TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30018688
Length (bp)2628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30018688) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018688) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30018688) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018688) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018688

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30018688SMESG000070130.1 SMESG000070126.1 dd_Smed_v4_1439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30018688SMESG000070130.1 SMESG000070126.1 dd_Smed_v4_1439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018688SMESG000070130.1 SMESG000070126.1 dd_Smed_v4_1439_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 61.6178 bits (148), Expect = 4.162e-9
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C ++ EL+    H+  H+  C +  + C
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALMDC 162          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 61.6178 bits (148), Expect = 4.162e-9
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C ++ EL+    H+  H+  C +  + C
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALMDC 162          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 54.299 bits (129), Expect = 3.625e-7
Identity = 37/153 (24.18%), Postives = 63/153 (41.18%), Query Frame = 3
Query:  942 DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKAL--CDYRSELQNIGNHISS---------HKESCPYTNIGCQY-PSAHMGLIVEHLHDQIYEHGKLVTESF 1364
            + LL   + C IC   L  P  + CG RFC  C+  ++      CP       ++ ++   D+  D    R+I Q+K  CP +   C   +    +  H+ S          +E CP+  I C +        + EHL   +  H +L+ ++F
Sbjct:   95 EELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCP-----MDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAF 242          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 57.7658 bits (138), Expect = 4.281e-8
Identity = 37/138 (26.81%), Postives = 59/138 (42.75%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEH 1340
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + VKC    C  + EL+ +  H+S     C +    C  P     + + HL +   +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP------VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPC--PQCQESVPISHLDEHKSQH 182          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 57.7658 bits (138), Expect = 4.281e-8
Identity = 37/138 (26.81%), Postives = 59/138 (42.75%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEH 1340
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + VKC    C  + EL+ +  H+S     C +    C  P     + + HL +   +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP------VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPC--PQCQESVPISHLDEHKSQH 182          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 57.7658 bits (138), Expect = 4.281e-8
Identity = 37/138 (26.81%), Postives = 59/138 (42.75%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEH 1340
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + VKC    C  + EL+ +  H+S     C +    C  P     + + HL +   +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP------VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLS----QCRFATAPC--PQCQESVPISHLDEHKSQH 182          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 57.3806 bits (137), Expect = 6.165e-8
Identity = 43/134 (32.09%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  921 NEYEFAY-----DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYL--NNKETLCPGLSEDCKDQLINFNGDLHA--------DYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            NEY   +     D +  D++LC  CN +L    Q+ CG R+C+ C V++L  NNK+ +C      CK +  N   D           D  I+++I  +KV C    C +RS L+N  +H S  + +    NIGC
Sbjct:   21 NEYPSGFPQSICDEVPKDKYLCSNCNNVLNKARQTVCGHRYCLAC-VNWLVRNNKDLVC----TKCKGEDSNVESDTSVLTPNQFFNDVAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPCNIGC 149          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 51.9878 bits (123), Expect = 1.725e-6
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  888 NAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCK-DQLINFNGDLHADYVISRKISQVKVKCPKAL-CDYRSELQNIGNHISSHKESCPYTNIGCQY 1283
            N++  R W L +     + S L  +F+C  C  I+ NP+Q+ CG  FC +C+  Y  N      G S  C  D +     ++  D    R++  ++V C  A  C  R  L N+ +H+    ++CP+  + C +
Sbjct:   15 NSEASRSWDL-DSRTLRFVSRLEQQFICPSCGGIVLNPHQTGCGHIFCAQCVKAYTEN------GGSSKCPLDSIPIKPEEIFQDNCCKRELLNLEVFCTNAPECTQRFSLCNLQDHL----KACPHERVRCSH 137          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 58.5362 bits (140), Expect = 4.155e-8
Identity = 34/117 (29.06%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP  +E            L  D    R+I  ++VKCP   C    EL+    H+  H   C +  + C
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELR----HLERHLVRCDFAGVEC 164          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 61.2326 bits (147), Expect = 4.234e-9
Identity = 35/120 (29.17%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C  + EL+    H+  H+  C +  + C
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELR----HLEDHQVHCEFALVNC 162          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.584e-9
Identity = 41/135 (30.37%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC-----QYPSAHMGLIVEH 1316
            Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CIV  L +    CP       D  I     L  D    R+I  +KVKCP   C    EL+    H+  H   C + ++ C      +P + +   +EH
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCP------VDNEILMENQLFPDNFAKREILSLKVKCPSQGCTETMELR----HLERHLGQCQFASVECSQCQGSFPKSRLEKHMEH 182          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 9.209e-9
Identity = 43/141 (30.50%), Postives = 63/141 (44.68%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEH 1340
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  L N    CP       D  I     L  D    R+I  ++VKCP   C    EL+    H+  H   C + ++ C   S   G  ++ L D+  EH
Sbjct:   55 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCP------VDNEILMEKQLFPDNFAKREILSLRVKCPNLGCTDTMELR----HLEHHLVQCQFASVEC---SQCQGSFLKLLLDKHMEH 182          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|A7XUJ6|TRAF6_PIG (TNF receptor-associated factor 6 OS=Sus scrofa OX=9823 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.339e-8
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C ++ EL+    H+  H+  C +  + C
Sbjct:   54 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLTVKCPNVGCLHKMELR----HLEDHQAHCEFALMNC 163          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.427e-8
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C ++ EL+    H+  H+  C +  + C
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALVDC 162          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.451e-8
Identity = 35/120 (29.17%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +  Y+  +D  L  ++ C IC + L+   Q+PCG RFC  CI+  + +    CP       D  I     L  D    R+I  + VKCP   C ++ EL+    H+  H+  C +  + C
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP------VDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELR----HLEDHQAHCEFALVDC 162          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 8.059e-28
Identity = 56/169 (33.14%), Postives = 99/169 (58.58%), Query Frame = 3
Query:  900 ERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHI---SSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLT 1397
            E+I +LL  Y F  +  + D   C +C  +L N  QS CGCRFC +CI++Y++     CPG + +CK++ +    ++H DY ++RKI++++VKCP+  C    EL +I  H+   +   ++CP+  +GC  P   +  +  HL +  ++H KL+ +  +N++N+   LT
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLT 172          

HSP 2 Score: 77.0258 bits (188), Expect = 4.325e-12
Identity = 39/129 (30.23%), Postives = 72/129 (55.81%), Query Frame = 2
Query:   26 SEIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFLTCDKRSISCQFNAIG 412
            +E I +++    FE+   +   L+C++C  L++ AC + CGCRFCS  I  Y+S  + +CPG +  C+ + +   ++I  DY  N +I+++ V C ++  +   +LV I  +   C  +S +C F  +G
Sbjct:    3 AEKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLG 131          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.369e-23
Identity = 88/305 (28.85%), Postives = 148/305 (48.52%), Query Frame = 3
Query:  882 MANAKYERIWKLLNEYEFA-YDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHI---SSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVT------------------ESFTNLKNEVASLTLALKHSK--------QELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQVRFMKR*RKHL---PIKYETANLGTELTFGINI 1697
            M  +K + + +LL++Y     D  ++++ LC++CN ++++  +S CGC +C  CI  YL+     CPG   +CK+  +N  GD+  +  +S +IS++ VKCP   C+Y SEL  +  H+   +     CP   IGC+        + +HL DQ+  H +L+                   E  ++LK EV  +  AL   K        +EL NKDN+++ L       Q  +E+K + +T    K         SEL+ LKS  ++F   ++ FMK   + +    IK +  +L  E+ FGI +
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLK-EVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLS------QDIQEVKNEMITLLTSK--------ESELKKLKSDIQIFR-QEIEFMKNDLEVVGSTDIKNQVKDLKKEI-FGIKM 288          

HSP 2 Score: 73.559 bits (179), Expect = 7.944e-10
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 2
Query:   80 ISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFLTCDKRSISCQFNAIGYE---VMNDERKAHL 448
            ++ +L C +CN+LM  AC + CGC +C   I  YLS +H +CPG    C+   +N + D+  +   + RIS I V C   +  +  +L+ +  +   C   S+ C    IG E   ++ DE   HL
Sbjct:   25 VNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHL 150          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A182W055 (Uncharacterized protein OS=Anopheles minimus OX=112268 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.451e-12
Identity = 46/175 (26.29%), Postives = 79/175 (45.14%), Query Frame = 3
Query:  942 DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKAL---------CDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKD 1439
            D LL   + C IC   L  P  + CG RFC +CI D+LN K + CP       ++ ++   D+  D    R+ISQ+K  CP ++          D  + L+     +S   + CP+  I C++ +     +  H+  +  +H +L+ E++T   +         K+S  E+   D
Sbjct:   24 DGLLEARYECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP-----LDNEPLDIKCDIFPDNCTRREISQIKKPCPNSMRGCVDQLSPTDIDTHLRQCPFAMSRQSQPCPFARIKCKFIATDEAALSAHIASECQQHLQLLLETYTGSSDRYKFWDPPAKNSVPEMSTND 193          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A182MKP3 (Uncharacterized protein OS=Anopheles culicifacies OX=139723 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.078e-11
Identity = 46/175 (26.29%), Postives = 79/175 (45.14%), Query Frame = 3
Query:  942 DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKAL---------CDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKD 1439
            D LL   + C IC   L  P  + CG RFC +CI D+LN K + CP       ++ ++   D+  D    R+ISQ+K  CP ++          +  S L+     +S   + CP+  I C++ +     +  H+  +  +H +L+ E++T   +         K+S  E+   D
Sbjct:   24 DGLLEARYECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP-----LDNEPLDIKSDIFPDNCTRREISQIKKPCPNSMRGCVDQFSPTEIDSHLRQCPFAMSRQSQPCPFARIKCKFIATDEAALNAHIASECQQHLQLLLETYTGSSDRYKFWDPPAKNSVPEMSTND 193          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2M4AHW9 (Putative tnf-receptor-associated factor 6 OS=Anopheles triannulatus OX=58253 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.181e-11
Identity = 46/154 (29.87%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  936 AYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKAL--CDYRSELQNIGNH-------ISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTN 1370
            A D LL   + C IC   L  P  + CG RFC +CI D+LN K + CP       ++ ++   D+  D    R+ISQ+K  CP  +  C  +     I +H       +SS  + CP+  + C++ +     + EH+     +H +L+ ES+T 
Sbjct:   22 ADDGLLEARYECPICYCWLNEPILTKCGHRFCRKCITDWLNEKNSNCP-----LDNEPLDIKCDIFPDNCTRREISQIKKPCPNWMRGCADQLSPTEIDSHQLQCPFGMSSQSQPCPFARVKCKFVARDEATLNEHIATDCQQHLQLLLESYTG 170          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 56.9954 bits (136), Expect = 6.697e-8
Identity = 38/117 (32.48%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  942 DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYL-NNKETLCPGLSEDC---KDQLINFNGD-LHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            D L    FLC  CN +L   +Q+ CG R+C  C++  L NNK+ +C    ED     D  +    D   +D  I+++I +++V C    C +RS L++  +H S  + +    NIGC
Sbjct:   20 DDLPPVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGC 136          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 56.9954 bits (136), Expect = 7.217e-8
Identity = 38/117 (32.48%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  942 DSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYL-NNKETLCPGLSEDC---KDQLINFNGD-LHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            D L    FLC  CN +L   +Q+ CG R+C  C++  L NNK+ +C    ED     D  +    D   +D  I+++I +++V C    C +RS L++  +H S  + +    NIGC
Sbjct:   20 DDLPPVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGC 136          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 54.299 bits (129), Expect = 4.641e-7
Identity = 33/117 (28.21%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + V+C    C  + EL+++ NHI      C +  + C
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP------VDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIP----HCKFATVPC 162          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 54.299 bits (129), Expect = 4.641e-7
Identity = 33/117 (28.21%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + V+C    C  + EL+++ NHI      C +  + C
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP------VDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIP----HCKFATVPC 162          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 54.299 bits (129), Expect = 4.742e-7
Identity = 33/117 (28.21%), Postives = 53/117 (45.30%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            Y+  +D  L  ++ C IC + L++  Q+PCG RFC  CI   + +    CP       D  +     L  D    R+I  + V+C    C  + EL+++ NHI      C +  + C
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP------VDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIP----HCKFATVPC 162          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 65.855 bits (159), Expect = 2.318e-11
Identity = 37/119 (31.09%), Postives = 55/119 (46.22%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVD--YLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            YE  ++  L  ++ C IC + L+ P Q+PCG RFC  CI+    L +    CP       D  +   G L  D    R+I  + V+CP   C +R EL+     +  H+  C Y  + C
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCP------VDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRA----LQEHQLRCEYAQVPC 159          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 58.9214 bits (141), Expect = 5.609e-9
Identity = 40/136 (29.41%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  927 YEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETL-CPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGL----IVEHL 1319
            Y+  +   +++E+ C IC+L L+ P Q+ CG RFC EC+ +    K    CP   E      ++   D+  D    R I    VKCP   C + +EL++    + +H  +C Y  + C  P     L    + EHL
Sbjct:   11 YDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-----LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRD----LEAHARNCDYELVTCSNPMCSAQLPRMDVDEHL 137          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 53.5286 bits (127), Expect = 4.012e-8
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  936 AYDS----LLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETL-CPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNI 1223
             YDS     +++E+ C IC+L L+ P Q+ CG RFC EC+ +    K    CP   E      ++   D+  D    R I    VKCP   C + +EL+++
Sbjct:   10 GYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-----LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDL 105          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 51.2174 bits (121), Expect = 1.082e-6
Identity = 38/134 (28.36%), Postives = 59/134 (44.03%), Query Frame = 3
Query:  900 ERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQ-SPCGCRFCMECI--VDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKC--PKALCDYRSELQNIGNHISSHKESCPYTNIGCQYP 1286
            +R+ +    YE  +   L +E+ C IC L  ++P Q   CG RFC  C+  +  L     LCP       D+    +  +  D    R I  + VKC   K  C++  EL N    I  H ++C + ++ C  P
Sbjct:    3 DRVDRATGGYEAEFVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCP------MDRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSN----IEEHAKNCAHEDVHCTNP 126          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 50.0618 bits (118), Expect = 3.176e-6
Identity = 34/131 (25.95%), Postives = 57/131 (43.51%), Query Frame = 3
Query:  894 KYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKC---PKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            +Y    +L   Y+  +D  L  ++ C IC L L++P Q+PCG RFC  CI   + +    CP       D       +L+ D    R++    V C    +  C ++  L+ +  H+    + CP  +  C
Sbjct:   33 QYGGPQRLEEGYDEFFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCP------VDNTPLSERELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHL----KGCPCMDTNC 153          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 50.0618 bits (118), Expect = 3.430e-6
Identity = 32/100 (32.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  957 DEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETL-CPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNH--ISSHK 1247
            DE +C IC++++  P  + CG  +C  CI  + N KE + CP  +E  K   I        D    R +  ++VKC    C ++ EL+    H  I SHK
Sbjct:   26 DELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQI------FPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHK 119          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 59.3066 bits (142), Expect = 1.473e-8
Identity = 37/124 (29.84%), Postives = 55/124 (44.35%), Query Frame = 3
Query:  918 LNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCP----GLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGC 1277
            L  Y+  +D  L  ++ C IC + L+N  Q+ CG RFC  CI   + +    CP     LSED           L  D    R+I  + V+CP + C  + EL+    H+  H   C +  + C
Sbjct:   61 LQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVDNEMLSED----------QLFPDNFAKREILSLTVRCPNSDCGEKMELR----HLEKHLAQCQFATVPC 170          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 50.447 bits (119), Expect = 5.879e-6
Identity = 33/108 (30.56%), Postives = 48/108 (44.44%), Query Frame = 3
Query:  960 EFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKAL--CDYRSELQNIGNHISSHKESCPYTNIGC 1277
            ++ C  C L+L  P Q+ CG RFC  CI D L+    +CP       D    F   +  D    R+I  +KV C      C  +  LQ I +H++     CP+  + C
Sbjct:   45 KYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPA------DMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVN----VCPFFEVPC 142          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 260/268 (97.01%), Postives = 262/268 (97.76%), Query Frame = 3
Query:  804 MHVCRIVNLLSIDHNYYLWTLFNNVIMANAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQ 1607
            MHVCR VNLLSIDHNYYLWTLFNNVIMANAKYERIWKLL+EYEFAYDSLLSDEFLCVICN ILKNPYQSPCGCRFCMECIVDYLN+KET CPG SEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESF NLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFS NQ
Sbjct:    1 MHVCRTVNLLSIDHNYYLWTLFNNVIMANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSSNQ 268          

HSP 2 Score: 83.1889 bits (204), Expect = 1.936e-16
Identity = 43/135 (31.85%), Postives = 76/135 (56.30%), Query Frame = 2
Query:    8 ILYDKMSEIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFL----TCDKRSISCQF 400
            I+ +   E I+K++ E +F   + +S E  C ICN ++     +PCGCRFC + I  YL+     CPG+S+ C++++IN+  D+  DY+ + +IS++ V C K    ++ +L  I  +      +C   +I CQ+
Sbjct:   26 IMANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQY 160          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070130.1 (SMESG000070130.1)

HSP 1 Score: 482.641 bits (1241), Expect = 2.611e-163
Identity = 246/290 (84.83%), Postives = 256/290 (88.28%), Query Frame = 3
Query:  882 MANAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQVRFM----KR*RKH-LPIKYETANLGTELTFGINIYSPYKH*QYKGRR 1736
            MANAKYERIWKLL+EYEFAYDSLLSDEFLCVICN ILKNPYQSPCGCRFCMECIVDYLN+KET CPG SEDCKDQLINFNGDLHADYVISRKISQVKVKCPK LCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESF NLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQ  +     +  RK+ L   Y  +       F   IY+ +K  Q +G+R
Sbjct:    1 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKTLCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQENYYLQNKEEDRKYILQPNYNVSTFDPIAPFKWQIYN-FKVLQSEGKR 289          

HSP 2 Score: 82.4185 bits (202), Expect = 2.736e-16
Identity = 42/128 (32.81%), Postives = 73/128 (57.03%), Query Frame = 2
Query:   29 EIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFL----TCDKRSISCQF 400
            E I+K++ E +F   + +S E  C ICN ++     +PCGCRFC + I  YL+     CPG+S+ C++++IN+  D+  DY+ + +IS++ V C K    ++ +L  I  +      +C   +I CQ+
Sbjct:    7 ERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKTLCDYRSELQNIGNHISSHKESCPYTNIGCQY 134          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070130.1 (SMESG000070130.1)

HSP 1 Score: 481.871 bits (1239), Expect = 2.941e-163
Identity = 246/290 (84.83%), Postives = 256/290 (88.28%), Query Frame = 3
Query:  882 MANAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQVRFM----KR*RKH-LPIKYETANLGTELTFGINIYSPYKH*QYKGRR 1736
            MANAKYERIWKLL+EYEFAYDSLLSDEFLCVICN ILKNPYQSPCGCRFCMECIVDYLN+KET CPG SEDCKDQLINFNGDLHADYVISRKISQVKVKCPK LCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESF NLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQ  +     +  RK+ L   Y  +       F   IY+ +K  Q +G+R
Sbjct:    1 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKTLCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQENYYLQNKEEDRKYILQPNYNVSTFDPIAPFKWQIYN-FKVLQSEGKR 289          

HSP 2 Score: 82.8037 bits (203), Expect = 2.137e-16
Identity = 42/128 (32.81%), Postives = 73/128 (57.03%), Query Frame = 2
Query:   29 EIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFL----TCDKRSISCQF 400
            E I+K++ E +F   + +S E  C ICN ++     +PCGCRFC + I  YL+     CPG+S+ C++++IN+  D+  DY+ + +IS++ V C K    ++ +L  I  +      +C   +I CQ+
Sbjct:    7 ERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKTLCDYRSELQNIGNHISSHKESCPYTNIGCQY 134          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.796e-162
Identity = 235/242 (97.11%), Postives = 237/242 (97.93%), Query Frame = 3
Query:  882 MANAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQ 1607
            MANAKYERIWKLL+EYEFAYDSLLSDEFLCVICN ILKNPYQSPCGCRFCMECIVDYLN+KET CPG SEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESF NLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFS NQ
Sbjct:    1 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSSNQ 242          

HSP 2 Score: 82.4185 bits (202), Expect = 2.867e-16
Identity = 42/130 (32.31%), Postives = 74/130 (56.92%), Query Frame = 2
Query:   29 EIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFL----TCDKRSISCQFNA 406
            E I+K++ E +F   + +S E  C ICN ++     +PCGCRFC + I  YL+     CPG+S+ C++++IN+  D+  DY+ + +IS++ V C K    ++ +L  I  +      +C   +I CQ+ +
Sbjct:    7 ERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPS 136          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 481.485 bits (1238), Expect = 6.792e-159
Identity = 235/242 (97.11%), Postives = 237/242 (97.93%), Query Frame = 3
Query:  882 MANAKYERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSFNQ 1607
            MANAKYERIWKLL+EYEFAYDSLLSDEFLCVICN ILKNPYQSPCGCRFCMECIVDYLN+KET CPG SEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESF NLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFS NQ
Sbjct:    1 MANAKYERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFANLKNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRTLKSVSEVFSSNQ 242          

HSP 2 Score: 201.06 bits (510), Expect = 2.821e-54
Identity = 103/149 (69.13%), Postives = 118/149 (79.19%), Query Frame = 2
Query:   11 LYDKMSEIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFLTCDKRSISCQFNAIG---YEVMNDERKAHL 448
            + DKMSE IYKIMKE KFEIV+EISREL+CNICNELMIKACSAPCGC FCSD IE YL G+ KFCPGTS+ CQ KMINY NDIVI+  +N++ISEI V C +Q  +F+D+L +IA +  TCDK  ISC FNAIG    EVMNDE K HL
Sbjct:  429 VVDKMSESIYKIMKEKKFEIVSEISRELKCNICNELMIKACSAPCGCCFCSDCIEQYLDGADKFCPGTSRRCQMKMINYANDIVIENRANVKISEIIVKCPRQNCEFEDELEMIANHVRTCDKCPISCPFNAIGCKVNEVMNDEMKTHL 577          

HSP 3 Score: 125.561 bits (314), Expect = 2.290e-29
Identity = 76/234 (32.48%), Postives = 123/234 (52.56%), Query Frame = 3
Query:  900 ERIWKLLNEYEFAYDSLLSDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKE---SCPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNL-------KNEVASLTLALKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQLSSELRT 1571
            E I+K++ E +F   S +S E  C ICN ++     +PCGC FC +CI  YL+  +  CPG S  C+ ++IN+  D+  +   + KIS++ VKCP+  C++  EL+ I NH+ +  +   SCP+  IGC+        +  HL+   Y H KL+ +   NL       KNE+  +       KQ+++N +    +   ++ E++   E  I EL E +   K EN +L SE+ T
Sbjct:  435 ESIYKIMKEKKFEIVSEISRELKCNICNELMIKACSAPCGCCFCSDCIEQYLDGADKFCPGTSRRCQMKMINYANDIVIENRANVKISEIIVKCPRQNCEFEDELEMIANHVRTCDKCPISCPFNAIGCKVNEVMNDEMKTHLNQDNYIHSKLLIDIINNLLSEMESMKNEIIEIKRENSQFKQKIDNIELQSANQHQKICEMENPGE--IDELNEEMGALKNENQRLRSEMET 666          

HSP 4 Score: 83.5741 bits (205), Expect = 3.274e-16
Identity = 42/128 (32.81%), Postives = 73/128 (57.03%), Query Frame = 2
Query:   29 EIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYIEHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQRQFKDKLVLIAGYFL----TCDKRSISCQF 400
            E I+K++ E +F   + +S E  C ICN ++     +PCGCRFC + I  YL+     CPG+S+ C++++IN+  D+  DY+ + +IS++ V C K    ++ +L  I  +      +C   +I CQ+
Sbjct:    7 ERIWKLLDEYEFAYDSLLSDEFLCVICNSILKNPYQSPCGCRFCMECIVDYLNDKETHCPGSSEDCKDQLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKESCPYTNIGCQY 134          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF64.162e-929.17TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF64.162e-929.17TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf63.625e-724.18gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf64.281e-826.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf64.281e-826.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf64.281e-826.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf16.165e-832.09TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
traf51.725e-627.61Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf4.155e-829.06epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf64.234e-929.17TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJN2|TRF6B_XENLA1.584e-930.37TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3MV19|TRF6A_XENLA9.209e-930.50TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|A7XUJ6|TRAF6_PIG1.339e-829.17TNF receptor-associated factor 6 OS=Sus scrofa OX=... [more]
sp|B6CJY4|TRAF6_CERAT1.427e-829.17TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU1.451e-829.17TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID88.059e-2833.14TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1011.369e-2328.85TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A182W0558.451e-1226.29Uncharacterized protein OS=Anopheles minimus OX=11... [more]
A0A182MKP31.078e-1126.29Uncharacterized protein OS=Anopheles culicifacies ... [more]
A0A2M4AHW93.181e-1129.87Putative tnf-receptor-associated factor 6 OS=Anoph... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf16.697e-832.48TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf17.217e-832.48TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf64.641e-728.21TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf64.641e-728.21TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf64.742e-728.21TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf62.318e-1131.09TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412435.609e-929.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274264.012e-832.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495451.082e-628.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487733.176e-625.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483943.430e-632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf61.473e-829.84TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf35.879e-630.56TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070126.11.936e-1697.01SMESG000070126.1[more]
SMESG000070130.12.611e-16384.83SMESG000070130.1[more]
SMESG000070130.12.941e-16384.83SMESG000070130.1[more]
SMESG000070126.11.796e-16297.11SMESG000070126.1[more]
SMESG000070126.16.792e-15997.11SMESG000070126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018688 ID=SMED30018688|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2628bp
TATATAAATCTTATATGATAAAATGTCTGAAATCATTTACAAAATTATGA
AAGAAAACAAATTTGAAATTGTGAATGAAATCAGCAGAGAATTGAGATGC
AATATTTGTAATGAATTGATGATAAAAGCTTGCAGCGCGCCATGCGGGTG
CCGATTTTGTTCCGATTACATTGAGCATTATTTGAGTGGAAGTCATAAAT
TTTGTCCAGGAACATCAAAGAGCTGTCAAAATAAAATGATAAATTATAAG
AATGATATTGTCATTGATTATATATCTAACATACGAATATCAGAAATCTC
TGTAACATGCCAAAAACAACAACGTCAATTTAAAGACAAGCTGGTCTTAA
TAGCTGGTTACTTTTTAACATGTGACAAGCGTTCAATCAGCTGCCAATTC
AATGCAATTGGATATGAAGTGATGAATGACGAAAGGAAAGCCCACCTTAT
GAGATGGAGTCAATGAAGAATGAAATAATCGAAGTGCAAATGGAAAAGTT
AGAAAAAAACGCAAAGAAAATTAATAAAATTTGATGATTTTATAAAGTTG
TCCATCATGCTCCAGACCAGATAGAAATTTCCAGACCTATTCAATAATAA
AGCCAAATAAAGAATTATTATCAACAATTTTGTTTATAGATCTGGTTTTT
GATCAGATAAAACAAATGTAGCAAAAGCTACGTCTAGAAATAATACAATG
TTATTATCAGCCAACCAGATCGCTAGAAATATGAAATCAATAGATCGATT
ATAGAAACGTTGACCAATGAAATTGATACACACAAATTATCAGTACTTGT
CTCATGCATGTGTGTCGCATTGTAAATCTGCTCAGTATCGATCACAATTA
TTATCTATGGACTTTATTCAATAACGTCATAATGGCTAATGCAAAATACG
AACGCATATGGAAATTACTTAACGAATATGAATTCGCCTATGATTCACTT
TTGTCTGACGAGTTTCTCTGTGTGATTTGCAATTTGATTTTAAAGAATCC
TTATCAAAGTCCTTGCGGATGCCGATTCTGTATGGAATGTATTGTGGATT
ACTTAAACAACAAAGAAACGCTTTGCCCGGGATTAAGTGAAGATTGCAAA
GACCAACTGATCAATTTCAATGGAGATTTGCATGCTGATTATGTGATTAG
TCGGAAAATTTCCCAAGTGAAAGTCAAGTGCCCAAAGGCGTTGTGTGATT
ACAGAAGTGAACTGCAAAACATCGGCAATCACATCAGCTCCCACAAAGAA
AGCTGTCCTTACACGAATATTGGATGCCAATATCCCAGTGCTCACATGGG
ACTGATTGTTGAGCATCTCCACGACCAGATCTATGAGCATGGGAAATTGG
TGACGGAATCTTTCACCAATTTGAAAAATGAAGTCGCATCCTTGACGTTG
GCTTTGAAGCATTCCAAACAGGAATTGGAAAACAAAGATAATTTATTGAT
TGATTTGGAAAATCGATTGAACGAGTTGCAAGGAACACGGGAAATAAAGA
TCCAAGAATTGACAGAGACTTTGGATAAGTGCAAAGAAGAAAATGTTCAA
CTGAGTTCTGAATTGAGGACATTGAAATCTGTTTCCGAGGTTTTCTCCTT
CAATCAAGTGAGATTCATGAAAAGATAGAGAAAGCATTTGCCTATAAAAT
ATGAAACTGCAAATTTGGGCACGGAACTCACTTTTGGCATTAATATATAT
TCCCCATACAAACATTGACAGTATAAAGGGAGACGAAGCCAGTATGGTCT
TCTAGGGGCGAGGGGATTCAAGTGTAAGCATATTTCTCATAGACTAATGC
ATAGCAATCGCAAAATCTCTTAGTGCTGATTTTGAACTTGAATGTTTTGG
ATCCCTTTAATCACATGTAGAAAAATTCTTGAGATCATTATCACAAAATG
TCCAAAAGGTGCAAATAAGTAGTGACAATACAAGCTGCATTCTCTAAAGT
TTACCAGTAAGATACTTTGTAGGAATTTTCAAATTTTCAAATTTGTTTTT
TCTAACTACGTTGACAGACAATTTCAAAAATATATCGAGAAGTCATTGTT
TCTATTCTCATGGGGTAAGGAATTGAATTCCGTACAGATTCCCTTTAAAT
ATTTATTTGTAAACAAAACTTTGCATTAAATTGTAAATAACAGGGGTGGG
CACAGTTATGTGTCTTGGGAGCCGCATTCATATAAAATCAATTTATGAAG
AGCCGCATTGATTTAAAAAAAAAATCAAAACAGTGTGCTTGGATTATGGT
GCAATTTAAGTATATTGATGAAATAAAGTCAAATACTTATTATTCACTAT
ATTGATTTAGCTTAAAAACATTATTTATTGAGAATTCCCAAATCAGAATA
AATCAATCAAAACATTTAACAGAGACAGATAGTTCTTTTTGTTTGTAAAA
ATGATCGTAATCAGAGTTGTTCAGTGAATTGCGACACTGAACCTTGCTCG
CTAATTTTCAGAAATTAGGTAGATAATTTGTTGATGCTGTTTGAAATAGT
TCTAACAATGCTCATCTGTTGCTCGAATTTTTGATTAAACAAATTTCATA
GTGGAGAACATTTAAACTTTAAATGTTTAAATTACTTTGTTTTTTAATCA
TATACTGTGAAATTTCTCGATTTGAAAA
back to top

protein sequence of SMED30018688-orf-1

>SMED30018688-orf-1 ID=SMED30018688-orf-1|Name=SMED30018688-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MHVCRIVNLLSIDHNYYLWTLFNNVIMANAKYERIWKLLNEYEFAYDSLL
SDEFLCVICNLILKNPYQSPCGCRFCMECIVDYLNNKETLCPGLSEDCKD
QLINFNGDLHADYVISRKISQVKVKCPKALCDYRSELQNIGNHISSHKES
CPYTNIGCQYPSAHMGLIVEHLHDQIYEHGKLVTESFTNLKNEVASLTLA
LKHSKQELENKDNLLIDLENRLNELQGTREIKIQELTETLDKCKEENVQL
SSELRTLKSVSEVFSFNQVRFMKR*
back to top

protein sequence of SMED30018688-orf-2

>SMED30018688-orf-2 ID=SMED30018688-orf-2|Name=SMED30018688-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MSEIIYKIMKENKFEIVNEISRELRCNICNELMIKACSAPCGCRFCSDYI
EHYLSGSHKFCPGTSKSCQNKMINYKNDIVIDYISNIRISEISVTCQKQQ
RQFKDKLVLIAGYFLTCDKRSISCQFNAIGYEVMNDERKAHLMRWSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0043122regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 187..260
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 41..171
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 49..125
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 39..162
e-value: 6.8E-19
score: 70.1
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 41..171
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 56..92
score: 9.819