = 1.870e-62
Identity = 153/452 (33.85%), Postives = 236/452 (52.21%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTL----KIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKY-QLEPNQIDIVSSATITENSSD-----------REIEIFSSKE--------KLPVFSASEGQ--SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLY-PWR---VTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            +W+ +NGLWVE+PL++N+LPEG  LP+Y+  I+QL NI PL+   +H  K     E  TIY I  +G +   LL+ FW  T     ++H+ G        F +L + LS+VD TSSVTFLP+++     ++T+ +VGEGLSGFIPG++ LIQG+ G   C N T  +NGT   S SS  Y   +           V + + L+   +      F    ++   Q+ + SS T+  +SS              +E+  SK+          P+ +    Q  S  ++     L A++N  TNG LPS+Q YS MPYG + YH+   +  + NPLACL+ ++ P +     +   +I T FG+    Y +++A +SP P++     G  +I + W L     S+ K ++ L L+ Q H  L  CG + Q+GS +G++V+F LV I   F S  +
Sbjct:   16 AWVAINGLWVELPLIVNDLPEGWYLPSYLTIIIQLANIGPLVVTLMHKFKPGWLNEIATIYTIIVLGIVASFLLAFFWRETTWVGGELHSTG--------FLVLTFFLSLVDCTSSVTFLPFMMKLETQYLTSYFVGEGLSGFIPGLLSLIQGV-GIVTCVNVTQSDNGTQTISRSS--YGADQLETQYLPANYSVQVFLFLLCAMMAFCLVAFYSLTRISSKQLLLQSSTTLFHSSSTINSTNPPGTPPGTLELTESKQGDTSAPTMDNPLRTECNTQEISYGQYALIYFLTAWVNALTNGVLPSVQTYSCMPYGNLAYHLSAAVGSMANPLACLIAMFLPCQSLLALVLLSVIGTGFGT----YNMVSAVQSPCPVLQGSDWGVALIVMSWLLFIGSLSYVKVMIGLILRSQSHSALLWCGAVVQLGSMIGALVMFPLVNIYGFFQSADL 452          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Xenopus
Match: syt4 (synaptotagmin 4 [Source:Xenbase;Acc:XB-GENE-5963049])

HSP 1 Score: 155.992 bits (393), Expect = 1.624e-41
Identity = 123/424 (29.01%), Postives = 218/424 (51.42%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCI-KKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQS--NKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +N LWVE+P+++  LPEG  LP ++  ++ LGNI PL     H      R  E + I  + ++  +    L+ FW+  + +       + S+P+ +L +LL++   TS+VTFLP++ ++P+ F+ + ++G+GLS  +P ++ L QG+G       +    NGT + + S   Y    F  S +F  LF  L +  ++F L+   R  R  + E  +         +E+S   +      + + P  +++ GQ     + ++ + L+   N  TNG LPS+Q YS +PYG   YH+ V +S I NP AC + +     +   + ++   G +   Y++  A  SP P +     G +++ LCW L   L S+ K ++   L + GH  L  CG + Q+GS +G++++F +V I + F S +
Sbjct:   21 SWVSVNSLWVELPVVVKELPEGWNLPAFLTVLIALGNIGPLAVTLSHRFCPPGRVSEPWLIRSVQALSLVSAGFLAGFWDRRVLVAG----EERSVPYLLLGFLLALGCCTSNVTFLPFMYSFPQQFVRSFFIGQGLSALLPCVLALGQGVG-------RLECRNGT-WGNHSEPHYLQENFPASSYFWGLFCFLGVSALAFLLLLVLRG-RNKEEEQGEGPTQQGDGGSEDSYPLK-SPEEEQPQEPPDASNRGQRFWTARNVYLLALLGLSNALTNGILPSVQTYSCLPYGPDAYHLSVVLSNIANPAACFIAMCALCRSSLVLGVIMAVGMIFGGYLMFLAALSPCPPLVGSLAGVVLVILCWTLFLGLLSYLKVVIGSLLHEAGHSALLWCGAVIQMGSLVGALLMFPMVSIYHLFQSGR 430          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Xenopus
Match: syt4 (synaptotagmin 4 [Source:Xenbase;Acc:XB-GENE-5963049])

HSP 1 Score: 94.7449 bits (234), Expect = 3.909e-20
Identity = 54/169 (31.95%), Postives = 97/169 (57.40%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCI-KKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSY 700
            SW+ +N LWVE+P+++  LPEG  LP ++  ++ LGNI PL     H      R  E + I  + ++  +    L+ FW+  + +       + S+P+ +L +LL++   TS+VTFLP++ ++P+ F+ + ++G+GLS  +P ++ L QG+ G   C N T  N+   +
Sbjct:   79 SWVSVNSLWVELPVVVKELPEGWNLPAFLTVLIALGNIGPLAVTLSHRFCPPGRVSEPWLIRSVQALSLVSAGFLAGFWDRRVLVAG----EERSVPYLLLGFLLALGCCTSNVTFLPFMYSFPQQFVRSFFIGQGLSALLPCVLALGQGV-GRLECRNGTWGNHSEPH 242          

HSP 2 Score: 92.8189 bits (229), Expect = 1.569e-19
Identity = 54/174 (31.03%), Postives = 93/174 (53.45%), Query Frame = 2
Query:  944 SASEGQS--NKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            +++ GQ     + ++ + L+   N  TNG LPS+Q YS +PYG   YH+ V +S I NP AC + +     +   + ++   G +   Y++  A  SP P +     G +++ LCW L   L S+ K ++   L + GH  L  CG + Q+GS +G++++F +V I + F S +
Sbjct:  315 ASNRGQRFWTARNVYLLALLGLSNALTNGILPSVQTYSCLPYGPDAYHLSVVLSNIANPAACFIAMCALCRSSLVLGVIMAVGMIFGGYLMFLAALSPCPPLVGSLAGVVLVILCWTLFLGLLSYLKVVIGSLLHEAGHSALLWCGAVIQMGSLVGALLMFPMVSIYHLFQSGR 488          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Match: Slc52a3 (solute carrier protein family 52, member 3 [Source:MGI Symbol;Acc:MGI:1916948])

HSP 1 Score: 211.846 bits (538), Expect = 2.895e-62
Identity = 144/445 (32.36%), Postives = 227/445 (51.01%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV--------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQ--------IDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSN--------KKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPE   LP+Y+  ++QL NI PL+   +H  +     E   I+LI  +G   C LL+  WN T  I       Q S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N+  + +         P P +     +L      ++  +  S +  C C   + L   Q         D++ S     +   R+ E  SS    PV S  +G            +  F   +VA++N  TNG LPS+Q YS +PYG V YH+   +S + +PLAC L ++    ++  + ++T  G+   AY +  A  SP P++  +  G+++I L W L +   S+ K +L + L+ +    L  CG   Q+GS +G++++F LV +L  F S  
Sbjct:   16 SWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQG----GQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNTMETPITQGNLSPSLPSPSWHQESRYLAPRFSPLLFFLLLSFLTGC-CLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRPRDTEDTSSLGA-PVSSPGKGSVEASVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEVLIVLSWVLFAACLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSAD 452          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Match: Slc52a3 (solute carrier protein family 52, member 3 [Source:MGI Symbol;Acc:MGI:1916948])

HSP 1 Score: 211.846 bits (538), Expect = 2.895e-62
Identity = 144/445 (32.36%), Postives = 227/445 (51.01%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV--------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQ--------IDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSN--------KKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPE   LP+Y+  ++QL NI PL+   +H  +     E   I+LI  +G   C LL+  WN T  I       Q S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N+  + +         P P +     +L      ++  +  S +  C C   + L   Q         D++ S     +   R+ E  SS    PV S  +G            +  F   +VA++N  TNG LPS+Q YS +PYG V YH+   +S + +PLAC L ++    ++  + ++T  G+   AY +  A  SP P++  +  G+++I L W L +   S+ K +L + L+ +    L  CG   Q+GS +G++++F LV +L  F S  
Sbjct:   16 SWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQG----GQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNTMETPITQGNLSPSLPSPSWHQESRYLAPRFSPLLFFLLLSFLTGC-CLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRPRDTEDTSSLGA-PVSSPGKGSVEASVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEVLIVLSWVLFAACLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSAD 452          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Match: Slc52a3 (solute carrier protein family 52, member 3 [Source:MGI Symbol;Acc:MGI:1916948])

HSP 1 Score: 128.257 bits (321), Expect = 2.301e-33
Identity = 71/175 (40.57%), Postives = 104/175 (59.43%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV 721
            SW+ +NGLWVE+PLL+  LPE   LP+Y+  ++QL NI PL+   +H  +     E   I+LI  +G   C LL+  WN T  I       Q S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N+  + +
Sbjct:   16 SWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQG----GQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNTMETPI 184          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Match: Slc52a3 (solute carrier protein family 52, member 3 [Source:MGI Symbol;Acc:MGI:1916948])

HSP 1 Score: 128.257 bits (321), Expect = 2.301e-33
Identity = 71/175 (40.57%), Postives = 104/175 (59.43%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV 721
            SW+ +NGLWVE+PLL+  LPE   LP+Y+  ++QL NI PL+   +H  +     E   I+LI  +G   C LL+  WN T  I       Q S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N+  + +
Sbjct:   16 SWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQG----GQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNTMETPI 184          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Match: Slc52a2 (solute carrier protein 52, member 2 [Source:MGI Symbol;Acc:MGI:1289288])

HSP 1 Score: 95.5153 bits (236), Expect = 1.544e-20
Identity = 50/151 (33.11%), Postives = 89/151 (58.94%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIG 649
            SW  +NG+WVE+P+++  LPEG  LP+Y+  +V LGN+  L+      + + +  E+  I ++  +G +   LL+  WNH   +      +  S+ F  L ++L++    S+VTFLP+L + P  F+ + ++G+GLS  +P ++ L QG+G
Sbjct:   23 SWAAVNGIWVELPVVVKELPEGWSLPSYLSVLVALGNLGLLLVTLWRRLARGKG-EQVPIRVVQGLGIVGTGLLASLWNHVAPVAG----KPYSVAFLTLAFVLALACCASNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALGQGVG 168          

HSP 2 Score: 72.7886 bits (177), Expect = 3.545e-13
Identity = 59/208 (28.37%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  836 QLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            Q  P Q+     A I  +   +  ++FSS+                    + L+A  N  TNG LP++Q++S +PYG + YH+ V +    NPLAC L +     ++  +  ++  G L  +Y++  A  SP P +     G +++ L W L +  FS+ K  ++  L   G   L   GV  QVGS LG++ +F    I   F S +
Sbjct:  256 QEPPGQV-----AGIVSSPDPKAHQLFSSRSAC----------------LLGLLAITNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSCANPLACFLAMAVLCRSLAGLCGLSLLGMLLGSYLMTLAALSPCPPLVGTSAGVVLVVLSWVLCAGTFSYIKVAISSMLHSGGRPALLAAGVAIQVGSLLGAVAMFPPTSIYRVFRSGK 442          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Match: sp|B0S5Y3|S5A3A_DANRE (Solute carrier family 52, riboflavin transporter, member 3-A OS=Danio rerio OX=7955 GN=slc52a3a PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 3.532e-73
Identity = 160/437 (36.61%), Postives = 243/437 (55.61%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV----YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQI--DIVSSATITENSSD---------REIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            SW+ +NGLWVE+PL++N LPEG  LP+Y+  I+Q  N+ PL+    H     R  E   IY + SIG + C LL+VFWN+T    T+   +  S  FFIL + L++VD TSSVTFLP+++  P  +IT  ++GEGLSG +PG+V L QG+G    C N T  ++  +    S+ +    Y PP FS  IFF FL VM  + L +F +++  R  R ++L    +  D  + AT+     D          E+E   ++  LP        S+ +  F  ++V ++N  TNG LPS+Q +S MPYG + YH+   +S + NP+AC++ ++  + ++  + I+   GS    Y +  A  SP P++   P+GD II L W   + L S+ K ++ + L+ + H  L  CG   Q GS LGSI++F LV + + F S  I
Sbjct:   16 SWVSINGLWVELPLIVNVLPEGWDLPSYLTVIIQFANLGPLLVTLAHKFCPGRLRENLAIYAVLSIGVVACILLAVFWNYT----TVIFGQPRSTAFFILTFFLALVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGLVPGLVALAQGVGMSK-CVNVTNVSDNVTDPGPSTFIVETQYLPPNFSTEIFFSFLAVMTTISLGAFLILN--RLPRTFELSTENLVSDSDAVATVCRGLEDPMDPKTNCPEEVEQKQNEVLLP----KPQHSSYQLAFIYVMVLWVNSATNGLLPSVQTFSCMPYGNMAYHLSAALSAVANPVACIIAMFFPKRSLVFLGILCLLGSTFGGYNMAMAAMSPCPLLQDTPLGDAIIVLSWVFFTGLLSYVKVMVGVILRDRSHSALVWCGAAVQTGSLLGSIIMFPLVNVYHLFKSGDI 441          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Match: sp|B5X4H8|RFT2_SALSA (Riboflavin transporter 2 OS=Salmo salar OX=8030 GN=rft2 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 3.809e-62
Identity = 147/448 (32.81%), Postives = 243/448 (54.24%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTI--FNNGT-SYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEI-FSSKEKLPVFSASEGQ-------------SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLY-PWRVTI---WSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NG+WVE+PL++  +PEG  LP+Y+  ++Q+ N+ PL    +H  +  +  ER  IY I  +G +   LL+ FW HT+ +         S+P  +L +LLSVVD TSSVTFLP+++     ++T  +VGEG+SG +P +V L+QG+ G  +C N T+    NGT   NST          Y P  FS  +FFLFL  M+V+CL +F L+++     + +    + +   +  + E  SD+ + +    +E+ P+ S+ +               S  +  F  +++A++N  TN  LPS+Q+YS +PYG   YH+   ++ + NP+AC + ++ P R  +      I+ T FG+    YI+  A  SP P++     G  +I + W L  +  S+ K ++ + L+ +GH  L  CG + Q+GS LG++ +F LV +   F S  
Sbjct:   16 SWVAINGIWVELPLIVPEIPEGWYLPSYLTVLIQMANVGPLFVTLMHRFRPGKLDERPVIYSIVGLGVVATFLLAFFWKHTVPLAG----ATHSVPLLVLCFLLSVVDCTSSVTFLPFMMRLGPQYLTTYFVGEGVSGLVPAVVALVQGV-GVVHCRNATVASLANGTLGVNSTVGASGELQAQYQPANFSAQVFFLFLSAMMVVCLAAFLLLNHHPAVAREK----KCEQYFNGGLAEEKSDQALSLSHRPQEEKPMISSPDSHRRARQSSFGTGFYSGPELAFIFVVLAWVNALTNAVLPSVQSYSCLPYGNQAYHLAATMAAVANPVACFIAMFLPLRSLVLIGLLTIVGTGFGT----YIMAMATLSPCPLLVHSASGTTLIVIAWVLFVLTLSYVKVIIGVILRDEGHSALVWCGAVVQLGSMLGALSMFPLVSVYGLFKSGD 450          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Match: sp|Q9D6X5|S52A3_MOUSE (Solute carrier family 52, riboflavin transporter, member 3 OS=Mus musculus OX=10090 GN=Slc52a3 PE=1 SV=3)

HSP 1 Score: 211.846 bits (538), Expect = 2.025e-61
Identity = 144/445 (32.36%), Postives = 227/445 (51.01%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV--------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQ--------IDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSN--------KKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPE   LP+Y+  ++QL NI PL+   +H  +     E   I+LI  +G   C LL+  WN T  I       Q S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N+  + +         P P +     +L      ++  +  S +  C C   + L   Q         D++ S     +   R+ E  SS    PV S  +G            +  F   +VA++N  TNG LPS+Q YS +PYG V YH+   +S + +PLAC L ++    ++  + ++T  G+   AY +  A  SP P++  +  G+++I L W L +   S+ K +L + L+ +    L  CG   Q+GS +G++++F LV +L  F S  
Sbjct:   16 SWVAINGLWVELPLLVTELPEAWYLPSYLTVVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQG----GQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNTMETPITQGNLSPSLPSPSWHQESRYLAPRFSPLLFFLLLSFLTGC-CLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRPRDTEDTSSLGA-PVSSPGKGSVEASVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEVLIVLSWVLFAACLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSAD 452          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Match: sp|Q4FZU9|S52A3_RAT (Solute carrier family 52, riboflavin transporter, member 3 OS=Rattus norvegicus OX=10116 GN=Slc52a3 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 5.730e-60
Identity = 151/451 (33.48%), Postives = 232/451 (51.44%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSS----------------------KVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSN--------KKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  ++QL N  PL+   +H  +     E   I+LI  +G   C LL+  W+ T  I      RQ S+ F +L + L++VD TSSVTFLP++   P +++T  ++GEGLSG +P +V L+QG  G   C N T    GT+ N  ++                        Y  PRFS  +FFL L  ++  CLV+F L+      R+  +E    D++ S     +   R+ E   S    PV S  +G            +  F   +VA++N  TNG LPS+Q YS +PYG V YH+   +S + +PLAC L ++    ++  + ++T  G+    Y +  A  SP PI+  +  G+++I L W L     S+ K +L + L+ +    L  CG   Q+GS +G++++F LV +L  F S  
Sbjct:   16 SWVAINGLWVELPLLVTKLPEGWYLPSYLTVVIQLANTGPLLVTLMHRFRPGCLSEVPVIFLILCVGTTACILLAFLWSMTSWIQG----RQHSVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQG-SGITTCVNVT-ETPGTTLNPVTTMETSITQRTLSPSLTPLTWHLESRYLAPRFSPLLFFLLLSFLMGCCLVAFFLLQRQPWGRQGSIE----DLLHSQVTLHSIKPRDTEDTGSVGA-PVSSPGKGSVEVSVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLACFLPIFLPNRSLLFLGVLTVLGTGFGTYNMAMAAMSPCPILQGHWGGEVLIVLSWMLFVACLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSAD 455          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Match: sp|Q5E9R1|S52A3_BOVIN (Solute carrier family 52, riboflavin transporter, member 3 OS=Bos taurus OX=9913 GN=SLC52A3 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.204e-58
Identity = 138/450 (30.67%), Postives = 223/450 (49.56%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXX----------------XXXXXXSLVDNCRCFRKY---QLEPNQ----IDIVSSATITENS------SDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PLL+  LPEG  LP+Y+  I+QL N+ PL+   +H  +     E   ++ +  +G I C L +  WN T  +    +  + S+ F +L + L++VD TSSVTFLP++   P +++T  +VGEGLSG +P +V L QG  G   C N T  +  T    T+  +  P   S ++                          +  +  S +  C CF  +   Q +P +    I+ + ++ +T NS       D      S K + P    +  Q      F  +LVA++N  TNG LPS+Q YS + YG V YH+   +S + +PL C L+++    ++  + ++   G+   AY +  A  SP P +  +  G+++I + W L +   S+ K +L + L+      L  CG   Q+GS LG++V+F LV +L  F S  
Sbjct:   16 SWVAINGLWVELPLLVTELPEGWYLPSYLTVIIQLANVGPLLVTLLHHFRPGCLSEVAVVFTVLGVGTIACTLFAFLWNVTSWV----LGSRHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTTFFVGEGLSGLLPALVALAQG-SGLTTCVNVTEISATTLSPETTRNMDSPQGASSTLVSKLAGTAPSGIHLESRYLPANFSPLVFFLLLSFMMAC-CFISFFFLQRQPKRWEASIEDLLTSQVTLNSIRPQEGKDLGPPEESGKAQDPPEEKTAPQHLAHLTFIYVLVAFVNALTNGVLPSVQTYSCLSYGPVAYHLSATLSSMASPLTCFLSIFLPNRSLPFLGVLAVLGTSFGAYNMAMAVMSPCPFMQGHWGGEVLIVVSWVLFTGCLSYVKVMLGVILRDHSRSALLWCGAAVQLGSLLGAVVMFPLVNVLRLFSSAD 459          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Match: A0A3B3Y216 (Solute carrier family 52 member 3 OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 4.387e-72
Identity = 155/432 (35.88%), Postives = 236/432 (54.63%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLE-----PNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG +LP+Y+  I+QL N+ PL+   +H ++  R  ER  IY + +IG + C LL  FW+ T    T+      S  FFI+ + LS+VD TSSVTFLP+++  P  +IT  ++GEGLSGFIPGI+ L QG+G       K + ++ TS N +  +V      Y PP FS  +FF FL  M+ + L   + V   R  R Y+L      P+ +  VSS      +     +    +EK     A    S  + +F  LLV ++N  TNG LPS+Q YS M YG + YH+   ++ + NP+AC + ++    ++  +  +T  G+    Y +  A  SP P++    +G+ II L W L +   S+ K ++ + L+ + H  L  CG   Q+GS +GS+ +F LV +   F S  
Sbjct:   16 SWVAVNGLWVELPLIVNALPEGWELPSYLTVIIQLANLGPLLVTLMHKLRPGRLNERAVIYSVLAIGIVSCILLVFFWDKT----TVVAGASRSTAFFIITFFLSLVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGFIPGIIALAQGVG-----MAKCVNSSHTSGNHSDEEVWSLQTQYLPPNFSTQVFFSFLAAMMCISLA--AFVGLNRLPRTYELSTENLVPDMVGTVSSGLDNPAAETDGKKSEQGEEKTKALLAEPQHSISQLVFMYLLVVWVNALTNGLLPSVQTYSCMSYGNLAYHLSAALASVANPVACTIAMFFQNRSLMFLRFLTLLGTGFGGYNMAMAALSPCPLLRGSALGEAIIVLSWLLFTGTMSYVKVMVGVILRDRSHSALVWCGAAAQMGSLVGSVTMFPLVNVYRLFKSGD 436          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Match: A0A315WA49 (Uncharacterized protein OS=Gambusia affinis OX=33528 GN=CCH79_00006518 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.680e-71
Identity = 161/432 (37.27%), Postives = 234/432 (54.17%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANK--TIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLE-----PNQIDIVSSA----TITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG +LP+Y+  I+QL N+ PL+   +H ++  R  ER  IY I SIG   C LL  FW+ T    T+      S  FFI+ + LS+VD TSSVTFLP+++  P  + T  ++GEGLSGFIPG++ L QG+G    C N   T  N+      +S   Y PP FS  +FF FL  M+ + L   + V   R  R Y+L      P+ +  VSS      +  +    E E    +EK     A    S  K  F  LLV +IN  TNG LPS+Q YS MPYG + YH+   ++ + NP+AC + ++    ++  + ++T  GS    Y +  A  SP P++    +G+ II L W L +   S+ K ++ + L+ + H  L  CG   Q+GS +GS+ +F LV +   F S  
Sbjct:   16 SWVAVNGLWVELPLIVNALPEGWELPSYLTVIIQLANLGPLLVTLMHKLRPGRLNERAVIYSILSIGIASCILLVFFWDKT----TVVAGASHSTAFFIITFFLSLVDCTSSVTFLPFMMQLPAKYFTTFFIGEGLSGFIPGVIALAQGVG-MAKCVNSSHTSGNHSDEVVWSSQTQYLPPNFSTEVFFSFLAAMMCISLA--AFVGLNRLPRTYELSTENLVPDTVGSVSSGLDNPAVETDGKKSEQE---GEEKSKPLLAEPQYSISKLGFMYLLVFWINALTNGLLPSVQTYSCMPYGNLAYHLSAALASVANPVACTIAMFFQNRSLMFLCVLTVLGSGFGGYNMAMAALSPCPLLRGSALGEAIIVLSWLLFTGTLSYVKVMVGVILRDRSHSALVWCGAAAQMGSLVGSVTMFPLVNVYQLFKSGD 437          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Match: A0A3Q0S6Z5 (Solute carrier family 52 member 3 OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.359e-71
Identity = 157/429 (36.60%), Postives = 238/429 (55.48%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSS--KVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQI--DIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYI----LLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG +LP+Y+  I+QL N+ PL+   +H +      E   IY I SIG + C LL+ FW+ T    T+      S  FF++I+ LS+VD TSSVTFLP+++  P  +IT  Y+GEGLSGFIPG+V L QG+ G   C N +     TS N+T S    Y PP    S    F  +  +MC+   + V   R  R Y+L    +  D V S +   ++S  E +    +    + +       K  ++ +     LVA++N  TNG LPS+Q YS +PYG + YH+  +++ + NPLAC+L ++    ++  + I+T  G+   +Y +  A  SP P+++   +G+ II L W   +   S+ K ++ + L+ Q H  L  CG  TQ+GS +GSI++F LV I   F S  
Sbjct:   16 SWVAVNGLWVELPLIVNTLPEGWELPSYLTVIIQLANVGPLLVTLMHKLNPGCLKENIVIYSILSIGVLSCILLAFFWDRT----TVFAGASHSTAFFVIIFFLSLVDCTSSVTFLPFMMQLPAKYITTYYIGEGLSGFIPGVVALAQGV-GMAICVNSS----ETSGNNTGSLHTEYLPPN--FSTEVFFFILGAMMCISLAAFVALNRLPRIYELSTENLVQDTVPSVSSGLDNSGAETDGERVRNNGEMANQGSHMMAKYSMYQLTIIYFLVAWVNAATNGLLPSVQTYSCIPYGNLAYHLSASLASVANPLACMLAMFFQNRSLIFLGILTVVGTGFGSYNMAMAAMSPCPLLHGTAVGEAIIVLSWLFFTGTLSYVKVMVGVILRDQSHNALVWCGAATQMGSLVGSIIMFPLVNIYRLFKSGD 433          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Match: A0A3B5M6M9 (Solute carrier family 52 member 3 OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.947e-71
Identity = 158/433 (36.49%), Postives = 235/433 (54.27%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQI------DIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG +LP+Y+  I+QL N+ PL+   +H ++  R  ER  IY + SIG   C LL  FW+ T    T+      S  FFI+ + LS+VD TSSVTFLP+++  P  +IT  ++GEGLSGFIPG++ L QG+G       K + ++ TS N +  +V      Y PP FS  +FF FL  M+ + L +   ++  R  R Y L    +       I S        +D +      KEK     A    S  K +F  LLVA++N  TNG LPS+Q YS M YG + YH+   ++ + NP+AC + ++    ++  + ++T  GS    Y +  A  SP P++    +G+ II L W L +   S+ K ++ + L+ + H  L  CG   QVGS +GS+ +F LV +   F S  
Sbjct:   16 SWVAVNGLWVELPLIVNALPEGWELPSYLTVIIQLANLGPLLVTLMHKLRPGRLNERAVIYSVLSIGIASCILLVFFWDKT----TVVAGASRSTAFFIITFFLSLVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGFIPGVIALAQGVG-----MAKCVNSSHTSGNHSDEEVWSLQTQYLPPNFSTEVFFSFLAAMMCISLAASIGLN--RLPRTYDLSTENLVQDTVGPISSGLDNPAAETDGKKNEQEGKEKSKPLLAEPQYSISKLVFMYLLVAWVNALTNGLLPSVQTYSCMSYGNLAYHLSAALASVANPVACTIAMFFQSRSLMFLCVLTVLGSGFGGYNMAMAALSPCPLLRGSALGEAIIVLSWLLFTGTLSYVKVMVGVILRDRSHSALVWCGAAAQVGSLVGSVTMFPLVNVYRLFKSGD 437          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Match: M4AAW2 (Solute carrier family 52 member 3 OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 4.749e-71
Identity = 157/433 (36.26%), Postives = 241/433 (55.66%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLE-----PNQIDIVSSATITENS-SDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG +LP+Y+  I+QL N+ PL+   +H ++  R  ER  IY + SIG   C LL  FW+ T  +   G  R ++  FFI+ + LS+VD TSSVTFLP+++  P  +IT  ++GEGLSGFIPG++ L QG+G       K + ++ TS N +  +V      Y PP FS  +FF FL  M+ + L +   ++  R  R Y+L      P+ +  +SS      + +D +      KEK     A    S  + +F  LLV ++N  TNG LPS+Q YS M YG + YH+   ++ + NP+AC + ++    ++  + ++T  GS    Y +  A  SP P++    +G+ II L W L +   S+ K ++ + L+ + H  L  CG   QVGS +GS+ +F LV +   F S  
Sbjct:   16 SWVAVNGLWVELPLIVNALPEGWELPSYLTVIIQLANLGPLLVTLMHKLRPGRLNERAVIYSVLSIGIASCILLVFFWDKTTVVA--GASRSTA--FFIITFFLSLVDCTSSVTFLPFMMQLPAKYITTYFIGEGLSGFIPGVIALAQGVG-----MAKCVNSSHTSGNHSDEEVWSLQTQYLPPNFSTEVFFSFLAAMMCISLAASIGLN--RLPRTYELSTENLVPDTVGPISSGLDNPAAETDGKKNEQEGKEKSKPLLAEPQYSIPELVFMYLLVVWVNALTNGLLPSVQTYSCMSYGNLAYHLSAALASVANPVACTIAMFFQSRSLMFLCVLTVLGSGFGGYNMAMAALSPCPLLRGSALGEAIIVLSWLLFTGTLSYVKVMVGVILRDRSHSALVWCGAAAQVGSLVGSVTMFPLVNVYRLFKSGD 437          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Cavefish
Match: slc52a3 (solute carrier family 52 member 3 [Source:NCBI gene;Acc:103029106])

HSP 1 Score: 214.927 bits (546), Expect = 1.522e-63
Identity = 148/435 (34.02%), Postives = 242/435 (55.63%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV---YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSN---------KKW--IFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPEG  LP+Y+  I+Q+ N+ PL+    H +   R  E   IY++ ++G + C  L+ FW +T  +  LG  R S+  FF+L + L++VD TSSVTF+P+++  P  +IT+ ++GEGLSGF+PG+V L QG+G    C N +   N +     +  V   Y P  FS   FF FL  M+V+ L++F+L++  R  R Y+L    +   S A I+ +       + +   K       E   +          +W  +F  ++V ++N  TNG LPS+Q YS MPYG + YH+   ++ + NPLAC++ ++  + ++  + I++  GS+   Y +  A  SP P++     G+ II + W   + L S+ K ++ + L+ Q H+ L   G   Q+GS +GS+ +F LV + + F S  
Sbjct:   16 SWVAINGLWVELPLIVNVLPEGWNLPSYLTVIIQMANLGPLLVTVSHKLCPGRLRENLIIYMVLTVGVLACIFLTAFWRYTTVL--LGESRSSA--FFVLTFFLALVDCTSSVTFMPFMMQLPAKYITSYFIGEGLSGFLPGLVALAQGVGMSK-CVNVSQTTNVSQPGEETFSVQTQYLPANFSTEGFFSFLVAMMVVSLIAFALLN--RVPRTYELSSKHLVPKSDAVISVSGGVDNPAMSNPDPKAKTLEDDETDQSSPLMVKPFYSRWELVFIYVMVVWVNGATNGVLPSVQTYSCMPYGNLAYHLAAALALVANPLACIIAMFAPKRSLVFLGILSLLGSVFGGYNMAMAAMSPCPLLQGTTAGEAIIVISWVFFTGLLSYVKVMVGVILRDQSHIALVFYGAAQQLGSLVGSVTMFPLVSVYHLFQSGD 443          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Cavefish
Match: si:ch73-196l6.5 (riboflavin transporter 2-like [Source:NCBI gene;Acc:103037288])

HSP 1 Score: 212.231 bits (539), Expect = 1.600e-62
Identity = 155/445 (34.83%), Postives = 241/445 (54.16%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTS------YNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDRE-------IEIFSSKEKLPVFSASEGQSNKKW-----IFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ + GLWVE+PL++  +PEG  LP+Y+  ++Q+ N+ PL    +H  +  +  E   +Y I S G I   LL  FW  TL++   GI R  S+P  +L + +SVVD TSSVTFLP+++     ++T  YVGEGLSG +P +V LIQG+G    C N T+++N          N +   V      Y P  FS   FF FL  M+++CLV+F L+++     + +L       VS A+  +N  + E       I +   K+ +   S   G     W     IF+IL  A+ N  TN  LPSIQ+YS +PYG   YH    ++ + NPLAC + ++  + ++  + ++T FGS+   YI+  A  SP P +  +  G ++I + W    +  S+ K ++A+ L+ +GH  L  CG + Q+GS LG++++F LV I + F S  
Sbjct:   16 SWVTICGLWVELPLIVPQVPEGWYLPSYLSVLIQVANVGPLFVTLMHRFRPGKLSEVSVVYFIVSFGFIASLLLGFFWKETLEVQ--GIER--SVPLLLLTFFISVVDCTSSVTFLPFMMRLRPEYLTTYYVGEGLSGLVPAVVALIQGVGVMQ-CVNGTLYSNCNETMQLLGKNISEEPVDHLIPHYLPANFSAEAFFFFLAAMMLVCLVAFLLLNHLPSVTRERLNHRTSRNVSRASEEKNKRNLEQKPMMKSISLNGVKKSISS-STRFGSGTYSWAQVVYIFFIL--AWANALTNSVLPSIQSYSCLPYGNQAYHWSATMASVANPLACFIAMFYSQRSLVLMGLLTAFGSVFGVYIMGMAVLSPCPFLVDHVAGVVLIVVAWTCFVLTLSYVKVMVAVILRDEGHSALLWCGAVVQLGSMLGAVIMFPLVNIYSLFSSGD 452          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Cavefish
Match: zgc:91890 (solute carrier family 52, riboflavin transporter, member 3-B-like [Source:NCBI gene;Acc:103037872])

HSP 1 Score: 204.527 bits (519), Expect = 1.120e-59
Identity = 153/439 (34.85%), Postives = 241/439 (54.90%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNST---SSKV---YPPPRXXXXXXXXXXXXXXXXXXXXXSLVD-----NCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKL---PVFSASEGQ-SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIM---TTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NG+WVE+PL++  +PEG  LP+Y+  I+QL NI PL    +H  K     ER  IY I  +G +   LL+  W +TL +         S+    L +LLSVVD TSSVTFLP+++     ++T  +VGEGLSG IP +V LIQG+ G   C N T   N + YNS+   S K+   YPP  FS  +FFLFL  M+V+CL +F +++        C  ++ L+         +   +  +  +  +    + L   P     +G  S  + +F  +++A++N  TN  LPS+Q+YS +PYG   YH+   ++ + NP+AC + ++   V I S+++M   T  G+   AYI+  A  SP P++  Y IG  ++ + W L  +  S+ K ++ + L+++GH  L  CG + Q+GS LG++ +F LV +   F S  
Sbjct:   16 SWVAINGMWVELPLIVPEIPEGWFLPSYLTVIIQLANIGPLFITLMHRFKPGALDERPVIYTIVVVGVVATFLLAFLWKYTLLVGN----AVHSVALLSLSFLLSVVDCTSSVTFLPFMMRLQPQYLTTYFVGEGLSGLIPAVVALIQGV-GLVQCKNATTSANISMYNSSWEASDKLEAHYPPANFSAQVFFLFLSAMMVVCLGAFLMLNYHPSVAKECKHEHYLDEEHRGKTDISLSMQRPAPEQKPMLEPPDDLVNEPRSRFGKGTYSTAEVVFIFVVLAWVNALTNAVLPSVQSYSCLPYGNQAYHLATTMAAVANPVACFIAMF---VPIRSLLLMGVLTLTGTAFGAYIMAMAALSPCPLLVHYDIGAALVVITWVLFVLTLSYVKVIIGVILREEGHSALVWCGAVVQLGSMLGALTMFPLVSVYGLFQSGD 446          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Cavefish
Match: slc52a2 (solute carrier family 52 member 2 [Source:NCBI gene;Acc:103030771])

HSP 1 Score: 177.178 bits (448), Expect = 1.290e-49
Identity = 125/428 (29.21%), Postives = 215/428 (50.23%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSAT---ITENS----SDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SWI +N LWVE+P+++N LPEG  LP Y+  ++  GN+ P+     H     R  ER  I+ I ++  +    L++FW+    +         S+P+ +L ++LS V  TS+VTFLP++  YP  +I   +VG+GLS   P IV L QG+ G+  C       NGT  + T  + +P   F   +F +     L    +++  V      +  Q  P+Q           + +N     S+ ++E+      +  ++ +        I+ +LL+   N  TNG LPS+Q++S +PYG + +H+ V +  I NPLAC + ++    +   + +++  G +  +Y++  A  SP P +     G  ++ + W + + LFS+ K ++   L + GH  L  CGV  Q GS +G++ +F LV + + FH  Q
Sbjct:   23 SWISVNSLWVELPVVVNILPEGWNLPAYLSVLIAFGNLGPVAVTLTHHFAPGRLNERLVIHSIQALAVVASVFLAIFWSRVTTVAG----ELRSVPYLLLAFVLSFVCCTSNVTFLPFMFRYPPEYIRTFFVGQGLSALFPCIVALGQGV-GKLDCIET---GNGTE-SRTYKENFPAEDFFWFLFVMLTVSALCFLALTYRTVKPAEDNKATQ-APDQEQEQKEQGEGHLLQNGGSPVSEEQVEVVKQAPAVSFWTLNN-------IYLLLLLGISNALTNGVLPSVQSFSCLPYGNMAFHLSVVLGNIANPLACFVAMFVLLRSNAGLGVLSLAGGVFASYLLALAVLSPCPPLLGSNAGVTLVVISWIIFTGLFSYLKVVVGSLLHEAGHAALLWCGVFIQAGSLIGALSMFPLVSVYHVFHRAQ 433          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Sea Lamprey
Match: slc52a3 (solute carrier family 52 member 3 [Source:NCBI gene;Acc:678609])

HSP 1 Score: 170.244 bits (430), Expect = 3.768e-48
Identity = 128/386 (33.16%), Postives = 199/386 (51.55%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYC------ANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKY---------------------QLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIII 1273
            SW+ +NG+WVE+P+L+  +PEG  LP+Y+  ++QL N+ PL     H  +     E   IY I ++G + C LL+  W+ T  I   G  R ++L    L + LS+VD TSSVTFLP+++     ++T+ YVGEGLSG +PG+V L QG G           AN T  +NGT      ++ Y  P FS  IFFL L  M+   + +F ++++    R+                      Q EP+Q +  S+    E S+      F   E     S +E    K ++   L++A+ N  TNG LPS+Q+YS +PYG   YH+   ++ + NP+AC + ++    +   + ++T  GS+  AYI+  A  SP P++     G I+I
Sbjct:   16 SWVAINGMWVELPVLVPQIPEGWYLPSYLTVLIQLANVGPLAITLAHRFRPGCMDEVPIIYAILALGAVACLLLAFLWDRTTVIA--GADRSTAL--LALTFFLSLVDCTSSVTFLPFMMRLQPGYMTSYYVGEGLSGLLPGLVALGQGAGFSTCVNVSLADANGTAGDNGTLIYEVQTE-YQAPNFSPQIFFLILCGMMAASMAAFVMLNHLPLARREYSHEGLQNLGSRRHGEVTAAGQREPSQRE--SNGVSLEPSALDTTHTFDVLESP---SIAEYVGIKYFVAIFLILAWANGLTNGVLPSVQSYSCLPYGNTAYHLSATLAALANPIACFVAIFKPSRSQLVLSMLTLLGSVFGAYILAMAIMSPCPLLLGTDAGTILI 391          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Nematostella
Match: EDO43831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE4])

HSP 1 Score: 177.948 bits (450), Expect = 2.916e-50
Identity = 146/446 (32.74%), Postives = 219/446 (49.10%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIY-MGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGT--SYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXS-LVDNCRCFRKYQ---LEPNQ---IDIVSSATITEN-----------SSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLV-AYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            SW+ LNG+WVE+P+ + + PE   LP+Y+  IVQL NI P++Y  G H  K   N E   I LI +IG + C LL+ FW+ T    +L      S     L + LS+VD TSSV FL ++  +P  ++TAL++GE LSG +P  V L QGI G+P   N T+  N T    +  S+ +Y            F F+  +M +   S L  N   F K Q     P+       V+   ++EN           SSD         E++P     +   + + + Y+L V  +IN   NG LPS Q Y+  PYG   YH+ V ++ I N L C+L L+    +   V I     ++   Y++L A  SP P + +  +G II+     +   L ++ K  +   ++K+G   L  CGV  Q GS +G++VIF +V +   FH  +  C
Sbjct:   11 SWVALNGIWVELPIFVKHAPEAWNLPSYLAIIVQLANIGPIVYGFGNHWAKNVCN-EWTAIPLIVTIGAVSCFLLAYFWDRT----SLLFGANHSTALLALSFTLSLVDCTSSVVFLTFIGTFPAPYLTALFIGETLSGMLPSFVALGQGI-GDP--CNSTLIQNTTILVNDFESTDLYVGKGLKFGPEEFFFFLFSMMVVCGLSFLALNVLPFAKRQQILQRPDHRTNFSEVNRHLLSENEFVSYGPHGSISSDTSAP---DDEQVPPAIVYQPNCSSRQVVYLLFVQVWINGLANGVLPSTQAYACQPYGSQAYHLAVTLTSISNALTCVLALWLPSQSTSIVTIFACIYNILSGYLLLLASLSPTPPLYNTLMGSIIMVTVSVVSGSLITYTKLTICTIMKKKGQRALFWCGVAIQAGSCIGALVIFPVVNVAKAFHQAKQQC 445          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Nematostella
Match: EDO36685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT7])

HSP 1 Score: 168.703 bits (426), Expect = 6.030e-47
Identity = 127/423 (30.02%), Postives = 230/423 (54.37%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIY-MGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIG---GEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS 1453
            +WI +NGLWVE+P+++  +PE   LP+Y+  I+QL NI PL + +G   + +F   E    Y +  IG +  ALL+ FW  T  I+  G  R ++L   IL + LS+VD TSSV F+PY+  +P  +++  ++GEGLSG +P +V L QG+G       C  + ++N+ ++  S S    P PRF+  +FF FL VM+  C ++F  ++  +  +K Q++  + D+ +S    +    +EI    ++    +       + ++ +F ++++A +N  +NG +P+IQ+Y+ +PY   +YH+ + +S I NP+ CL+       +I  +  +     +   YII+ A +SP  ++     G  +I +       + ++ K  ++  ++ QG   L   G+ TQ+GS +G++ IF+ V +   F  
Sbjct:   14 AWIAVNGLWVELPIIVQEIPESWSLPSYLTVIIQLANIGPLAFTLGNKFLPRFVK-EIPVTYALVVIGVLASALLAHFWKET--IYIAGADRSAAL--LILAFFLSMVDCTSSVAFIPYMSRFPMVYLSPYFLGEGLSGLLPSLVALAQGVGEGASNERCVAQPVYNSSSNSTSGSWG--PGPRFTPKVFFWFLSVMMACCGLAFLALNTLQVTKKQQVKEREYDVTTS----DMHELQEISKTEAQSTSDIQVTDNILTTRQNVFLLVILAIVNGLSNGIIPAIQSYACIPYSYYIYHLTLTLSNIANPITCLMFPLLRVKSIPVITFLCGVYCVMCTYIIIIASQSPDVLLRCGDTGAALIVVISVSSVAMVTYCKVAISSLMRNQGRKKLLWFGISTQLGSCIGALSIFVPVNVYYMFKQ 425          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Nematostella
Match: EDO27376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9F1])

HSP 1 Score: 48.9062 bits (115), Expect = 1.767e-7
Identity = 29/86 (33.72%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  980 FYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYP-WRV-TIWSVIIMTTFGSLGVAYIILAACKSP 1231
            F ++++A +N  +NG +P+IQ+Y+ +PY   +YH+ + +S I NP+ CL  ++P  RV +I  +  +     +   YII+ A +SP
Sbjct:    1 FLLVILAIVNGLSNGIIPAIQSYACIPYSYYIYHLTLTLSNIANPITCL--MFPLLRVKSIPVITFLCGVYCVMCTYIIIIASQSP 84          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Match: slc52a3 (solute carrier family 52 member 3 [Source:NCBI gene;Acc:101172243])

HSP 1 Score: 233.417 bits (594), Expect = 1.015e-70
Identity = 152/431 (35.27%), Postives = 239/431 (55.45%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIG-GEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATIT---ENS---SDREIEIFSSKE--KLPVFSASEGQSNKKWIFYI-LLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++N LPE  +LP+Y+  I+QL N+ PL+   +H     R  ERF IY I SIG + C LL+ FW  T    T+      S  FFI+ + LS+VD TSSVT LP+++  P  +IT  ++GEGLSGFIPG++ L QG+G  +   ++KT  N+      +    Y  P    S    F F+  +MC+   + +   R  R Y+L    +   ++A+++   +NS   +D  ++  S+ +  +LP    +E Q +K  + YI  LV ++N  TNG LPS+Q YS MPYG + YH+   +S + NP+AC + ++    ++  + ++T  G+    Y +  A  SP P++    +G+ +I L W   +   S+ K ++ + L+   H  L  CG   Q+GS +GSI +F LV I + F S  
Sbjct:   16 SWVAINGLWVELPLIVNTLPEAWELPSYLTVIIQLANLGPLLVTVMHKQCPGRLNERFVIYFILSIGVVSCVLLAFFWERT----TIVAGAPHSTAFFIITFFLSLVDCTSSVTSLPFMMQLPAKYITTYFIGEGLSGFIPGVIALAQGVGIAKCVNSSKTHGNHTDEEQWSMQTEYLSPN--FSTQVFFFFLAAMMCVSLAAFIGLNRLPRTYELSTENLVQDTAASVSSGLDNSGADTDGGVDKSSAAKSGQLP----AELQPSKYQLIYIYCLVVWVNSSTNGLLPSVQTYSCMPYGNLAYHLSAALSSVANPVACTIAMFFQNRSLIFLGVLTLLGTGFGGYNMAMAAMSPCPLLIGSAVGEAVIVLSWLFFTGTLSYVKVMVGVILRDHSHSALVWCGAAAQMGSLVGSITMFPLVNIYHLFKSGD 436          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Match: zgc:91890 (riboflavin transporter 2 [Source:NCBI gene;Acc:101172718])

HSP 1 Score: 214.542 bits (545), Expect = 1.898e-63
Identity = 144/438 (32.88%), Postives = 233/438 (53.20%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSS------KVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQ----------SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            SW+ +NG+WVE+PL++   PE   LP+Y+  ++Q+ NI P     +H  +     ER  IY I  +G +   LL+ FW HT+ I   G  R  S+P  IL +LLSVVD TSSVTFLP+++     ++T  + GEGLSG +P +V L+QG+G    C N T+  + ++ NS+S         Y P +FS+ +FF+ L +M+V+ LV+F L+++     + +               E S     +    K  L     + G+          SN +  F  +++A++N  TN  LPS+Q +S +PYG   YH+   ++ + NP+AC + ++    ++  +  +T FGS   AYI+  A  SP P++     G  +I L W L  +  S+ K ++ + L+ +GH  L  CG + Q+GS LG++ +F LV +   F S  +
Sbjct:   16 SWVAINGMWVELPLVVEKAPEMWLLPSYLTVLIQMANIGPFFVTLMHRFRPGVLDERPVIYFIVVLGIVSTFLLAFFWEHTVMIA--GSLR--SVPLLILSFLLSVVDCTSSVTFLPFMMTLRPQYLTTYFAGEGLSGLVPALVALVQGVGVVD-CENATLHGDTSTGNSSSVGSGELIAKYQPAKFSVQVFFVLLSIMMVVSLVAFILLNHHPAVARERKREQYFFEDQENKKREQSLSLHAQTPEQKPMLGPLEGATGEPRSSFGKGTYSNLEVAFIFVVLAWVNALTNAVLPSVQTFSCLPYGNKAYHLAATMAAVANPVACFIAMFVPIRSLAFMCFLTVFGSGTGAYIMAMAALSPCPLMVHSTSGTAVIVLAWILFVLSLSYVKVIIGVILRDEGHSALVWCGAVVQLGSMLGALSMFPLVSVYGLFKSGDV 448          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Match: zgc:91890 (riboflavin transporter 2 [Source:NCBI gene;Acc:101172718])

HSP 1 Score: 214.542 bits (545), Expect = 8.786e-63
Identity = 144/438 (32.88%), Postives = 233/438 (53.20%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSS------KVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQ----------SNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQI 1462
            SW+ +NG+WVE+PL++   PE   LP+Y+  ++Q+ NI P     +H  +     ER  IY I  +G +   LL+ FW HT+ I   G  R  S+P  IL +LLSVVD TSSVTFLP+++     ++T  + GEGLSG +P +V L+QG+G    C N T+  + ++ NS+S         Y P +FS+ +FF+ L +M+V+ LV+F L+++     + +               E S     +    K  L     + G+          SN +  F  +++A++N  TN  LPS+Q +S +PYG   YH+   ++ + NP+AC + ++    ++  +  +T FGS   AYI+  A  SP P++     G  +I L W L  +  S+ K ++ + L+ +GH  L  CG + Q+GS LG++ +F LV +   F S  +
Sbjct:   72 SWVAINGMWVELPLVVEKAPEMWLLPSYLTVLIQMANIGPFFVTLMHRFRPGVLDERPVIYFIVVLGIVSTFLLAFFWEHTVMIA--GSLR--SVPLLILSFLLSVVDCTSSVTFLPFMMTLRPQYLTTYFAGEGLSGLVPALVALVQGVGVVD-CENATLHGDTSTGNSSSVGSGELIAKYQPAKFSVQVFFVLLSIMMVVSLVAFILLNHHPAVARERKREQYFFEDQENKKREQSLSLHAQTPEQKPMLGPLEGATGEPRSSFGKGTYSNLEVAFIFVVLAWVNALTNAVLPSVQTFSCLPYGNKAYHLAATMAAVANPVACFIAMFVPIRSLAFMCFLTVFGSGTGAYIMAMAALSPCPLMVHSTSGTAVIVLAWILFVLSLSYVKVIIGVILRDEGHSALVWCGAVVQLGSMLGALSMFPLVSVYGLFKSGDV 504          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Match: si:ch73-196l6.5 (riboflavin transporter 2 [Source:NCBI gene;Acc:101174357])

HSP 1 Score: 202.601 bits (514), Expect = 5.695e-59
Identity = 150/434 (34.56%), Postives = 237/434 (54.61%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVD-NCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKW--IFYIL-LVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTF---GSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++  +PEG  LP+Y+  ++Q+ N+ PL    +H  +     E   IY+I S+G I   LL  FW  TL +   G  R  S+   +L + L+VVD TSSVTFLP++++    ++T  ++GEG+SG +P +V LIQG+ G  +C N T   N T    +++ V      Y P  FS  +FF FL  M+++CLV+F L++ +    R++  +     +          S +   I   +       +S G     W  +FYI  +++++N  TN ALPS+Q+YS MPYG   YH+   ++ + NP+AC + L+   V I S++ M T    GS   AYI+  A  SP P++ +   G  ++ L W    +  S+ K ++ L L+ +GH  L  CG + Q+GS LG+I +F LV + + F S  
Sbjct:   16 SWVSINGLWVELPLIVPQIPEGWYLPSYLSILIQMANVGPLFITLMHRFRPGALNETAAIYVIISLGSIATFLLGFFWKETLVVA--GAPR--SVALLVLTFFLAVVDCTSSVTFLPFMMHLKPQYLTTYFIGEGVSGLLPALVALIQGV-GVVHCKNSTHLLNQTFTTFSNAVVVELQAQYQPANFSAEVFFFFLSAMMLVCLVAFLLLNYHPSVAREHPTKRYTNGVKEPCQKGRMCSAQRSMIDPYRPAKQRRKSSFGTGVYSWWQVFYIFAILSWVNALTNTALPSVQSYSCMPYGNNAYHLSATLAAVSNPMACFIALF---VPIRSLVFMGTLTVVGSAVGAYIMGMAVLSPCPLLVNDTSGGAVMVLAWIFFILSLSYVKVIIGLILRDEGHSALVWCGAVVQLGSLLGAITMFPLVSVYDLFTSGD 441          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Match: si:ch73-196l6.5 (riboflavin transporter 2 [Source:NCBI gene;Acc:101174357])

HSP 1 Score: 202.986 bits (515), Expect = 6.337e-59
Identity = 150/434 (34.56%), Postives = 237/434 (54.61%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKV------YPPPRXXXXXXXXXXXXXXXXXXXXXSLVD-NCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKW--IFYIL-LVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTF---GSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQ 1459
            SW+ +NGLWVE+PL++  +PEG  LP+Y+  ++Q+ N+ PL    +H  +     E   IY+I S+G I   LL  FW  TL +   G  R  S+   +L + L+VVD TSSVTFLP++++    ++T  ++GEG+SG +P +V LIQG+ G  +C N T   N T    +++ V      Y P  FS  +FF FL  M+++CLV+F L++ +    R++  +     +          S +   I   +       +S G     W  +FYI  +++++N  TN ALPS+Q+YS MPYG   YH+   ++ + NP+AC + L+   V I S++ M T    GS   AYI+  A  SP P++ +   G  ++ L W    +  S+ K ++ L L+ +GH  L  CG + Q+GS LG+I +F LV + + F S  
Sbjct:   35 SWVSINGLWVELPLIVPQIPEGWYLPSYLSILIQMANVGPLFITLMHRFRPGALNETAAIYVIISLGSIATFLLGFFWKETLVVA--GAPR--SVALLVLTFFLAVVDCTSSVTFLPFMMHLKPQYLTTYFIGEGVSGLLPALVALIQGV-GVVHCKNSTHLLNQTFTTFSNAVVVELQAQYQPANFSAEVFFFFLSAMMLVCLVAFLLLNYHPSVAREHPTKRYTNGVKEPCQKGRMCSAQRSMIDPYRPAKQRRKSSFGTGVYSWWQVFYIFAILSWVNALTNTALPSVQSYSCMPYGNNAYHLSATLAAVSNPMACFIALF---VPIRSLVFMGTLTVVGSAVGAYIMGMAVLSPCPLLVNDTSGGAVMVLAWIFFILSLSYVKVIIGLILRDEGHSALVWCGAVVQLGSLLGAITMFPLVSVYDLFTSGD 460          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Match: SMESG000040831.1 (SMESG000040831.1)

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 441/443 (99.55%), Postives = 441/443 (99.55%), Query Frame = 2
Query:  140 MPDKXXXXXXXXXXXXXXXSWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            MPDKLSILLSFLIGFFAIGSWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRFSISIFFLFLFVMLVMCLVSFSLVDNC CFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHS QIIC
Sbjct:    1 MPDKLSILLSFLIGFFAIGSWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRFSISIFFLFLFVMLVMCLVSFSLVDNCHCFRKYQLEPNQIDIVSSATITENSSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSKQIIC 443          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Match: SMESG000040849.1 (SMESG000040849.1)

HSP 1 Score: 456.833 bits (1174), Expect = 1.310e-157
Identity = 243/425 (57.18%), Postives = 310/425 (72.94%), Query Frame = 2
Query:  197 SWIDLNGLWVEVPLLINNLPEGPQLPTYVVAIVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEI-FSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            SWIDLNG+WVE+PLL+  LPE   LPT VV IVQL NIAPLIYMG+  I +F+N+ER+TIY+I SIGC+CC LL+VFW++T+K+  LG   + S+ FF+L+W LS++DTTSSVTFLPYL++YPR++ITALYVGEGLSGF PGI+GLIQG+GGE  C N TI  NGT  N T    YP PR S+S FF+FL  MLV+ LVSF ++DNC+ F K++L+   +   S     +    +E E   + K K  +      +S +KWI YILLV YINF TNG LPSIQNYSLMPY   LYH++V++SQILNPLACLLTL  W++    +  +TT  S+G  Y++  A  SP+PI+N  P G I+ +  WF+VSILFSFEK +LA+ELQKQGHVWLQLCG  TQ+GS LG+ +IF+LVV++N F     IC
Sbjct:   24 SWIDLNGVWVELPLLVTTLPERWTLPTIVVTIVQLANIAPLIYMGLFYIGRFQNMERYTIYVILSIGCVCCGLLAVFWDYTMKLSILGKKSEYSVAFFVLVWFLSMIDTTSSVTFLPYLVHYPRYYITALYVGEGLSGFFPGILGLIQGVGGEGRCENITISLNGTQ-NYTQQMKYPAPRISVSSFFVFLCAMLVISLVSFIILDNCKYFHKFRLQ--NVSKNSKGGSEKEFLLKETETSIADKMKSSLLGEQPKKSKRKWIIYILLVGYINFLTNGVLPSIQNYSLMPYSNNLYHIVVSVSQILNPLACLLTLRSWKINNIILGAITTVASIGAGYVLFLASMSPVPILNITPFGQILAAFSWFIVSILFSFEKAVLAIELQKQGHVWLQLCGASTQIGSALGAALIFVLVVVINIFKPKPEIC 445          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Match: SMESG000040849.1 (SMESG000040849.1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.383e-134
Identity = 211/382 (55.24%), Postives = 275/382 (71.99%), Query Frame = 2
Query:  326 MGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEI-FSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            MG+  I +F+N+ER+TIY+I SIGC+CC LL+VFW++T+K+  LG   + S+ FF+L+W LS++DTTSSVTFLPYL++YPR++ITALYVGEGLSGF PGI+GLIQG+GGE  C N TI  NGT  N T    YP PR S+S FF+FL  MLV+ LVSF ++DNC+ F K++L+   +   S     +    +E E   + K K  +      +S +KWI YILLV YINF TNG LPSIQNYSLMPY   LYH++V++SQILNPLACLLTL  W++    +  +TT  S+G  Y++  A  SP+PI+N  P G I+ +  WF+VSILFSFEK +LA+ELQKQGHVWLQLCG  TQ+GS LG+ +IF+LVV++N F     IC
Sbjct:    1 MGLFYIGRFQNMERYTIYVILSIGCVCCGLLAVFWDYTMKLSILGKKSEYSVAFFVLVWFLSMIDTTSSVTFLPYLVHYPRYYITALYVGEGLSGFFPGILGLIQGVGGEGRCENITISLNGTQ-NYTQQMKYPAPRISVSSFFVFLCAMLVISLVSFIILDNCKYFHKFRLQ--NVSKNSKGGSEKEFLLKETETSIADKMKSSLLGEQPKKSKRKWIIYILLVGYINFLTNGVLPSIQNYSLMPYSNNLYHIVVSVSQILNPLACLLTLRSWKINNIILGAITTVASIGAGYVLFLASMSPVPILNITPFGQILAAFSWFIVSILFSFEKAVLAIELQKQGHVWLQLCGASTQIGSALGAALIFVLVVVINIFKPKPEIC 379          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Match: SMESG000040849.1 (SMESG000040849.1)

HSP 1 Score: 384.03 bits (985), Expect = 2.763e-130
Identity = 206/371 (55.53%), Postives = 267/371 (71.97%), Query Frame = 2
Query:  359 IERFTIYLIFSIGCICCALLSVFWNHTLKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEI-FSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            +ER+TIY+I SIGC+CC LL+VFW++T+K+  LG   + S+ FF+L+W LS++DTTSSVTFLPYL++YPR++ITALYVGEGLSGF PGI+GLIQG+GGE  C N TI  NGT  N T    YP PR S+S FF+FL  MLV+ LVSF ++DNC+ F K++L+   +   S     +    +E E   + K K  +      +S +KWI YILLV YINF TNG LPSIQNYSLMPY   LYH++V++SQILNPLACLLTL  W++    +  +TT  S+G  Y++  A  SP+PI+N  P G I+ +  WF+VSILFSFEK +LA+ELQKQGHVWLQLCG  TQ+GS LG+ +IF+LVV++N F     IC
Sbjct:    1 MERYTIYVILSIGCVCCGLLAVFWDYTMKLSILGKKSEYSVAFFVLVWFLSMIDTTSSVTFLPYLVHYPRYYITALYVGEGLSGFFPGILGLIQGVGGEGRCENITISLNGTQ-NYTQQMKYPAPRISVSSFFVFLCAMLVISLVSFIILDNCKYFHKFRLQ--NVSKNSKGGSEKEFLLKETETSIADKMKSSLLGEQPKKSKRKWIIYILLVGYINFLTNGVLPSIQNYSLMPYSNNLYHIVVSVSQILNPLACLLTLRSWKINNIILGAITTVASIGAGYVLFLASMSPVPILNITPFGQILAAFSWFIVSILFSFEKAVLAIELQKQGHVWLQLCGASTQIGSALGAALIFVLVVVINIFKPKPEIC 368          
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Match: SMESG000040849.1 (SMESG000040849.1)

HSP 1 Score: 319.316 bits (817), Expect = 1.077e-105
Identity = 178/320 (55.62%), Postives = 226/320 (70.62%), Query Frame = 2
Query:  512 VVDTTSSVTFLPYLINYPRHFITALYVGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRXXXXXXXXXXXXXXXXXXXXXSLVDNCRCFRKYQLEPNQIDIVSSATITENSSDREIEI-FSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSIQNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGSLGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALELQKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC 1468
            ++DTTSSVTFLPYL++YPR++ITALYVGEGLSGF PGI+GLIQG+GGE  C N TI  NGT  N T    YP PR S+S FF+FL  MLV+ LVSF ++DNC+ F K++L+   +   S     +    +E E   + K K  +      +S +KWI YILLV YINF TNG LPSIQNYSLMPY   LYH++V++SQILNPLACLLTL  W++    +  +TT  S+G  Y++  A  SP+PI+N  P G I+ +  WF+VSILFSFEK +LA+ELQKQGHVWLQLCG  TQ+GS LG+ +IF+LVV++N F     IC
Sbjct:    1 MIDTTSSVTFLPYLVHYPRYYITALYVGEGLSGFFPGILGLIQGVGGEGRCENITISLNGTQ-NYTQQMKYPAPRISVSSFFVFLCAMLVISLVSFIILDNCKYFHKFRLQ--NVSKNSKGGSEKEFLLKETETSIADKMKSSLLGEQPKKSKRKWIIYILLVGYINFLTNGVLPSIQNYSLMPYSNNLYHIVVSVSQILNPLACLLTLRSWKINNIILGAITTVASIGAGYVLFLASMSPVPILNITPFGQILAAFSWFIVSILFSFEKAVLAIELQKQGHVWLQLCGASTQIGSALGAALIFVLVVVINIFKPKPEIC 317          
The following BLAST results are available for this feature:
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC52A31.625e-5329.71solute carrier family 52 member 3 [Source:HGNC Sym... [more]
SLC52A31.625e-5329.71solute carrier family 52 member 3 [Source:HGNC Sym... [more]
SLC52A31.625e-5329.71solute carrier family 52 member 3 [Source:HGNC Sym... [more]
SLC52A32.062e-4228.87solute carrier family 52 member 3 [Source:HGNC Sym... [more]
SLC52A11.521e-3528.15solute carrier family 52 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rft-11.905e-4031.13Riboflavin transporter rft-1 [Source:UniProtKB/Sw... [more]
rft-21.034e-2927.03Riboflavin transporter rft-2 [Source:UniProtKB/Sw... [more]
rft-21.191e-1534.56Riboflavin transporter rft-2 [Source:UniProtKB/Sw... [more]
rft-21.091e-1432.32Riboflavin transporter rft-2 [Source:UniProtKB/Sw... [more]
rft-22.141e-1432.32Riboflavin transporter rft-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rift9.968e-5529.01gene:FBgn0039882 transcript:FBtr0085852[more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc52a35.349e-7336.84solute carrier family 52 member 3 [Source:NCBI gen... [more]
slc52a35.349e-7336.84solute carrier family 52 member 3 [Source:NCBI gen... [more]
si:ch73-196l6.53.845e-6232.41si:ch73-196l6.5 [Source:ZFIN;Acc:ZDB-GENE-140106-7... [more]
si:ch73-196l6.53.845e-6232.41si:ch73-196l6.5 [Source:ZFIN;Acc:ZDB-GENE-140106-7... [more]
zgc:918901.161e-5733.33zgc:91890 [Source:NCBI gene;Acc:431729][more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC52A31.870e-6233.85solute carrier family 52 (riboflavin transporter),... [more]
syt41.624e-4129.01synaptotagmin 4 [Source:Xenbase;Acc:XB-GENE-596304... [more]
syt43.909e-2031.95synaptotagmin 4 [Source:Xenbase;Acc:XB-GENE-596304... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc52a32.895e-6232.36solute carrier protein family 52, member 3 [Source... [more]
Slc52a32.895e-6232.36solute carrier protein family 52, member 3 [Source... [more]
Slc52a32.301e-3340.57solute carrier protein family 52, member 3 [Source... [more]
Slc52a32.301e-3340.57solute carrier protein family 52, member 3 [Source... [more]
Slc52a21.544e-2033.11solute carrier protein 52, member 2 [Source:MGI Sy... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0S5Y3|S5A3A_DANRE3.532e-7336.61Solute carrier family 52, riboflavin transporter, ... [more]
sp|B5X4H8|RFT2_SALSA3.809e-6232.81Riboflavin transporter 2 OS=Salmo salar OX=8030 GN... [more]
sp|Q9D6X5|S52A3_MOUSE2.025e-6132.36Solute carrier family 52, riboflavin transporter, ... [more]
sp|Q4FZU9|S52A3_RAT5.730e-6033.48Solute carrier family 52, riboflavin transporter, ... [more]
sp|Q5E9R1|S52A3_BOVIN3.204e-5830.67Solute carrier family 52, riboflavin transporter, ... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3Y2164.387e-7235.88Solute carrier family 52 member 3 OS=Poecilia mexi... [more]
A0A315WA491.680e-7137.27Uncharacterized protein OS=Gambusia affinis OX=335... [more]
A0A3Q0S6Z52.359e-7136.60Solute carrier family 52 member 3 OS=Amphilophus c... [more]
A0A3B5M6M92.947e-7136.49Solute carrier family 52 member 3 OS=Xiphophorus c... [more]
M4AAW24.749e-7136.26Solute carrier family 52 member 3 OS=Xiphophorus m... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc52a31.522e-6334.02solute carrier family 52 member 3 [Source:NCBI gen... [more]
si:ch73-196l6.51.600e-6234.83riboflavin transporter 2-like [Source:NCBI gene;Ac... [more]
zgc:918901.120e-5934.85solute carrier family 52, riboflavin transporter, ... [more]
slc52a21.290e-4929.21solute carrier family 52 member 2 [Source:NCBI gen... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc52a33.768e-4833.16solute carrier family 52 member 3 [Source:NCBI gen... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO438312.916e-5032.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366856.030e-4730.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273761.767e-733.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc52a31.015e-7035.27solute carrier family 52 member 3 [Source:NCBI gen... [more]
zgc:918901.898e-6332.88riboflavin transporter 2 [Source:NCBI gene;Acc:101... [more]
zgc:918908.786e-6332.88riboflavin transporter 2 [Source:NCBI gene;Acc:101... [more]
si:ch73-196l6.55.695e-5934.56riboflavin transporter 2 [Source:NCBI gene;Acc:101... [more]
si:ch73-196l6.56.337e-5934.56riboflavin transporter 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of solute carrier family 52, riboflavin transporter, member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040831.10.000e+099.55SMESG000040831.1[more]
SMESG000040849.11.310e-15757.18SMESG000040849.1[more]
SMESG000040849.12.383e-13455.24SMESG000040849.1[more]
SMESG000040849.12.763e-13055.53SMESG000040849.1[more]
SMESG000040849.11.077e-10555.63SMESG000040849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018709 ID=SMED30018709|Name=solute carrier family 52, riboflavin transporter, member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1570bp
TTTTTTTTAATTAACTATTTAAACGTCAAATAAGAAATTTATATTTTTAT
TATTAAAATTGATTTTAAATTACACAATCTAATTTCTTGAAAGTAATATG
AATAGTTTTGGTGAAATTGTATGCCTGATTTGATAATTAATGCCTGACAA
ATTATCTATATTATTATCTTTTCTTATTGGATTTTTCGCAATCGGTTCAT
GGATTGACTTAAATGGATTATGGGTGGAGGTACCACTACTGATAAATAAC
CTTCCAGAAGGCCCACAATTGCCAACTTATGTGGTGGCAATAGTTCAGTT
GGGAAATATTGCTCCGTTAATATATATGGGAGTTCATTGTATTAAAAAAT
TTCGAAACATAGAACGATTTACGATATATTTAATATTTTCAATTGGTTGT
ATTTGTTGTGCTCTTTTATCAGTATTCTGGAATCACACCTTGAAGATTCA
TACCCTTGGAATCTGGCGTCAGTCGAGTCTTCCATTTTTTATTCTTATCT
GGCTGTTGTCGGTCGTTGATACAACATCATCTGTGACATTTTTACCATAT
CTTATCAATTATCCAAGACATTTCATAACGGCTCTCTATGTTGGAGAGGG
ACTTAGTGGTTTTATTCCTGGAATTGTCGGTTTAATTCAAGGCATTGGGG
GCGAGCCATATTGTGCCAATAAAACTATCTTTAATAATGGAACGAGTTAT
AATTCAACCAGTTCAAAAGTTTATCCTCCTCCAAGATTTTCAATATCGAT
ATTTTTTCTTTTTCTCTTTGTGATGTTAGTTATGTGCCTCGTATCCTTTT
CTTTGGTGGACAATTGCCGCTGCTTCCGAAAATATCAATTGGAACCGAAC
CAGATAGACATTGTCAGTTCTGCCACAATCACTGAAAATTCAAGTGATAG
AGAGATTGAAATTTTTTCATCAAAAGAAAAATTGCCAGTTTTCAGTGCAT
CTGAAGGACAATCAAATAAAAAATGGATCTTTTACATTTTGTTGGTGGCA
TATATCAACTTTTTTACAAATGGAGCTCTTCCGTCTATTCAGAACTATTC
TTTGATGCCTTACGGCATTGTTCTTTATCATGTAATCGTCAACATTTCCC
AGATTCTGAATCCACTTGCCTGTTTATTAACTCTGTATCCCTGGAGAGTC
ACCATTTGGTCTGTAATAATAATGACGACGTTTGGTTCGCTTGGGGTCGC
ATATATAATTTTAGCAGCTTGTAAAAGTCCGTTGCCTATAATAAATTCAT
ATCCCATTGGGGATATTATAATTTCTCTATGTTGGTTCTTGGTCAGTATA
TTATTTTCTTTTGAGAAAACCCTATTGGCTTTGGAATTACAAAAACAGGG
TCACGTTTGGCTACAACTTTGCGGAGTCATGACACAAGTTGGATCGACTT
TGGGATCAATTGTGATTTTTATTTTAGTTGTGATTTTGAATACTTTCCAT
TCTAACCAGATTATTTGTTAATGCTTATCATCTTAATAATAATAAAAAAT
TGTAATTAAAACACTTGGAACATTTCAACACATTTGATCACACCTTCTAG
AATTTTTTTATCAATAAAAC
back to top

protein sequence of SMED30018709-orf-1

>SMED30018709-orf-1 ID=SMED30018709-orf-1|Name=SMED30018709-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MPDKLSILLSFLIGFFAIGSWIDLNGLWVEVPLLINNLPEGPQLPTYVVA
IVQLGNIAPLIYMGVHCIKKFRNIERFTIYLIFSIGCICCALLSVFWNHT
LKIHTLGIWRQSSLPFFILIWLLSVVDTTSSVTFLPYLINYPRHFITALY
VGEGLSGFIPGIVGLIQGIGGEPYCANKTIFNNGTSYNSTSSKVYPPPRF
SISIFFLFLFVMLVMCLVSFSLVDNCRCFRKYQLEPNQIDIVSSATITEN
SSDREIEIFSSKEKLPVFSASEGQSNKKWIFYILLVAYINFFTNGALPSI
QNYSLMPYGIVLYHVIVNISQILNPLACLLTLYPWRVTIWSVIIMTTFGS
LGVAYIILAACKSPLPIINSYPIGDIIISLCWFLVSILFSFEKTLLALEL
QKQGHVWLQLCGVMTQVGSTLGSIVIFILVVILNTFHSNQIIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009357Riboflavin_transptr
Vocabulary: molecular function
TermDefinition
GO:0032217riboflavin transporter activity
Vocabulary: biological process
TermDefinition
GO:0032218riboflavin transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009357Solute carrier family 52, riboflavin transporterPFAMPF06237DUF1011coord: 278..373
e-value: 1.7E-21
score: 76.3
IPR009357Solute carrier family 52, riboflavin transporterPANTHERPTHR12929PERV-A RECEPTORcoord: 5..440
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 410..432
NoneNo IPR availableTMHMMTMhelixcoord: 310..332
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 79..101
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 376..398
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
NoneNo IPR availableTMHMMTMhelixcoord: 145..167