Protein regulator of cytokinesis 1

Overview
NameProtein regulator of cytokinesis 1
Smed IDSMED30018708
Length (bp)2164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein regulator of cytokinesis 1 (SMED30018708) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30018708) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein regulator of cytokinesis 1 (SMED30018708) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30018708) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30018708SMESG000010278.1 dd_Smed_v4_2844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018708SMESG000010278.1 dd_Smed_v4_2844_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018708SMESG000010278.1 dd_Smed_v4_2844_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018708SMESG000010278.1 dd_Smed_v4_4088_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 100.523 bits (249), Expect = 8.663e-22
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 100.523 bits (249), Expect = 8.663e-22
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 100.523 bits (249), Expect = 8.663e-22
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 100.908 bits (250), Expect = 8.866e-22
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  369 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 457          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: RNF38 (ring finger protein 38 [Source:HGNC Symbol;Acc:HGNC:18052])

HSP 1 Score: 100.138 bits (248), Expect = 1.111e-21
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  343 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 431          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: plr-1 (Probable E3 ubiquitin-protein ligase plr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2B7])

HSP 1 Score: 67.3958 bits (163), Expect = 1.865e-11
Identity = 26/62 (41.94%), Postives = 37/62 (59.68%), Query Frame = 1
Query: 1696 NSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
             SL+    ++S     +C++CLE++E    +R L C HEFH KC+D WL   R CPLC+ D 
Sbjct:  300 GSLTSVAQSSSHSAQERCVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDV 361          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: toe-4 (Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEMBL;Acc:Q9XUM8])

HSP 1 Score: 66.2402 bits (160), Expect = 4.483e-11
Identity = 26/56 (46.43%), Postives = 36/56 (64.29%), Query Frame = 1
Query: 1711 AKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRAD 1878
            AK  + +E    C VCL  FE  ++I+ L+C H FH +CI KWL IN+ CP+CR +
Sbjct:  421 AKKTDGEEDEDTCTVCLSSFEDGESIQKLRCNHVFHPECIYKWLDINKRCPMCREE 476          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: H10E21.5 (pep chromosome:WBcel235:III:20531:23962:-1 gene:WBGene00019185.1 transcript:H10E21.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H10E21.5)

HSP 1 Score: 58.5362 bits (140), Expect = 1.118e-8
Identity = 29/86 (33.72%), Postives = 44/86 (51.16%), Query Frame = 1
Query: 1654 RYKTTSDKHKQRDKNSLSDAKT---------ANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAF 1884
            RY    D+ ++R  N+   A T           ++E    C VCL+ ++ +  IR L C+H +H  CID WL  +RTCP+C+ D  
Sbjct:  187 RYAHAKDRLQRRLFNAARKALTRIPTMTITPGMTQELQSDCAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDIL 272          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: C18B12.4 (pep chromosome:WBcel235:X:15036662:15040602:-1 gene:WBGene00007666.1 transcript:C18B12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C18B12.4)

HSP 1 Score: 56.6102 bits (135), Expect = 3.619e-8
Identity = 28/89 (31.46%), Postives = 40/89 (44.94%), Query Frame = 1
Query: 1609 KRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWL-KINRTCPLCR 1872
            KR +++  L K+P  +Y+   D                        C +CLE F S + +R L C H FH  CID WL +  + CPLC+
Sbjct:  222 KRRLSKRNLKKIPVKKYRLGDDPDT---------------------CAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCK 289          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Match: C01G6.4 (pep chromosome:WBcel235:II:9271265:9273042:-1 gene:WBGene00007226.1 transcript:C01G6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01G6.4)

HSP 1 Score: 53.9138 bits (128), Expect = 4.018e-8
Identity = 20/42 (47.62%), Postives = 28/42 (66.67%), Query Frame = 1
Query: 1744 KCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLC 1869
            +C +C+ DFE  + IR L C H FH +C+D+WL  + TCP C
Sbjct:   94 ECAICMIDFEPGERIRFLPCMHSFHQECVDEWLMKSFTCPSC 135          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082118)

HSP 1 Score: 100.523 bits (249), Expect = 2.161e-21
Identity = 51/113 (45.13%), Postives = 68/113 (60.18%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA---FDG 1890
            N + LL LA    E + RG+TR E+D+LP+  YK   + H   D++S               C+VC+ DFE +Q +R L C HEFHAKC+DKWL+ NRTCP+CR +A   FDG
Sbjct: 1033 NYEALLSLAERLGEAKPRGLTRNEIDQLPS--YKFNPEVHNG-DQSS---------------CVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDG 1127          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082116)

HSP 1 Score: 99.3673 bits (246), Expect = 4.425e-21
Identity = 51/113 (45.13%), Postives = 68/113 (60.18%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA---FDG 1890
            N + LL LA    E + RG+TR E+D+LP+  YK   + H   D++S               C+VC+ DFE +Q +R L C HEFHAKC+DKWL+ NRTCP+CR +A   FDG
Sbjct:  728 NYEALLSLAERLGEAKPRGLTRNEIDQLPS--YKFNPEVHNG-DQSS---------------CVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDG 822          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: mura (gene:FBgn0037705 transcript:FBtr0082117)

HSP 1 Score: 99.3673 bits (246), Expect = 4.425e-21
Identity = 51/113 (45.13%), Postives = 68/113 (60.18%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA---FDG 1890
            N + LL LA    E + RG+TR E+D+LP+  YK   + H   D++S               C+VC+ DFE +Q +R L C HEFHAKC+DKWL+ NRTCP+CR +A   FDG
Sbjct:  728 NYEALLSLAERLGEAKPRGLTRNEIDQLPS--YKFNPEVHNG-DQSS---------------CVVCMCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDG 822          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0082432)

HSP 1 Score: 65.4698 bits (158), Expect = 1.442e-10
Identity = 31/91 (34.07%), Postives = 46/91 (50.55%), Query Frame = 1
Query: 1612 RGITREELDK--LPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRAD 1878
            RG T E +++  LP H+Y+                 + + + E   KC +CL  FE +  +R L C H FH  C+D+WL  N+ CP+CR D
Sbjct: 1155 RGATLETIERNTLP-HKYRRVR--------------RPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVD 1230          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0307892)

HSP 1 Score: 65.4698 bits (158), Expect = 1.442e-10
Identity = 31/91 (34.07%), Postives = 46/91 (50.55%), Query Frame = 1
Query: 1612 RGITREELDK--LPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRAD 1878
            RG T E +++  LP H+Y+                 + + + E   KC +CL  FE +  +R L C H FH  C+D+WL  N+ CP+CR D
Sbjct: 1155 RGATLETIERNTLP-HKYRRVR--------------RPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVD 1230          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 100.908 bits (250), Expect = 5.123e-22
Identity = 48/115 (41.74%), Postives = 72/115 (62.61%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA +   Q+D
Sbjct:  375 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASE--VQRD 469          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 101.679 bits (252), Expect = 6.972e-22
Identity = 48/115 (41.74%), Postives = 72/115 (62.61%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA +   Q+D
Sbjct:  565 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASE--VQRD 659          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 101.679 bits (252), Expect = 7.182e-22
Identity = 48/115 (41.74%), Postives = 72/115 (62.61%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA +   Q+D
Sbjct:  577 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASE--VQRD 671          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:767686])

HSP 1 Score: 99.7525 bits (247), Expect = 9.344e-22
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNLENHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:767686])

HSP 1 Score: 99.7525 bits (247), Expect = 1.025e-21
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  352 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNLENHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 440          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: RNF44 (ring finger protein 44 [Source:NCBI gene;Acc:100493970])

HSP 1 Score: 102.064 bits (253), Expect = 2.091e-22
Identity = 50/116 (43.10%), Postives = 69/116 (59.48%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDG 1908
            N + LL+LA    E + RG+T+  +++LP++R+   S + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA    A +DG
Sbjct:  334 NYEALLNLAERLGEAKPRGLTKANIEQLPSYRFNAESHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKSNRTCPICRADA--SEAHRDG 429          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: RNF44 (ring finger protein 44 [Source:NCBI gene;Acc:100493970])

HSP 1 Score: 102.064 bits (253), Expect = 3.127e-22
Identity = 50/116 (43.10%), Postives = 69/116 (59.48%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDG 1908
            N + LL+LA    E + RG+T+  +++LP++R+   S + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA    A +DG
Sbjct:  374 NYEALLNLAERLGEAKPRGLTKANIEQLPSYRFNAESHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKSNRTCPICRADA--SEAHRDG 469          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: RNF44 (ring finger protein 44 [Source:NCBI gene;Acc:100493970])

HSP 1 Score: 101.679 bits (252), Expect = 4.929e-22
Identity = 50/116 (43.10%), Postives = 69/116 (59.48%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDG 1908
            N + LL+LA    E + RG+T+  +++LP++R+   S + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA    A +DG
Sbjct:  409 NYEALLNLAERLGEAKPRGLTKANIEQLPSYRFNAESHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKSNRTCPICRADA--SEAHRDG 504          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 99.7525 bits (247), Expect = 1.141e-21
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: rnf38 (ring finger protein 38 [Source:NCBI gene;Acc:594927])

HSP 1 Score: 99.7525 bits (247), Expect = 1.913e-21
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  387 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 475          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 100.908 bits (250), Expect = 5.983e-22
Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  368 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 456          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 100.523 bits (249), Expect = 6.168e-22
Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 100.523 bits (249), Expect = 6.168e-22
Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf38 (ring finger protein 38 [Source:MGI Symbol;Acc:MGI:1920719])

HSP 1 Score: 100.523 bits (249), Expect = 6.168e-22
Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  336 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 424          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Rnf44 (ring finger protein 44 [Source:MGI Symbol;Acc:MGI:2145310])

HSP 1 Score: 98.2117 bits (243), Expect = 1.137e-21
Identity = 45/107 (42.06%), Postives = 65/107 (60.75%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    + + RG+T+ ++++LP++R+   S + +Q                    C+VC  DFE +Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  254 NYEALLNLAERLGDAKPRGLTKADIEQLPSYRFNPDSHQSEQT------------------LCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 342          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q8BI21|RNF38_MOUSE (E3 ubiquitin-protein ligase RNF38 OS=Mus musculus OX=10090 GN=Rnf38 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 5.538e-21
Identity = 46/107 (42.99%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  422 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICRADA 510          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q9H0F5|RNF38_HUMAN (E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens OX=9606 GN=RNF38 PE=1 SV=4)

HSP 1 Score: 100.908 bits (250), Expect = 5.739e-21
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  419 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 507          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q08CG8|RNF44_DANRE (RING finger protein 44 OS=Danio rerio OX=7955 GN=rnf44 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.741e-21
Identity = 46/107 (42.99%), Postives = 66/107 (61.68%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  352 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNLENHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 440          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q4V7B8|RNF44_RAT (RING finger protein 44 OS=Rattus norvegicus OX=10116 GN=Rnf44 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.882e-21
Identity = 45/107 (42.06%), Postives = 65/107 (60.75%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    + + RG+T+ ++++LP++R+   S + +Q                    C+VC  DFE +Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  254 NYEALLNLAERLGDAKPRGLTKADIEQLPSYRFNPDSHQSEQT------------------LCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 342          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q3UHJ8|RNF44_MOUSE (RING finger protein 44 OS=Mus musculus OX=10090 GN=Rnf44 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.254e-20
Identity = 45/107 (42.06%), Postives = 65/107 (60.75%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    + + RG+T+ ++++LP++R+   S + +Q                    C+VC  DFE +Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  311 NYEALLNLAERLGDAKPRGLTKADIEQLPSYRFNPDSHQSEQT------------------LCVVCFSDFEVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 399          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A3R7JNL9 (E3 ubiquitin-protein ligase RNF38 OS=Clonorchis sinensis OX=79923 GN=Rnf38 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.010e-26
Identity = 56/122 (45.90%), Postives = 79/122 (64.75%), Query Frame = 1
Query: 1543 NYSLNGSNIDTLLHLAAHFEQR-KRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N +   +++DTL  LA   E   +RG+T+EELD LP   Y    +   Q +      A+T +      +C++CL+D+ESK  +RA++C HEFHAKC+DKWLK  RTCPLCRADAFDG+ +K+
Sbjct: 1303 NTAAAAASVDTLYQLAVQLESSGRRGLTKEELDTLPVRSYGKIHEAPTQHENTKDCVAETDD------RCMICLDDYESKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADAFDGTQRKE 1418          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: H2KUM4 (RING finger protein 38 OS=Clonorchis sinensis OX=79923 GN=CLF_109547 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.873e-26
Identity = 55/114 (48.25%), Postives = 75/114 (65.79%), Query Frame = 1
Query: 1567 IDTLLHLAAHFEQR-KRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            +DTL  LA   E   +RG+T+EELD LP   Y    +   Q +      A+T +      +C++CL+D+ESK  +RA++C HEFHAKC+DKWLK  RTCPLCRADAFDG+ +K+
Sbjct: 1129 VDTLYQLAVQLESSGRRGLTKEELDTLPVRSYGKIHEAPTQHENTKDCVAETDD------RCMICLDDYESKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADAFDGTQRKE 1236          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A074ZUF6 (RING-type domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02888 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 7.297e-26
Identity = 55/115 (47.83%), Postives = 76/115 (66.09%), Query Frame = 1
Query: 1564 NIDTLLHLAAHFEQR-KRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            ++DTL  LA   E   +RG+T+EELD LP   Y    +   Q +      A+T +      +C++CL+D+ESK  +RA++C HEFHAKC+DKWLK  RTCPLCRADAFDG+ +K+
Sbjct: 1195 SVDTLYQLAVQLESSGRRGLTKEELDTLPVRSYGQIQESPTQLENTKDCVAETDD------RCMICLDDYESKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADAFDGTQRKE 1303          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A4S2L6D8 (RING-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009738 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.452e-25
Identity = 54/115 (46.96%), Postives = 75/115 (65.22%), Query Frame = 1
Query: 1564 NIDTLLHLAAHFEQR-KRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            ++DTL  LA   E   +RG+T+EELD LP   Y    +   Q +      A+T +      +C++CL+D+E K  +RA++C HEFHAKC+DKWLK  RTCPLCRADAFDG+ +K+
Sbjct: 1139 SVDTLYQLAVQLESSGRRGLTKEELDTLPVRSYGQIHEAPTQLENTKDCVAETED------RCMICLDDYEPKDLLRAMRCRHEFHAKCVDKWLKTKRTCPLCRADAFDGTQRKE 1247          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: Q5DAH5 (SJCHGC07006 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.213e-24
Identity = 53/130 (40.77%), Postives = 80/130 (61.54%), Query Frame = 1
Query: 1519 MTQTMRPLNYSLNGSNIDTLLHLAAHFEQRK-RGITREELDKLPTHRYKTTSDKH--KQRDKNSLSDAKTANSKEGVP---KCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDG 1890
            ++QT+     +   +++DTLLHLA   E    RG++++EL+ LP   Y   S       + K+S  + +T N++  +    +C++CL+D+   Q IR ++C HEFHA C+DKWLK  RTCPLCRADAF G
Sbjct:  115 LSQTVSDPTSAAAAASVDTLLHLAVQLESNNGRGLSKDELESLPIRLYTLKSPNRLPDDKQKSSFDETQTTNAQNYLSECDRCMICLDDYVESQQIRQMRCLHEFHASCVDKWLKTKRTCPLCRADAFTG 244          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:103037379])

HSP 1 Score: 100.908 bits (250), Expect = 3.299e-22
Identity = 46/107 (42.99%), Postives = 67/107 (62.62%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            N + LL+LA    E + RG+T+ ++++LP++R+ + + + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA
Sbjct:  334 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNSENHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADA 422          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf38 (ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-030131-8693])

HSP 1 Score: 100.138 bits (248), Expect = 1.964e-21
Identity = 47/115 (40.87%), Postives = 71/115 (61.74%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+  ++ + +                     C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA +   Q+D
Sbjct:  569 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSE---------------------CVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASE--VQRD 660          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:103037379])

HSP 1 Score: 77.0258 bits (188), Expect = 1.891e-14
Identity = 36/95 (37.89%), Postives = 56/95 (58.95%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLK 1845
            N + LL+LA    E + RG+T+ ++++LP++R+ + + + +Q                    C+VC  DFES+Q +R L C HEFHAKC+DKWLK
Sbjct:  334 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNSENHQSEQT------------------LCVVCFSDFESRQLLRVLPCNHEFHAKCVDKWLK 410          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf6 (ring finger protein 6 [Source:NCBI gene;Acc:103037065])

HSP 1 Score: 71.2478 bits (173), Expect = 2.328e-12
Identity = 36/112 (32.14%), Postives = 52/112 (46.43%), Query Frame = 1
Query: 1576 LLHLAAHF-------EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDG 1890
            +L LA  F       ++  RG+T+E++D L T  Y   S + +Q                    C VC+ ++     +R+L C HEFH  CID+WL  N TCP+CR     G
Sbjct:  595 ILRLAHFFLLNDEEDDEHPRGLTKEQIDNLATRTYGQASLEGEQGRA-----------------CSVCINEYAQGNKLRSLPCAHEFHIHCIDRWLSENNTCPICRQPILSG 689          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: rnf165b (E3 ubiquitin-protein ligase RNF165-like [Source:NCBI gene;Acc:103024953])

HSP 1 Score: 68.1662 bits (165), Expect = 7.476e-12
Identity = 35/121 (28.93%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 1528 TMRPLNYSLNGSNI----DTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRAD 1878
            T++ LN S + + +    + LL L        RG  +  +++       T   K+K+R    L      +  +   KC +CL   E  +++R L C H FH  C+D+WL  N+ CP+CR D
Sbjct:  218 TLQGLNPSRHATAVRESYEELLQLEDRLGNVNRGAVQTTIERF------TFPHKYKKRRPLELKIGMDEDELDTDEKCTICLSMLEDGEDVRRLPCMHLFHQACVDQWLATNKKCPICRVD 332          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: rnf111 (ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-070808-2])

HSP 1 Score: 69.707 bits (169), Expect = 1.576e-12
Identity = 33/109 (30.28%), Postives = 54/109 (49.54%), Query Frame = 1
Query: 1561 SNIDTLLHLAAHFEQRKRGITREELDK-LPTHRYK--TTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRAD 1878
            + I  LL L        RG ++  +++    H+YK  T ++   ++      D +     E   KC +CL   E ++++R L C H FH  C+D+WL  N+ CP+CR D
Sbjct:  783 AQIQDLLQLEERLGNVNRGASQSTIERHTYPHKYKKVTVNNTKSRKSLEKEGDDEGGADDENEEKCTICLSVLEEEEDVRRLPCMHLFHQVCVDQWLTTNKKCPICRVD 891          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: rnf150a (ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE-060213-1])

HSP 1 Score: 60.4622 bits (145), Expect = 4.284e-10
Identity = 27/84 (32.14%), Postives = 44/84 (52.38%), Query Frame = 1
Query: 1654 RYKTTSDKHKQRDKNSLSDAKTANSKEGVPK-----------CLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCR 1872
            RY +  D+H++R  ++   A T    + + K           C VC+E ++    +R L C+H FH  C+D WL  +RTCP+C+
Sbjct:  247 RYASARDRHQRRLGDAAKKAMTKLPLKTIKKGDQETEPDFDNCAVCIEGYKPNDVVRILPCKHLFHKACVDPWLLDHRTCPMCK 330          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 53.9138 bits (128), Expect = 8.832e-10
Identity = 21/41 (51.22%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 1747 CLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLC 1869
            C VCLEDF  K  +    C+H FH KC+ KWL+I   CP+C
Sbjct:   17 CAVCLEDFREKDELAVCPCKHAFHRKCLVKWLEIRNACPMC 57          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003380.1 (pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 gene:ENSPMAG00000003092.1 transcript:ENSPMAT00000003380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 5.642e-9
Identity = 20/41 (48.78%), Postives = 27/41 (65.85%), Query Frame = 1
Query: 1747 CLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLC 1869
            C VCLEDF  K  +    C H FH KC+ +WL+I ++CP+C
Sbjct:   33 CAVCLEDFTLKDKLGICPCRHAFHRKCLVRWLEIRKSCPMC 73          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003771.1 (pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:ENSPMAG00000003449.1 transcript:ENSPMAT00000003771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.087e-8
Identity = 20/43 (46.51%), Postives = 28/43 (65.12%), Query Frame = 1
Query: 1747 CLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINR-TCPLCR 1872
            C +CLE++E  + +R L C H FH KC+D WL   R  CP+C+
Sbjct:    7 CAICLEEYEEGERLRVLPCAHAFHCKCVDPWLTQQRKNCPVCK 49          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO49283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH29])

HSP 1 Score: 82.4185 bits (202), Expect = 3.588e-19
Identity = 44/96 (45.83%), Postives = 61/96 (63.54%), Query Frame = 1
Query: 1573 TLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRT 1857
            TLL+LA    E + +G+TR E+D+LPT  Y+ T++  KQ D     DA+          C+VCL DFE KQ +R L C HE+H +CIDKWLK+++T
Sbjct:    8 TLLNLAEQIGEAKPKGLTRAEIDQLPT--YRVTAESKKQND-----DAR----------CVVCLVDFEEKQLVRTLPCLHEYHTRCIDKWLKVHKT 86          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO31118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV5])

HSP 1 Score: 60.8474 bits (146), Expect = 1.203e-11
Identity = 26/81 (32.10%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 1606 RKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKI 1848
            + RG+++E +D++P+ R+             S S+   +N       C+VC+ D+ +++ +R L C H+FH+KCID+WLK+
Sbjct:   33 KSRGLSKEVIDRIPSFRF-------------SASNKDMSNGS-----CVVCMMDYTNREKLRKLPCNHDFHSKCIDRWLKV 95          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO36379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX4])

HSP 1 Score: 61.6178 bits (148), Expect = 4.120e-10
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 1594 HFEQRKRGITREELDKLPTHRYKTTS----------DKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWL-KINRTCPLCRADAFDGSAQKDG 1908
            + E+R+  ++   L K+PT ++K             D++K+ DK  L      +  E    C +CL++++    +R L C+H +H KC+D WL +  RTCP+C+        +K G
Sbjct:  207 YLEKRRNRLSLTNLRKIPTKKFKKGDEYYDVCAICLDEYKEGDK--LRILPCDHGDEYYDVCAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTEGKRTCPVCKRPVETSKKKKQG 320          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO49300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH66])

HSP 1 Score: 56.9954 bits (136), Expect = 1.152e-9
Identity = 30/96 (31.25%), Postives = 45/96 (46.88%), Query Frame = 1
Query: 1585 LAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCR 1872
               H  + +R +  +E   + T R        K   K        A SK     C +CLEDF +K+ +   KC H +H KCI KWL++  +CP+C+
Sbjct:   34 FCCHLLRARRQLLSQEQGNVGTQRRSFPKGLKKVNYKKKW----LAKSKLKSDMCTICLEDFINKEEVNMCKCGHAYHNKCIMKWLEVRNSCPICQ 125          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO41758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3E3])

HSP 1 Score: 59.3066 bits (142), Expect = 1.208e-9
Identity = 31/85 (36.47%), Postives = 46/85 (54.12%), Query Frame = 1
Query: 1654 RYKTTSDKHKQR----DKNSLSDAKTANSK----EGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAF 1884
            RY    DK ++R     K +++   T   K    E +  C VCL+ ++S + IR L C HE+H  CID WL  +RTCP+C+ +  
Sbjct:  187 RYVHARDKTEKRLSSAAKKAIAKLPTRTVKKDEEEEIDSCPVCLDGYKSGEVIRILPCNHEYHKLCIDPWLVEHRTCPMCKLNIL 271          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: rnf38 (E3 ubiquitin-protein ligase RNF38 [Source:NCBI gene;Acc:101171057])

HSP 1 Score: 102.064 bits (253), Expect = 4.685e-22
Identity = 48/115 (41.74%), Postives = 71/115 (61.74%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFHAKC+DKWLK NRTCP+CRADA +   Q+D
Sbjct:  616 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNRQSEQT------------------LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADASE--VQRD 710          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:101159595])

HSP 1 Score: 100.523 bits (249), Expect = 5.196e-22
Identity = 48/109 (44.04%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFD 1887
            N + LL+LA    E + RG+T+ ++++LP++R+ +         +N LS+            C+VC  DFE +Q +R L C HEFHAKC+DKWLK NRTCP+CRADA D
Sbjct:  344 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNS---------ENHLSEQTL---------CVVCFSDFECRQLLRVLPCNHEFHAKCVDKWLKTNRTCPICRADASD 434          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: ENSORLT00000004098.2 (E3 ubiquitin-protein ligase RNF38 [Source:NCBI gene;Acc:101163418])

HSP 1 Score: 100.523 bits (249), Expect = 1.570e-21
Identity = 46/115 (40.00%), Postives = 70/115 (60.87%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKD 1905
            N + LL+LA    E + RG+T+ ++++LP++R+   + + +Q                    C+VC+ DFES+Q +R L C HEFH KC+DKWL+ NRTCP+CRADA +   Q+D
Sbjct:  546 NYEALLNLAEQLGEAKLRGLTKGDIEQLPSYRFNPNNHQSEQT------------------LCVVCMSDFESRQLLRVLPCSHEFHGKCVDKWLRANRTCPICRADASE--VQRD 640          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: rnf44 (ring finger protein 44 [Source:NCBI gene;Acc:101159595])

HSP 1 Score: 78.1814 bits (191), Expect = 8.177e-15
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 1564 NIDTLLHLAAHF-EQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKIN 1851
            N + LL+LA    E + RG+T+ ++++LP++R+ +         +N LS+            C+VC  DFE +Q +R L C HEFHAKC+DKWLK++
Sbjct:  328 NYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNS---------ENHLSEQTL---------CVVCFSDFECRQLLRVLPCNHEFHAKCVDKWLKVS 406          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: si:ch211-59o9.10 (uncharacterized LOC101160975 [Source:NCBI gene;Acc:101160975])

HSP 1 Score: 77.7962 bits (190), Expect = 1.232e-14
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 1
Query: 1552 LNGSNIDTLLHLAAHFEQRK-----RGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSA 1896
            + G+N + LL     FE+R+     R ++R E+ + PT ++ +               AKTA    G  +C +C  D+   + +R L C H++H +CID+WLK N TCP+CRA+  DGS+
Sbjct:  339 IQGNNYEALLE----FEERQGAVVSRKLSRREIQRFPTKKFHS---------------AKTA----GNTQCQICFCDYNDGEKLRMLPCFHDYHVQCIDRWLKDNTTCPICRANLADGSS 435          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000010278.1 (SMESG000010278.1)

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 520/524 (99.24%), Postives = 520/524 (99.24%), Query Frame = 1
Query:  340 MFSITQDIENSQYNSWLNPEILIKNTRRQAGNRKRGYDLANIDLGDECQQRVLRPRHDPEFSNSQEASRTRPIPNRIRQRLLERANNTVRSDRQSQPQXXXXXXXXXXXTPEIAIPQSANDLALLQAIAAFNWSQSNLYRNADAASFLPGHIQLATYPNLSNLHMSQRIPQFDPWVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSAAADATSNDETAALRMSQMAYPSMTPEINRTNNALLWSYPYFLNPSTNINTMTTQSSISRQSHEMHTHSTGSAPIEQPTDFSYLRFIEYSQRDSLPISSNENRAFPAIYQNDPRLCXXXXXXXXXXXXXCPCHSSGHLVHNPNQSQSHMTVSDSIQSEPASSQSQNTFTNFSHSSGIPFDQFWPHMTQTMRPLNYSLNGSNIDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDGA 1911
            MFSITQDIENSQYN WLNPEILIKNTRRQAGNRKRGYDLANIDLGDECQQRVLRPRHDPEFSNSQEASRTRPIPNRIRQRLLERANNTVRSDRQSQPQVVAASAAAVAATPEIAIPQSANDLALLQAIAAFNWSQSNLYRNADAASFLPGHIQLATYPNLSNLHMSQRIPQFDPWVLHNYLLAASYSAASTSHHHLQHHH QQQQHVSAAADATSNDETAALRMSQMAYPSMTPEINRTNNALLWSYPYFLNPSTNINTMTTQSS SRQSHEMHTHSTGSAPIEQPTDFSYLRFIEYSQRDSLPISSNENRAFPAIYQNDPRLCSSILSNPFSFSSICPCHSSGHLVHNPNQSQSHMTVSDSIQSEPASS SQNTFTNFSHSSGIPFDQFWPHMTQTMRPLNYSLNGSNIDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDGA
Sbjct:    1 MFSITQDIENSQYNGWLNPEILIKNTRRQAGNRKRGYDLANIDLGDECQQRVLRPRHDPEFSNSQEASRTRPIPNRIRQRLLERANNTVRSDRQSQPQVVAASAAAVAATPEIAIPQSANDLALLQAIAAFNWSQSNLYRNADAASFLPGHIQLATYPNLSNLHMSQRIPQFDPWVLHNYLLAASYSAASTSHHHLQHHHQQQQQHVSAAADATSNDETAALRMSQMAYPSMTPEINRTNNALLWSYPYFLNPSTNINTMTTQSSTSRQSHEMHTHSTGSAPIEQPTDFSYLRFIEYSQRDSLPISSNENRAFPAIYQNDPRLCSSILSNPFSFSSICPCHSSGHLVHNPNQSQSHMTVSDSIQSEPASSLSQNTFTNFSHSSGIPFDQFWPHMTQTMRPLNYSLNGSNIDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSAQKDGA 524          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000016770.1 (SMESG000016770.1)

HSP 1 Score: 102.064 bits (253), Expect = 4.343e-22
Identity = 47/111 (42.34%), Postives = 68/111 (61.26%), Query Frame = 1
Query: 1564 NIDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDGSA 1896
            N+++++ LA H E   RGI   EL +LP H YK           N L+ + T   ++   KC+VCLE+F    ++R L C H++H  C+DKWL++NRTCP+CRADA  GS+
Sbjct:  664 NMESVIQLALHLETSWRGINPSELAQLPCHYYK-----------NDLNASNTDLERQD--KCMVCLEEFLENDHLRTLSCSHQYHVMCVDKWLRMNRTCPMCRADATLGSS 761          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000059381.1 (SMESG000059381.1)

HSP 1 Score: 100.138 bits (248), Expect = 1.321e-21
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 1
Query: 1567 IDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            + TL HL    +Q K GITR+ELD +PT ++         ++ N ++   T + K+   +C++CLEDF   + IR L+C H+FH+ C++KWLKINRTCPLCR+DA
Sbjct:  505 LPTLDHLPL-IDQPKPGITRQELDTIPTRKFI--------KNNNDMNYKVTDDDKD---RCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 597          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000059381.1 (SMESG000059381.1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.541e-21
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 1
Query: 1567 IDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADA 1881
            + TL HL    +Q K GITR+ELD +PT ++         ++ N ++   T + K+   +C++CLEDF   + IR L+C H+FH+ C++KWLKINRTCPLCR+DA
Sbjct:  509 LPTLDHLPL-IDQPKPGITRQELDTIPTRKFI--------KNNNDMNYKVTDDDKD---RCMICLEDFMPDEIIRMLRCSHDFHSICVEKWLKINRTCPLCRSDA 601          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000019216.1 (SMESG000019216.1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.387e-9
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 1
Query: 1618 ITREELDKLPTHRYKTTSDKHKQRDKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKWLKINRTCPLCRADAFDG 1890
            IT+EEL+ L T  +                D K  N+ E +  C +CL +F++   I+ L C+H +H++CIDKWL     CP CRA    G
Sbjct:   89 ITKEELELLSTKIF----------------DEKKMNNYE-ITDCDICLGNFKNGCQIKVLPCKHSYHSECIDKWLLQQPMCPRCRAGVKSG 162          
The following BLAST results are available for this feature:
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF388.663e-2242.99ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF388.663e-2242.99ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF388.663e-2242.99ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF388.866e-2242.99ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
RNF381.111e-2142.99ring finger protein 38 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plr-11.865e-1141.94Probable E3 ubiquitin-protein ligase plr-1 [Sourc... [more]
toe-44.483e-1146.43Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEM... [more]
H10E21.51.118e-833.72pep chromosome:WBcel235:III:20531:23962:-1 gene:WB... [more]
C18B12.43.619e-831.46pep chromosome:WBcel235:X:15036662:15040602:-1 gen... [more]
C01G6.44.018e-847.62pep chromosome:WBcel235:II:9271265:9273042:-1 gene... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mura2.161e-2145.13gene:FBgn0037705 transcript:FBtr0082118[more]
mura4.425e-2145.13gene:FBgn0037705 transcript:FBtr0082116[more]
mura4.425e-2145.13gene:FBgn0037705 transcript:FBtr0082117[more]
CG69231.442e-1034.07gene:FBgn0037944 transcript:FBtr0082432[more]
CG69231.442e-1034.07gene:FBgn0037944 transcript:FBtr0307892[more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf385.123e-2241.74ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf386.972e-2241.74ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf387.182e-2241.74ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf449.344e-2242.99ring finger protein 44 [Source:NCBI gene;Acc:76768... [more]
rnf441.025e-2142.99ring finger protein 44 [Source:NCBI gene;Acc:76768... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF442.091e-2243.10ring finger protein 44 [Source:NCBI gene;Acc:10049... [more]
RNF443.127e-2243.10ring finger protein 44 [Source:NCBI gene;Acc:10049... [more]
RNF444.929e-2243.10ring finger protein 44 [Source:NCBI gene;Acc:10049... [more]
rnf381.141e-2142.99ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
rnf381.913e-2142.99ring finger protein 38 [Source:NCBI gene;Acc:59492... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf385.983e-2242.99ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf386.168e-2242.99ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf386.168e-2242.99ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf386.168e-2242.99ring finger protein 38 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf441.137e-2142.06ring finger protein 44 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BI21|RNF38_MOUSE5.538e-2142.99E3 ubiquitin-protein ligase RNF38 OS=Mus musculus ... [more]
sp|Q9H0F5|RNF38_HUMAN5.739e-2142.99E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens ... [more]
sp|Q08CG8|RNF44_DANRE7.741e-2142.99RING finger protein 44 OS=Danio rerio OX=7955 GN=r... [more]
sp|Q4V7B8|RNF44_RAT7.882e-2142.06RING finger protein 44 OS=Rattus norvegicus OX=101... [more]
sp|Q3UHJ8|RNF44_MOUSE1.254e-2042.06RING finger protein 44 OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7JNL93.010e-2645.90E3 ubiquitin-protein ligase RNF38 OS=Clonorchis si... [more]
H2KUM46.873e-2648.25RING finger protein 38 OS=Clonorchis sinensis OX=7... [more]
A0A074ZUF67.297e-2647.83RING-type domain-containing protein OS=Opisthorchi... [more]
A0A4S2L6D81.452e-2546.96RING-type domain-containing protein OS=Opisthorchi... [more]
Q5DAH51.213e-2440.77SJCHGC07006 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf443.299e-2242.99ring finger protein 44 [Source:NCBI gene;Acc:10303... [more]
rnf381.964e-2140.87ring finger protein 38 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rnf441.891e-1437.89ring finger protein 44 [Source:NCBI gene;Acc:10303... [more]
rnf62.328e-1232.14ring finger protein 6 [Source:NCBI gene;Acc:103037... [more]
rnf165b7.476e-1228.93E3 ubiquitin-protein ligase RNF165-like [Source:NC... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1111.576e-1230.28ring finger protein 111 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf150a4.284e-1032.14ring finger protein 150a [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch1073-392o20.18.832e-1051.22ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000003380.15.642e-948.78pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 ge... [more]
ENSPMAT00000003771.11.087e-846.51pep scaffold:Pmarinus_7.0:GL488469:4:5386:-1 gene:... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492833.588e-1945.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311181.203e-1132.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363794.120e-1028.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493001.152e-931.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417581.208e-936.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf384.685e-2241.74E3 ubiquitin-protein ligase RNF38 [Source:NCBI gen... [more]
rnf445.196e-2244.04ring finger protein 44 [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000004098.21.570e-2140.00E3 ubiquitin-protein ligase RNF38 [Source:NCBI gen... [more]
rnf448.177e-1538.14ring finger protein 44 [Source:NCBI gene;Acc:10115... [more]
si:ch211-59o9.101.232e-1434.17uncharacterized LOC101160975 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010278.10.000e+099.24SMESG000010278.1[more]
SMESG000016770.14.343e-2242.34SMESG000016770.1[more]
SMESG000059381.11.321e-2144.76SMESG000059381.1[more]
SMESG000059381.11.541e-2144.76SMESG000059381.1[more]
SMESG000019216.14.387e-935.16SMESG000019216.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018708 ID=SMED30018708|Name=Protein regulator of cytokinesis 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2164bp
TTAAAATAAATAAATATATATAAAATATAAAACATCCAATGTACATAATA
TATAAATCGATTCGTTCTGGTACACAAATCATAGGTCGTGCACGTCAGTT
TTGTGTTCTATATTTTTCATTTGTATGTAATTCTCTCTAGGTTATTCAAT
CTGTGATTTGATTGGTCGATTAAATTTCATTAGCGAGTTGTGAATGGTTG
CTTATTTTATCGGGTTCCAATGAAAGTCAATTCATTAATAAGATATTGTA
AAAATTTTTAATCATTTATTTTTATCGAAAATTTGGATTATTTTATTTGG
AAAGAAAAAAACAAAGAATAAACAGAAATTCTAATTCAGATGTTTTCTAT
TACTCAAGATATTGAAAATTCACAATACAACAGTTGGCTCAATCCAGAAA
TTCTGATAAAGAATACTCGTAGGCAAGCGGGAAATCGTAAGCGCGGTTAT
GACTTGGCCAATATAGATCTTGGAGATGAATGCCAACAGAGAGTGCTGAG
ACCGCGACACGATCCAGAGTTCAGCAATTCACAAGAAGCCTCACGGACTA
GACCTATTCCGAACAGAATCAGACAGAGATTACTTGAAAGGGCCAATAAC
ACAGTCAGGTCAGACCGCCAGAGTCAACCACAAGTCGTCGCGGCATCAGC
AGCAGCAGTAGCAGCTACTCCTGAAATAGCGATTCCTCAATCAGCAAATG
ATTTAGCCTTATTACAGGCGATAGCTGCTTTCAACTGGTCACAGAGCAAT
TTATACCGAAACGCAGATGCTGCATCGTTTCTGCCAGGCCACATCCAACT
GGCCACATATCCGAATCTCAGTAACCTACACATGAGTCAGAGAATACCTC
AATTCGATCCATGGGTTTTGCATAATTATTTACTCGCTGCCTCATACAGT
GCAGCAAGCACTAGTCACCACCATCTTCAGCATCATCATCATCAGCAGCA
GCAGCATGTTTCTGCCGCTGCTGATGCCACTAGCAATGATGAAACTGCTG
CATTGAGGATGTCACAGATGGCTTATCCCAGCATGACACCAGAAATAAAT
CGAACAAATAACGCATTGTTATGGTCATATCCATACTTTCTCAATCCGTC
GACCAATATTAACACAATGACAACTCAGTCGTCCATCAGTAGGCAATCAC
ACGAGATGCATACTCATTCCACGGGATCTGCACCAATTGAACAACCGACA
GATTTCTCTTATTTACGCTTCATAGAATATTCGCAACGAGATTCATTGCC
GATATCGTCAAATGAAAATCGAGCCTTTCCAGCAATATACCAAAACGATC
CTCGACTCTGCTCGTCGATTCTGTCAAATCCGTTTTCTTTCTCTTCGATT
TGTCCATGTCACTCATCGGGACATTTGGTTCACAATCCAAACCAGTCTCA
ATCTCACATGACGGTGTCAGATTCAATTCAATCAGAGCCGGCCTCATCTC
AATCTCAAAACACTTTCACAAATTTCTCACACTCATCTGGAATTCCTTTC
GACCAATTTTGGCCTCACATGACACAGACAATGAGGCCGTTGAATTACTC
ACTGAACGGTTCCAACATTGACACTTTGCTTCATTTAGCCGCTCATTTCG
AACAGAGAAAGCGTGGAATCACTAGAGAAGAACTCGACAAGTTGCCAACT
CATCGCTACAAAACTACATCAGACAAGCACAAACAGAGAGACAAGAATTC
CTTATCCGATGCCAAAACCGCAAATTCGAAAGAGGGCGTTCCGAAATGCC
TTGTGTGTTTGGAGGATTTCGAATCTAAGCAAAACATTCGAGCATTGAAA
TGTGAGCACGAGTTTCACGCTAAATGTATAGACAAGTGGCTGAAGATAAA
CAGAACTTGCCCGTTATGTCGGGCCGACGCGTTTGACGGATCTGCTCAAA
AAGATGGAGCCTAAATCAATTATTCTGACTAAAAACTTGATTCTGTGTTA
TTTTTTATGAAATTTAATTTAATCTGGCTTCATTAGAATTGTAAATGTGT
TTGTATGGAATATTATTTTGTTAGACATTTCTACATCGGCCGTTTGCTAT
ATATTAATAATACTTTGTTGGCTTTGTGATTTCCTTTGTCAGGTCGGTGA
TGATTGGGTTTGCCGAGAATTGTTTACCGGTCGATAATGCGCACCAATGG
TAAATGGATTCCAC
back to top

protein sequence of SMED30018708-orf-1

>SMED30018708-orf-1 ID=SMED30018708-orf-1|Name=SMED30018708-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MFSITQDIENSQYNSWLNPEILIKNTRRQAGNRKRGYDLANIDLGDECQQ
RVLRPRHDPEFSNSQEASRTRPIPNRIRQRLLERANNTVRSDRQSQPQVV
AASAAAVAATPEIAIPQSANDLALLQAIAAFNWSQSNLYRNADAASFLPG
HIQLATYPNLSNLHMSQRIPQFDPWVLHNYLLAASYSAASTSHHHLQHHH
HQQQQHVSAAADATSNDETAALRMSQMAYPSMTPEINRTNNALLWSYPYF
LNPSTNINTMTTQSSISRQSHEMHTHSTGSAPIEQPTDFSYLRFIEYSQR
DSLPISSNENRAFPAIYQNDPRLCSSILSNPFSFSSICPCHSSGHLVHNP
NQSQSHMTVSDSIQSEPASSQSQNTFTNFSHSSGIPFDQFWPHMTQTMRP
LNYSLNGSNIDTLLHLAAHFEQRKRGITREELDKLPTHRYKTTSDKHKQR
DKNSLSDAKTANSKEGVPKCLVCLEDFESKQNIRALKCEHEFHAKCIDKW
LKINRTCPLCRADAFDGSAQKDGA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0001578microtubule bundle formation
GO:0032465regulation of cytokinesis
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0005515protein binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 470..510
e-value: 1.9E-7
score: 40.7
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 469..511
e-value: 1.9E-13
score: 50.5
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 470..511
score: 13.035
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 436..516
e-value: 1.2E-19
score: 71.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 429..460
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 53..75
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 429..458
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..216
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 202..216
NoneNo IPR availablePANTHERPTHR46171:SF3GH10160Pcoord: 187..516
NoneNo IPR availablePANTHERPTHR46171FAMILY NOT NAMEDcoord: 187..516
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 469..514