E3 ubiquitin-protein ligase TRIM9

Overview
NameE3 ubiquitin-protein ligase TRIM9
Smed IDSMED30018687
Length (bp)3042
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TRIM9 (SMED30018687) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIM9 (SMED30018687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TRIM9 (SMED30018687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRIM9 (SMED30018687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018687SMESG000016119.1 SmedASXL_007122SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018687SMESG000016119.1 dd_Smed_v6_9989_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018687SMESG000016119.1 OX_Smed_1.0.10431ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
dorsal-ventral muscle cellSMED30018687SMESG000016119.1 dd_Smed_v4_9989_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM9 (tripartite motif containing 9 [Source:HGNC Symbol;Acc:HGNC:16288])

HSP 1 Score: 457.988 bits (1177), Expect = 1.245e-147
Identity = 258/747 (34.54%), Postives = 394/747 (52.74%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYS------------------LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E     S +      S +  +       D D +S  SE DSG        S   +    S   V   P A                    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T ++  F     S   D+ +SN+  T++  S DD V+LG TG S+G+HYWE  +D+ D    PAFGVAR D  +D MLG DDK W+MY++  RSWF+H + H  RT+GGI  G+T+GV LD ++  L+++INDE  GPIAF  +                           F+PAVS N+ VQ TL  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGL------------------------FFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 420.239 bits (1079), Expect = 3.652e-133
Identity = 249/762 (32.68%), Postives = 384/762 (50.39%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQD-SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RGKV-----ASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRR----------QKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA           +T++ Q  DG  +            D +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ +   RG V     A+  + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L A   G                   +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E+D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +   + +                 P  P+   E+C   NN  T+ W+  P+    V  Y LE+DDGAGG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCA-----------RTIAVQTPDGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQLDFIQMKCR--------------VPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 710          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 414.461 bits (1064), Expect = 3.918e-130
Identity = 256/813 (31.49%), Postives = 391/813 (48.09%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQN--QDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RGKV-----ASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL-----------HAAESGTKILENK---------------------RRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L Q      G+G    A  A + E D                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ +   RG V     A+  + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L            AA   T   +                         +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E+D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +                D++    P  P+   E+C   NN  T+ W+  P+    V  Y LE+DDGAGG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAGAAAAASLEHDAAAGPACGGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQL----------------DFIQMKLPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 770          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM67 (tripartite motif containing 67 [Source:HGNC Symbol;Acc:HGNC:31859])

HSP 1 Score: 410.609 bits (1054), Expect = 9.944e-129
Identity = 255/813 (31.37%), Postives = 390/813 (47.97%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQN--QDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RGKV-----ASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL-----------HAAESGTKILENK---------------------RRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L Q      G+G    A  A + E D                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ +   RG V     A+  + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L            AA   T   +                         +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E+D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +   + +                 P  P+   E+C   NN  T+ W+  P+    V  Y LE+DDGAGG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAGAAAAASLEHDAAAGPACGGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQLDFIQMKCR--------------VPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 772          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Match: TRIM9 (tripartite motif containing 9 [Source:HGNC Symbol;Acc:HGNC:16288])

HSP 1 Score: 293.508 bits (750), Expect = 1.301e-87
Identity = 179/564 (31.74%), Postives = 287/564 (50.89%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYS------------------LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMY 1743
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E     S +      S +  +       D D +S  SE DSG        S   +    S   V   P A                    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M  + DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T +      Y
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRM--TTDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGKALQQY 541          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223908:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 380.948 bits (977), Expect = 4.253e-118
Identity = 241/740 (32.57%), Postives = 358/740 (48.38%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTS--------------------------EQDSDHLSEASETDSGVVVNTRIV-STAVSGVDHSFIYVNNRPCAYSLQ--CPTCKRL-ILLDSSGIDCIIQNKALDRVVQNF-----------------------RGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTK-----ILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPY-PGPEVLYYTLEIDDGAG-GPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPH----GPIAFTKL 2145
            ME ELKC +C  +F+  ++L CGHS+C  CA    +       + +   +       S IL+  S                          + +SD LS  SETDSGVV   R    +++ G   S ++    P    +Q  C +C++     D + I     N A+  V++ +                               S CQ+C   E   A   CEQC+IYYC  C    HP RGPL +H L  A  G +     I      +    C  H  E L ++C  C++ +C  C+QD  H  H++ ++   CK  KTELS  LQ LSEKAK+  + I  LK L + +   C   ++ +   ID+LI  L  +K +L+ ++ ++   K    K  I + T  L + +  IQFCIE L+E D T ++ ISN+LL +   +E  + +E+  K     +F + + D + LQ  I T+   + +          D  ++  P API    +C   NN  TV W+P   G  V  + LEID G   G F++VY G + +CT++GLHF + Y  RVK++N  GES YS++ICL+T  +  F +  + +  D+ +SN   TLS  S +   ILGS   S+GVHYWE  ID+ D  +    GVA+    R+ MLG D  GWSMY++ +RSW+LH   H  R  GG+  G+ +GVRLDCD+G + Y +ND         +AFT +
Sbjct:    1 MEEELKCTICIRFFEDPIILTCGHSLCRMCALKAHQPSTSSGSSSTSSPRPSTPGILSQILSSASSPISPQSAGSSSGASDTMSLCVSDNGDHESDKLSVVSETDSGVVGCGRTSRPSSIIGPPLSRLHNILTPSTSGVQLVCNSCQKPSYFCDENSIVSAPTNLAMQNVIRRYLLAHPDKAFLTPSCSGSSGSSGSSQSSDEASSQCQLCEGSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFLWHKEMRTKPETDSEFVLNL-DTKHLQYTIQTLDFAQLKAGPRGTRFKGD--ASRVPSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDDGNFKEVYSGPDTICTIDGLHFNTVYAARVKSYNSAGESEYSESICLQTAHVAWFQLTKSPSQRDMILSNECATLSGSSLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGVAQPAVNRNVMLGKDLHGWSMYVDGERSWYLHNETHHNRVLGGVTRGTVIGVRLDCDRGTMEYTVNDRKRIYQDDSMAFTNM 737          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Match: madd-2 (pep chromosome:WBcel235:V:1223901:1235445:-1 gene:WBGene00016539.1 transcript:C39F7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-2)

HSP 1 Score: 379.793 bits (974), Expect = 6.745e-118
Identity = 243/740 (32.84%), Postives = 356/740 (48.11%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILA----PTSEQ----------------------DSDHLSEASETDSGVVVNTRIV-STAVSGVDHSFIYVNNRPCAYSLQ--CPTCKRL-ILLDSSGIDCIIQNKALDRVVQNF-----------------------RGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTK-----ILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPY-PGPEVLYYTLEIDDGAG-GPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPH----GPIAFTKL 2145
            ME ELKC +C  +F+  ++L CGHS+C  CA    +       + +   +       S IL+    P S Q                      +SD LS  SETDSGVV   R    +++ G   S ++    P    +Q  C +C++     D + I     N A+  V++ +                               S CQ+C   E   A   CEQC+IYYC  C    HP RGPL +H L  A  G +     I      +    C  H  E L ++C  C++ +C  C+QD  H  H++ ++   CK  KTELS  LQ LSEKAK+  + I  LK L + +   C   ++ +   ID+LI  L  +K +L+ ++ ++   K    K  I + T  L + +  IQFCIE L+E D T ++ ISN+LL +   +E  + +E+  K     +F + + D + LQ  I T+                D+     P API    +C   NN  TV W+P   G  V  + LEID G   G F++VY G + +CT++GLHF + Y  RVK++N  GES YS++ICL+T  +  F +  + +  D+ +SN   TLS  S +   ILGS   S+GVHYWE  ID+ D  +    GVA+    R+ MLG D  GWSMY++ +RSW+LH   H  R  GG+  G+ +GVRLDCD+G + Y +ND         +AFT +
Sbjct:    1 MEEELKCTICIRFFEDPIILTCGHSLCRMCALKAHQPSTSSGSSSTSSPRPSTPGILSQILSSASSPISPQSAGSSSGASDTMSLCVSDNGDHESDKLSVVSETDSGVVGCGRTSRPSSIIGPPLSRLHNILTPSTSGVQLVCNSCQKPSYFCDENSIVSAPTNLAMQNVIRRYLLAHPDKAFLTPSCSGSSGSSGSSQSSDEASSQCQLCEGSENRMANVFCEQCDIYYCTPCQTALHPARGPLAKHNLLQANDGERKKSSAITTATTVRDLLRCATHPGEGLTMYCLACKVPVCSRCLQDLRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVKNNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRRILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFLWHKEMRTKPETDSEFVLNL-DTKHLQYTIQTL----------------DFAQLKVPSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDDGNFKEVYSGPDTICTIDGLHFNTVYAARVKSYNSAGESEYSESICLQTAHVAWFQLTKSPSQRDMILSNECATLSGSSLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGVAQPAVNRNVMLGKDLHGWSMYVDGERSWYLHNETHHNRVLGGVTRGTVIGVRLDCDRGTMEYTVNDRKRIYQDDSMAFTNM 723          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Match: Trim9 (gene:FBgn0051721 transcript:FBtr0304114)

HSP 1 Score: 416.772 bits (1070), Expect = 7.970e-132
Identity = 252/673 (37.44%), Postives = 353/673 (52.45%), Query Frame = 1
Query:  310 TSEQD-SDHLSEASETDSGVVV---NTRIVSTAVSGVDHSFIYVNNRP-CAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEI---EPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFT---MYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            TS+QD SD +S  SE DSGVV     +R VS A +G+      V   P  AY L CP C++L+  D  G+  +   +A++ +V  F    A E   CQ+C    ++ A  +CEQCEI YC  C +  HP RGPL +H L       +       Q++S C  H  E L+ +C +C+   C  CI +  H  H++ +I+  CK QKTELSH LQ LSEKA+S  +FI  LK +S+K+ + C + E  + +  + LI  +++++  L+  I+ +K  K    K+     T  L +  G IQFCIE L+E+D+ +FL + + L+ +V   +  + QE+    P++S   D  +   D   L + I  +   + +     A    D     AP  P   P  C   NN  TV WQP     V  Y LE+DDG+GG FR+VY G E +CTV+GLHF S YN RVKA N  GE  YS+ I L+T ++  FT   +        +  S N  T+S E  +  V LGS G SRGVHYWEF ID       PAFGVAR D  R++MLG D+K ++MYI+ +RSWF H   H  R +GGI  GST+GV LD ++  LS+ +N+ P G +AF  L                           FYPAVS N+ V  T+    + P
Sbjct:  107 TSDQDQSDKVSIFSEADSGVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRF---CAREALRCQMCETDPKV-ASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQ-------QRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTL---DDAALARAIDNLNFIQMR-----AVKDGDERCPAAPMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGV------------------------FYPAVSINRGVTLTMHTAMDAP 735          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Match: Trim9 (gene:FBgn0051721 transcript:FBtr0080096)

HSP 1 Score: 416.001 bits (1068), Expect = 9.226e-132
Identity = 250/673 (37.15%), Postives = 352/673 (52.30%), Query Frame = 1
Query:  310 TSEQD-SDHLSEASETDSGVVV---NTRIVSTAVSGVDHSFIYVNNRP-CAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEI---EPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFT---MYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            TS+QD SD +S  SE DSGVV     +R VS A +G+      V   P  AY L CP C++L+  D  G+  +   +A++ +V  F    A E   CQ+C    ++ A  +CEQCEI YC  C +  HP RGPL +H L       +       Q++S C  H  E L+ +C +C+   C  CI +  H  H++ +I+  CK QKTELSH LQ LSEKA+S  +FI  LK +S+K+ + C + E  + +  + LI  +++++  L+  I+ +K  K    K+     T  L +  G IQFCIE L+E+D+ +FL + + L+ +V   +  + QE+    P++S   D  +   D   L + I  +                +++   AP  P   P  C   NN  TV WQP     V  Y LE+DDG+GG FR+VY G E +CTV+GLHF S YN RVKA N  GE  YS+ I L+T ++  FT   +        +  S N  T+S E  +  V LGS G SRGVHYWEF ID       PAFGVAR D  R++MLG D+K ++MYI+ +RSWF H   H  R +GGI  GST+GV LD ++  LS+ +N+ P G +AF  L                           FYPAVS N+ V  T+    + P
Sbjct:  107 TSDQDQSDKVSIFSEADSGVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRF---CAREALRCQMCETDPKV-ASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQ-------QRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTL---DDAALARAIDNL----------------NFIQMRAPMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGV------------------------FYPAVSINRGVTLTMHTAMDAP 724          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Match: CG8419 (gene:FBgn0031999 transcript:FBtr0079589)

HSP 1 Score: 83.1889 bits (204), Expect = 7.977e-16
Identity = 106/479 (22.13%), Postives = 187/479 (39.04%), Query Frame = 1
Query:  103 PINVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQ---------------DGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNT-----RIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR---GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKS--------------NCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQF----IHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQL------IATMRLTEAQV 1398
            P N      +LKC +C   +     L C HS C QC    + + N  +++L  Q+Q                G+ +  +A ++P  ++ S       ++   +V+ +     R  S+  +    SF    +  C   ++C TC     L   G+  + QN  L R ++  R   G+    + +C +C+E  EI A + C  C +  C  C +  H  +     H + +      ILE +R +K+                C  HTN EL  FC NCR + C  C+   H  H   TI     +Q      LL+  +++ +   Q+    I  L +++  IN +C   +T++   + + +  L   +  L+  I   +  K     +          +A   ++F  E+         L     LL ++   +Q F   ++PK+S S  F  +I    T  Q       I TM++ E  +
Sbjct:  296 PENTVIFTDDLKCGICLDVYTDPRTLHCLHSFCLQC----LVSENFKDESLWDQDQARSEEPSNYSLRSEMGGSSAELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASEVSTRC---IRCHTCNYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVISRVWCSLCTE--EISATYHCISCTLNLCTLCKE-AHERQRSTASHRMRS------ILELRRARKQKQQQMGLGDSSKLVLRCGIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQ----GKLLKEATDQTRPLCQYAEHSIERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVLKQQLDLEKRTQQAMDAVRFSQELCEIGADVEILSYVTILLRRLEYCQQ-FKPPVDPKISDSLHFLPKIRAPSTKDQRDIPLYGIITMQVVEPSL 753          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:100332164])

HSP 1 Score: 445.277 bits (1144), Expect = 3.164e-143
Identity = 254/727 (34.94%), Postives = 390/727 (53.65%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL---HAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFW-----QPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFT 2268
            ME ELKCP+C   FK+ ++LPC H++C  CA NI   V         QN+    S +  +       D D +S  SETDSG    T  + +  +GV      + +R C  S+ CP C R + LD  G+  + +N+ L+ +V  ++  + AS K  CQ+C +R  + A  MCEQC+++YC  C  RCHP RGPL +H L     A++G+        +K+  C+ H  E  +++C +CR  +C  C+++  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK+L ++I +   + E  +++  D LI  L  +K +L++ +  EK  K    K+ I   T  L +  G ++FC+E+++E+D + FL IS++L+ +V   +  +++  +EPK+    +F + ++    +Q ++                   D+  N  P AP+   E+C   NN  T+ W     Q  P   V  Y LE+DDG GGP+R+VY G E VCTV+GLHF SSY+ RVKA+N  G   YS  + L+T  +  FT    S   D+ ++N   T++  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVG+ LD  K  L+++IN + HGP+AF  L                           F PAVS N+ VQ +
Sbjct:    1 MEEELKCPVCGSLFKEPIILPCSHNVCLACARNI--TVQTPEGETPPQNRSSGTSDYDYL-------DMDKMSMYSETDSGYGSYTPCLKSP-NGVRVFPPALMHRHC--SITCPLCHRSVSLDERGLRGLQRNRLLEAIVSRYQQSRAASVK--CQLC-DRNPVDATVMCEQCDVFYCSPCQQRCHPSRGPLAKHRLLPPTQAQAGSAQPPGAPARKQPTCVDHEAENYSMYCASCRTPVCYQCLEEGKHGKHDVKPLAAMWKQHKCQLSQALNGVSDKAKEAKEFLVQLKNLLQQIQENGVEFEACLVAQCDSLIEALTRQKAKLLTKVTKEKENKLKTVKDQITHCTMKLRQTTGMMEFCLEVIKENDPSGFLQISDALIKRVLASQDQWVKGALEPKVC--PEFALTVNTDPLMQSILQL-----------------DFTQNKVPPAPLLQLEKCCMRNNSATLAWRITTVQALP---VEGYVLELDDGNGGPYREVYVGKETVCTVDGLHFNSSYSARVKAYNSAGVGAYSKVVVLKTSDVAWFTFDPTSAHRDIVLTNENQTVTCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGISKGSTVGILLDLTKHTLTFFINKQQHGPMAFENLEGV------------------------FMPAVSLNRNVQVS 666          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: trim9 (tripartite motif containing 9 [Source:ZFIN;Acc:ZDB-GENE-030131-8043])

HSP 1 Score: 419.083 bits (1076), Expect = 3.418e-133
Identity = 253/756 (33.47%), Postives = 376/756 (49.74%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYS------------------------LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISD---LETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  +F++ ++LPC H+IC  CA NI+    +     S +      S +  +       D D +S  SE DSG       VS   +    S   V   P +                          L CP C R + LD  G+    +N+ L+ VV  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G +I      +K S C  H  E L+++C  C+  +C  C++D  H  HE+  +  + K  K +LS  L  LS++A    +F+  L+++ + I +   + E  +++  D LI  LN +K +L+S +  E   K +  ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+MS   DF++ +     L+T+ QL                    D+V    P API   E+C    +  T+ W+  P   +    Y LE+DDG GG FR+VY G E +CTV+GLHF S+Y  RVKA N  G   YS  + ++T ++  FT    S   D+ +SN+  T++  S DD V++G+TG SRGVHYWE  ID+ D    PAFGVAR+D  +D MLG DDK W++                  TDGGI  G+TVGV LD  +G L + INDE  GP+AF  L                           +YPA+S N+ VQ TL  G  +P
Sbjct:    4 MEEELKCPVCGSFFREPIILPCSHNICLACARNILVQTPDAESPQSSRASGSGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPSMPPPQQAQHHLLPHTGVLPPVPRNSCLTCPQCHRSLTLDDRGLRGFPKNRVLEGVVDRYQQSKAAALK--CQLC-EKSPREATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEDGKHSTHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIEALNRRKAQLLSRVTKEHEHKLSVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHMTENQWGKGSLTPRMS--SDFDLTLDSGPLLQTIHQL--------------------DFVQMKVPAAPILQLEECCTQTSSATLSWKQPPLSTIAVDGYILELDDGTGGQFREVYVGTEMICTVDGLHFNSTYKSRVKAFNSSGVGQYSKTLVMQTSEIAWFTFDSASAHPDIILSNDNLTVTCNSYDDRVVMGNTGFSRGVHYWEMTIDRYDNHPDPAFGVARADVMKDVMLGKDDKAWAI------------------TDGGISKGATVGVLLDFTRGILLFLINDEQQGPVAFNTLEGM------------------------YYPAISLNRNVQVTLHSGLPIP 684          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: trim46a (tripartite motif containing 46a [Source:ZFIN;Acc:ZDB-GENE-110825-1])

HSP 1 Score: 131.724 bits (330), Expect = 6.585e-31
Identity = 140/646 (21.67%), Postives = 261/646 (40.40%), Query Frame = 1
Query:  109 NVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVA--SEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKR-RQKKSNCLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFL---LISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQIS-DLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEID---DGAGGPFRKVY-------RGCEC-----------VCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNS----NSDDVYISNN--------GFTL---------STESTDDHVILGSTGLSRGVHYWEFRIDKMDPGA 1896
            N+ +ME EL CP+C    K+ ++LPC HS+C  CA  ++         L  +      S       P +     +     +TD       R++ T V G        +  P      CPTC+R + L   G+   ++N  L+R+V+ +R  V+  +    CQ C   + + A   C  C   +C +C    HP   P  +H          IL     R K   C+ H  E L  +C +C+ ++C  C ++  H  H+I  I    +  K +++  +  +     S    I  ++S   +     A  + ++   ++EL ++L E++G L   ++  ++++ A     + +  + L  A G + +  E+L+ESD + F+    ++++ L K     Q F    +P   H   F + +S +L+ L  +                    D++   AP AP+   ++ L  + ++  +  P       +Y++E      GAG  + +V+        G  C              ++ L   S Y +RV+  N+ G   YS+ + L T    V +   +S    +++ V +           G TL         S   T D +++    +++G HYW   +   +PG+
Sbjct:   22 NMKSMERELHCPVCEEMVKQPIVLPCSHSVCVLCAAEVLVQRGYPPPELPPEPNTPTSS-------PLTRSPRQNRRPPPKTDR----LDRVIRT-VCGTHPGRRRKDTPPILMLFPCPTCRRDVELGERGLADCLRNLTLERIVERYRHTVSLGTMAIMCQFCKPPQTLEATKGCADCRSNFCNECFKLYHPWGTPRAQH--------EHILPTHSFRPKVLVCVEHEQERLQFYCRSCQRLLCSLCKLRRAHSGHKIMPIALAYQTLKDKITKEMNYILANQDSVQAQITQVESGIAQTEVNSAVVKEQLSQCVNELRAVLAERQGALAMCLEGSRAQRAAALNAQLSEKQSLLENA-GLLTYTQELLKESDQSCFVQAARVTHNRLVKAIENLQHFSLSADPSFRH---FQMDVSRELKALSSM--------------------DFI--QAPLAPVIDTQKTLAYDQLYLCWRLPQDSAPAWHYSVEFQRKVGGAGAVWGRVWSEGSSGSNGTHCSWQRLDDVGGTSAVIDKLEMDSVYVLRVRGCNKAGFGEYSEEVYLHTTPAPVLSFCLDSRWGLHAERVALGKGQTYARSVPGMTLLQAADRALTSCHLTSD-LLVADVSITQGRHYWACSV---EPGS 617          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: trim46a (tripartite motif containing 46a [Source:ZFIN;Acc:ZDB-GENE-110825-1])

HSP 1 Score: 129.413 bits (324), Expect = 3.749e-30
Identity = 139/645 (21.55%), Postives = 260/645 (40.31%), Query Frame = 1
Query:  112 VANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVA--SEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKR-RQKKSNCLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFL---LISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQIS-DLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEID---DGAGGPFRKVY-------RGCEC-----------VCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNS----NSDDVYISNN--------GFTL---------STESTDDHVILGSTGLSRGVHYWEFRIDKMDPGA 1896
            + +ME EL CP+C    K+ ++LPC HS+C  CA  ++         L  +      S       P +     +     +TD       R++ T V G        +  P      CPTC+R + L   G+   ++N  L+R+V+ +R  V+  +    CQ C   + + A   C  C   +C +C    HP   P  +H          IL     R K   C+ H  E L  +C +C+ ++C  C ++  H  H+I  I    +  K +++  +  +     S    I  ++S   +     A  + ++   ++EL ++L E++G L   ++  ++++ A     + +  + L  A G + +  E+L+ESD + F+    ++++ L K     Q F    +P   H   F + +S +L+ L  +                    D++   AP AP+   ++ L  + ++  +  P       +Y++E      GAG  + +V+        G  C              ++ L   S Y +RV+  N+ G   YS+ + L T    V +   +S    +++ V +           G TL         S   T D +++    +++G HYW   +   +PG+
Sbjct:    1 MKSMERELHCPVCEEMVKQPIVLPCSHSVCVLCAAEVLVQRGYPPPELPPEPNTPTSS-------PLTRSPRQNRRPPPKTDR----LDRVIRT-VCGTHPGRRRKDTPPILMLFPCPTCRRDVELGERGLADCLRNLTLERIVERYRHTVSLGTMAIMCQFCKPPQTLEATKGCADCRSNFCNECFKLYHPWGTPRAQH--------EHILPTHSFRPKVLVCVEHEQERLQFYCRSCQRLLCSLCKLRRAHSGHKIMPIALAYQTLKDKITKEMNYILANQDSVQAQITQVESGIAQTEVNSAVVKEQLSQCVNELRAVLAERQGALAMCLEGSRAQRAAALNAQLSEKQSLLENA-GLLTYTQELLKESDQSCFVQAARVTHNRLVKAIENLQHFSLSADPSFRH---FQMDVSRELKALSSM--------------------DFI--QAPLAPVIDTQKTLAYDQLYLCWRLPQDSAPAWHYSVEFQRKVGGAGAVWGRVWSEGSSGSNGTHCSWQRLDDVGGTSAVIDKLEMDSVYVLRVRGCNKAGFGEYSEEVYLHTTPAPVLSFCLDSRWGLHAERVALGKGQTYARSVPGMTLLQAADRALTSCHLTSD-LLVADVSITQGRHYWACSV---EPGS 595          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Match: mid2 (midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1])

HSP 1 Score: 122.479 bits (306), Expect = 4.075e-28
Identity = 139/612 (22.71%), Postives = 238/612 (38.89%), Query Frame = 1
Query:  451 SLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF----------------------------RGKVAS-----EKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGP-FRKVYRGCECVC----------TVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTE--------------STDDHVILGSTGLSRGVHYWEFRIDKMDPGAQP--AFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYY 2103
            + QCPTC+ +I L+  G++ + +N  L  ++  F                            RG  AS     E+  CQ C +     A   C  CE+ YC  CL   HP + P   H L    +  ++       +   CL H NE++N++C     +IC  C +   H +H++ ++       K  L + L +L ++       +  L  + +++    A  E +++   DEL+ I+ ++K  +   I++ K  K  +  + I      L R++  I      L+E+D T FL  + ++  +V  +  A  Q + P ++ +  F+    D    ++++  +                DY++  AP  P    E C  +++  TV W       V  Y L+     G   F  +Y   +             TV GL   + Y   VKA NQ G S  S+   L+T     F +   +    + +SN+  T+  +               T  +   G+  +  G HYWE  +     GA    A GVA     ++E  G +   W    +   + FL +H + E           VGV LD D   LS+Y
Sbjct:   53 AFQCPTCRYVITLNQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPNESRRPRPYSATLGGSARGSPASSAMSLERVGCQFCDQEPPREAVKTCVTCEVSYCDRCLRATHPNKKPFTSHRLVEPVADAQL-------RGLACLEHENEKVNMYCVVDDQLICALCKLVGRHREHQVTSLSDRFDKLKQTLENNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLVEECDELVEIIRQRKQVIAVKIKESKVMKLRKLAQQIANCRQCLERSSALITQAEHSLKENDHTRFLQTARNVAERV-AMATASSQVLIPDVNLNEAFDNFALDFSREKKILEGL----------------DYLT--APNPPSIREELCTASHDTITVHWTSEDEFSVTSYELQYTIYTGQTNFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFFVKAINQAG-SRNSEPARLKTNS-QPFKLDPKTAHKKLRLSNDCLTMEKDESSLKKSHTPERFSGTGSYGAAGNVFIDSGCHYWEVLL-----GASTWYALGVAYKSAPKNEWSGKNSSSW--VFSRCNNNFLVRHNNKESIVEASLQLRRVGVLLDYDNNTLSFY 629          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 434.491 bits (1116), Expect = 9.978e-139
Identity = 251/751 (33.42%), Postives = 388/751 (51.66%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHS-----------------------FIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC HS+C  CA NI+    +   + S Q++  +G      L      D D +S  SE DSG        S   +    S                        + +   P    L CP C R ++LD  G+    +N+ L+ V++ ++   A+    CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   D N+   D   L Q I  +   + +V                P  P+   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+V+ G E +CTV+GLHF S+YN RVKA N+ G S YS  + L+T ++  F     S   D+  SN+  T++  S DD V+LG +G S+GVHYWE  ID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R++GGI  G+TVGV LD  +  L++ IN+E  GP+AF  +                           F+PAVS N+ VQ T+  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPD---SESPQSRRASGVSDYDYL------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNSCLTCPQCHRSLILDERGLRGFAKNRVLEGVIERYQQSKAAALR-CQLC-EKSPKEATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLNL---DSAPLLQSIHQLDFVQMKVPSL------------VPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGL------------------------FFPAVSLNRNVQVTIHTGLPVP 703          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 429.483 bits (1103), Expect = 1.004e-136
Identity = 247/744 (33.20%), Postives = 382/744 (51.34%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHS-----------------------FIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTL 2271
            ME ELKCP+C  ++++ ++LPC HS+C  CA NI+  V   +    Q  +    S +  +       D D +S  SE DSG        S   +    S                        + +   P    L CP C R ++LD  G+    +N+ L+ V++ ++   A+    CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   D N+   D   L Q I  +   + +V                P  P+   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+V+ G E +CTV+GLHF S+YN RVKA N+ G S YS  + L+T ++  F     S   D+  SN+  T++  S DD V+LG +G S+GVHYWE  ID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R++GGI  G+TVGV LD  +  L++ IN+E  GP+AF  +                           F+PAVS N+ VQ  L
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHSLCLSCARNIL--VQTPDSESPQSRRASGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNSCLTCPQCHRSLILDERGLRGFAKNRVLEGVIERYQQSKAAALR-CQLC-EKSPKEATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLNL---DSAPLLQSIHQLDFVQMKVPSL------------VPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGL------------------------FFPAVSLNRNVQLKL 696          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 418.313 bits (1074), Expect = 4.587e-132
Identity = 253/788 (32.11%), Postives = 390/788 (49.49%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHS-----------------------FIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLET-------------GKLTV------------------------FTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC HS+C  CA NI+    +   + S Q++  +G      L      D D +S  SE DSG        S   +    S                        + +   P    L CP C R ++LD  G+    +N+ L+ V++ ++   A+    CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   D N+   D   L Q I  +   + +V                P  P+   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+V+ G E +CTV+GLHF S+YN RVKA N+ G S YS  + L+T             G+L +                        F     S   D+  SN+  T++  S DD V+LG +G S+GVHYWE  ID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R++GGI  G+TVGV LD  +  L++ IN+E  GP+AF  +                           F+PAVS N+ VQ T+  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHSLCLSCARNILVQTPD---SESPQSRRASGVSDYDYL------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNSCLTCPQCHRSLILDERGLRGFAKNRVLEGVIERYQQSKAAALR-CQLC-EKSPKEATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLNL---DSAPLLQSIHQLDFVQMKVPSL------------VPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEGPFSRMSATLAGRLQIDAMPSPLEFLQSPDQESCASPVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGL------------------------FFPAVSLNRNVQVTIHTGLPVP 740          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: stk35 (serine/threonine kinase 35 [Source:Xenbase;Acc:XB-GENE-5853374])

HSP 1 Score: 416.387 bits (1069), Expect = 2.659e-131
Identity = 252/788 (31.98%), Postives = 387/788 (49.11%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHS-----------------------FIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLET-------------GKLTV------------------------FTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC HS+C  CA NI+  V   +    Q  +    S +  +       D D +S  SE DSG        S   +    S                        + +   P    L CP C R ++LD  G+    +N+ L+ V++ ++   A+    CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   D N+   D   L Q I  +   + +V                P  P+   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+V+ G E +CTV+GLHF S+YN RVKA N+ G S YS  + L+T              +L V                        F     S   D+  SN+  T++  S DD V+LG +G S+GVHYWE  ID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R++GGI  G+TVGV LD  +  L++ IN+E  GP+AF  +                           F+PAVS N+ VQ T+  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHSLCLSCARNIL--VQTPDSESPQSRRASGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPMQPHHQSSGALLLPIGPRNSCLTCPQCHRSLILDERGLRGFAKNRVLEGVIERYQQSKAAALR-CQLC-EKSPKEATVMCEQCDVFYCEPCRLRCHPPRGPLAKHRLLPPAQG-RVSRRLSPRKISTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKVQLLSRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLNL---DSAPLLQSIHQLDFVQMKVPSL------------VPAPPLLQLEECCNHNNSATLSWKQPPMSMVQTEGYILELDDGNGGQFREVFVGKETMCTVDGLHFNSTYNARVKAFNKAGVSLYSKTLVLQTSEGPFRRMSATLAARLQVNSIPSPLEFLQHAEQESCGSPVPWFAFDPGSAHPDIIFSNDNLTVTCNSYDDRVVLGKSGFSKGVHYWELTIDRYDNHPDPAFGVARVEVMKDVMLGKDDKAWAMYVDNNRSWFMHSNSHTNRSEGGITKGATVGVLLDFTRRTLTFSINEEQQGPVAFENMEGL------------------------FFPAVSLNRNVQVTIHTGLPVP 740          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:100490969])

HSP 1 Score: 412.535 bits (1059), Expect = 3.580e-130
Identity = 250/764 (32.72%), Postives = 387/764 (50.65%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDS-DHLSEASETDSGVVVNT---------RIVSTA-----VSGVDHSFIYVNNRPCAYS-LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RG--------------KVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL----HAAESG-------TKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFT 2268
            ME ELKCP+C  +F++ L+LPC H++C  CA  I+       QT   ++          + A     D  D +S  SETDSG    T         R++  A      S    S   ++   C+ S + CP C R   LD  G+    +N+ L+ +V  +   RG                 S  + CQ+C +     A  MCEQC++ YC  C  +CHP RGP  +H L    H  + G       T ++ +   +K   C  H  E  +++C NCR  +C  C+Q+  H +HE+  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +   + E  +++  D L+  LN +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E+D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E LQQ I  +                D++    P  P+   E+C   NN  T+ W+  P+    V  Y LE+DDG GGPFR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   N+   D+ +SN   T +  S DD V+LG+   S+G+HYWE ++D+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GG+  G+TVG+ LD  K  L ++IN +  GPIAF  +                           F PAVS N+ VQ +
Sbjct:    1 MEEELKCPVCGSFFREPLILPCSHNVCLPCARTIVV------QTPESEHLPHGARPMLLMGADYDYPDHLDKMSLHSETDSGYGSYTPSLKSPNGVRVLPPAPAPSLASSSGASSRALHGSLCSSSSITCPQCHRSASLDERGLRGFQRNRLLETIVHRYQQERGLAPGAEGSAAAEAACGGSANARCQLC-DSNPAEAAVMCEQCDVLYCSSCQKKCHPTRGPFAKHRLVPATHITQPGPSAHRPATALVPSNASRKFPTCADHELENYSMYCLNCRTPVCYQCLQEGKHGKHEMKALGIMWKQHKAQLSQALSGVSDKAKEAKEFLVQLKNILQQIQENGLEYEACLVAQCDALVDALNRQKAKLLTKVTKEREHKFKVVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQGSQEQWVKGALEPKVSPEFDLTL---DNEPLQQAIHQL----------------DFIQMKLPPVPLLQLEKCCTRNNSVTLAWRMPPFTHNPVDGYILELDDGDGGPFREVYLGKETLCTIDGLHFNSTYNARVKAFNSTGLGPYSKTVVLQTSDVAFFTFDSNAAHRDIVLSNENMTATCSSYDDRVVLGTAAFSKGIHYWEIQVDRYDNHPDPAFGVARINVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRAEGGVCKGTTVGILLDLVKRILIFHINGKQQGPIAFENIEGV------------------------FMPAVSLNRNVQVS 714          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim9 (tripartite motif-containing 9 [Source:MGI Symbol;Acc:MGI:2137354])

HSP 1 Score: 457.218 bits (1175), Expect = 1.364e-147
Identity = 261/747 (34.94%), Postives = 400/747 (53.55%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSG-------VVVNTRIVSTAVSGV-----------DHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E   + S Q++  +GS  S         D D +S  SE DSG           T     + +GV            H    +   P    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG+GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T ++  F     S   D+  SN+  T++  S DD V+LG TG S+GVHYWE  ID+ D    PAFGVAR D  +D MLG DDK W+MY++  RSWF+H + H  RT+GGI  G+T+GV LD ++  L++++N+E  GPIAF  +                           F+PAVS N+ VQ TL  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPE---SESPQSRRASGSGVSDY----DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGL------------------------FFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim9 (tripartite motif-containing 9 [Source:MGI Symbol;Acc:MGI:2137354])

HSP 1 Score: 408.683 bits (1049), Expect = 5.685e-129
Identity = 252/769 (32.77%), Postives = 388/769 (50.46%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSG-------VVVNTRIVSTAVSGV-----------DHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGK----------------------LTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E   + S Q++  +GS  S         D D +S  SE DSG           T     + +GV            H    +   P    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG+GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T +                      +  F     S   D+  SN+  T++  S DD V+LG TG S+GVHYWE  ID+ D    PAFGVAR D  +D MLG DDK W++                  T+GGI  G+T+GV LD ++  L++++N+E  GPIAF  +                           F+PAVS N+ VQ TL  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPE---SESPQSRRASGSGVSDY----DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGCNFETQSASYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAI------------------TEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGL------------------------FFPAVSLNRNVQVTLHTGLPVP 704          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 405.216 bits (1040), Expect = 4.920e-127
Identity = 250/803 (31.13%), Postives = 383/803 (47.70%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR--------GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL------------HAAESGTKILEN------------KRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L        G+   A  A   +QD                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ ++           A   + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L              A +GT    +               +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +    K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +                D+V    P  P+   E+C   NN  T+ W+  P+       Y LE+DDG GG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGA---AAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQL----------------DFVQMKLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 405.216 bits (1040), Expect = 4.920e-127
Identity = 250/803 (31.13%), Postives = 383/803 (47.70%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR--------GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL------------HAAESGTKILEN------------KRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L        G+   A  A   +QD                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ ++           A   + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L              A +GT    +               +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +    K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +                D+V    P  P+   E+C   NN  T+ W+  P+       Y LE+DDG GG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGA---AAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQL----------------DFVQMKLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Match: Trim67 (tripartite motif-containing 67 [Source:MGI Symbol;Acc:MGI:3045323])

HSP 1 Score: 405.216 bits (1040), Expect = 4.920e-127
Identity = 250/803 (31.13%), Postives = 383/803 (47.70%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR--------GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL------------HAAESGTKILEN------------KRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L        G+   A  A   +QD                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ ++           A   + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L              A +GT    +               +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +    K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +                D+V    P  P+   E+C   NN  T+ W+  P+       Y LE+DDG GG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGA---AAAATPPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGIVQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPFAKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSMYCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQL----------------DFVQMKLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 757          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q9C026|TRIM9_HUMAN (E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 5.980e-147
Identity = 258/747 (34.54%), Postives = 394/747 (52.74%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYS------------------LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E     S +      S +  +       D D +S  SE DSG        S   +    S   V   P A                    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T ++  F     S   D+ +SN+  T++  S DD V+LG TG S+G+HYWE  +D+ D    PAFGVAR D  +D MLG DDK W+MY++  RSWF+H + H  RT+GGI  G+T+GV LD ++  L+++INDE  GPIAF  +                           F+PAVS N+ VQ TL  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYL-------DLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGL------------------------FFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q91ZY8|TRIM9_RAT (E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 9.541e-147
Identity = 261/747 (34.94%), Postives = 400/747 (53.55%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSG-------VVVNTRIVSTAVSGV-----------DHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H++C  CA NI+    E   + S Q++  +GS  S         D D +S  SE DSG           T     + +GV            H    +   P    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E+C   NN  T+ W+  P   V    Y LE+DDG+GG FR+VY G E +CTV+GLHF S+YN RVKA N+ G SPYS  + L+T ++  F     S   D+  SN+  T++  S DD V+LG TG S+GVHYWE  ID+ D    PAFGVAR D  +D MLG DDK W+MY++  RSWF+H + H  RT+GGI  G+T+GV LD ++  L++++N+E  GPIAF  +                           F+PAVS N+ VQ TL  G  VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPE---SESPQSRRASGSGVSDY----DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRTMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVAADGYILELDDGSGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTIDRYDNHPDPAFGVARIDVMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKTLTFFVNNEQQGPIAFENVEGL------------------------FFPAVSLNRNVQVTLHTGLPVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q29RQ5|TRIM9_BOVIN (E3 ubiquitin-protein ligase TRIM9 OS=Bos taurus OX=9913 GN=TRIM9 PE=2 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 8.057e-146
Identity = 261/747 (34.94%), Postives = 396/747 (53.01%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYS------------------LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H+IC  CA NI+    E   + S Q++  +GS  S         D D +S  SE DSG        S   +    S   V   P A                    + CP C R ++LD  G+    +N+ L+ V+  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G ++      +K S C  H  E  +++C  C+M +C  C+++  H  HE+  +  + K  K++LS  L  LS++AK   +F+  L+++ ++I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ + +   LQ +         Q+D      V    S+  P  PI   E C   NN  T+ W+  P   V    Y LE+DDG GG FR+VY G E +CTV+GLHF S+YN R+KA N+ G S YS  + L+T ++  F     S   D+  SN+  T++  S DD V+LG TG S+GVHYWE  +D+ D    PAFGVAR D  +D MLG DDK W+MY++  RSWF+H + H  RT+GGI  G+T+GV LD ++  L+++INDE  GPIAF  +                           F+PAVS N+ VQ TL  G +VP
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNICQACARNILVQTPE---SESPQSRRASGSGVSDY----DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALASVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALK--CQLC-EKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMT--TDFDLSLDNSPLLQSI--------HQLD-----FVQMKASSPVPATPILQLEDCCTHNNSATLSWKQPPLSTVPAEGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTVDRYDNHPDPAFGVARIDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDFNRKTLTFFINDEQQGPIAFENVEGL------------------------FFPAVSLNRNVQVTLHTGLQVP 700          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|M9MRI4|TRIM9_DROME (E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 7.989e-131
Identity = 252/673 (37.44%), Postives = 353/673 (52.45%), Query Frame = 1
Query:  310 TSEQD-SDHLSEASETDSGVVV---NTRIVSTAVSGVDHSFIYVNNRP-CAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEI---EPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFT---MYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            TS+QD SD +S  SE DSGVV     +R VS A +G+      V   P  AY L CP C++L+  D  G+  +   +A++ +V  F    A E   CQ+C    ++ A  +CEQCEI YC  C +  HP RGPL +H L       +       Q++S C  H  E L+ +C +C+   C  CI +  H  H++ +I+  CK QKTELSH LQ LSEKA+S  +FI  LK +S+K+ + C + E  + +  + LI  +++++  L+  I+ +K  K    K+     T  L +  G IQFCIE L+E+D+ +FL + + L+ +V   +  + QE+    P++S   D  +   D   L + I  +   + +     A    D     AP  P   P  C   NN  TV WQP     V  Y LE+DDG+GG FR+VY G E +CTV+GLHF S YN RVKA N  GE  YS+ I L+T ++  FT   +        +  S N  T+S E  +  V LGS G SRGVHYWEF ID       PAFGVAR D  R++MLG D+K ++MYI+ +RSWF H   H  R +GGI  GST+GV LD ++  LS+ +N+ P G +AF  L                           FYPAVS N+ V  T+    + P
Sbjct:  107 TSDQDQSDKVSIFSEADSGVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRF---CAREALRCQMCETDPKV-ASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQ-------QRESVCGEH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQEVTNAAPRVSPIVDLTL---DDAALARAIDNLNFIQMR-----AVKDGDERCPAAPMTPTILPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSMYNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRSWFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGV------------------------FYPAVSINRGVTLTMHTAMDAP 735          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Match: sp|Q6ZTA4|TRI67_HUMAN (Tripartite motif-containing protein 67 OS=Homo sapiens OX=9606 GN=TRIM67 PE=2 SV=3)

HSP 1 Score: 410.609 bits (1054), Expect = 4.775e-128
Identity = 255/813 (31.37%), Postives = 390/813 (47.97%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQN--QDGNGSHFSAILAPTSEQD----------------------------SDHLSEASETDSG---------------VVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RGKV-----ASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL-----------HAAESGTKILENK---------------------RRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F++ ++LPC H++C  CA  I     +  Q L Q      G+G    A  A + E D                            +D LS  SETDSG               V+        + +         +    + S+ CP C R   LD  G+    +N+ L+ +VQ +   RG V     A+  + CQ+C      PA  +CEQC++ YC  C  +CHP RGP  +H L            AA   T   +                         +K   C  H  E  +++C +CR  +C  C+++  H +HE+  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +     E  +++  D L+  L  +K +L++ +  E+  K     + I+  T  L ++ G +++C+E+++E+D + FL IS++L+ +V   ++ +++  +EPK+S   D  +   D E L Q I  +   + +                 P  P+   E+C   NN  T+ W+  P+    V  Y LE+DDGAGG FR+VY G E +CT++GLHF S+YN RVKA N  G  PYS  + L+T  +  FT   NS   D+ +SN+  T +  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR+   +D MLG DDK W+MY++  RSWF+H + H  RT+GG+  G+TVGV LD +K  L+++IN +  GP AF+ +                           F PA+S N+ VQ TL  G EVP
Sbjct:    1 MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAGAAAAASLEHDAAAGPACGGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAVPGTSAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFAKHRLVQPPPPPPPPAEAASGPTGTAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEFDLTL---DSEPLLQAIHQLDFIQMKCR--------------VPPVPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGV------------------------FMPALSLNRNVQVTLHTGLEVP 772          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A5K3EXH8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 336/852 (39.44%), Postives = 461/852 (54.11%), Query Frame = 1
Query:  109 NVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNE------INQTLSQQNQDGNG-----SHFSAIL---------------APTSEQDSDHLSEASETDSGVVVNTR----------IVSTAVSGVDHSFIYVNNRPCA-----YSLQCPTCKRLI-LLDSSGIDCIIQNKALDRVVQNFRGKVASEKSY------------CQVCSEREEI---------------------PAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCI------------QDFHLQH---EIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIE-----------------------PKMSHSGDFN---------IQISDLETLQQLIATMRLTEAQVDHY-HAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTM-YHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
             +A M+ EL+CP C+ +F   +LLPCGHS+C+ CA + +   ++      I   LS      N      + F AI+               A     DSD  S  SE DSGVVV +R          I+  +V G        +  P A     + L CPTC R++ LLD  GI+ + +N+AL+RV+    G+ A   +             CQ+C E + +                     PA   CEQC I+YC +C +RCHP RGPL++H LH A  G +I+  KR+ +   C  H +EE +LFCN C++ IC  C+             + H QH   E+  +   CK +KTELS +LQ+LSE+A++G Q I  L+++SE + K   + E +  +  D LI  +  KK ELI+ I++E+ +K +  KE I Q T+ L R+ G IQFCIEML+E+DA SFLL+S SL+ +    EQ+F+  IE                       P  SH              + +  L+ + ++++ + L E   D     +  +     D P AP+F  E+CL   NI T+ WQP PG  + YYTLEIDDGAGG FRKVYRG E +CT+EGLHF+S Y  RVKAHNQ G S YSD + ++T   + F M   +S+   +  SN+  +++ +S +D V+L STGLSRGVHYWEF ID++D G QPAFGVA+SDC ++ MLG D + W+MYI+ KRSWFLHK EHFERTDGGI +GS +GVRLDCD+G LSYY++DEPHGPIAFT L    Y                       YPA+S N+ VQ TL  G E P
Sbjct:   34 GLAKMDPELRCPTCSRYFLSPVLLPCGHSLCTSCAVSALHPTSDATVSVAIQAILSATEASANSHKRPSTAFEAIVHNEPNLEGSSSTVSGASHGGTDSDQQSIVSEADSGVVVTSRAGIYAGRPPTIICPSVLGFSQVTQPTSVPPQAIQSLTHGLFCPTCHRIVALLDEKGINQLPRNRALERVIAKLVGEEAVTGALQQDNPSRTCIPICQLCDEPDPLNMDPLSIGGARISETGPQGGTPASVWCEQCGIFYCEECRERCHPKRGPLLKHGLHPAAKGAEIVRQKRQSQPPVCPEHPHEEASLFCNACKVAICNDCVISDVNQTTCTLTPNRHGQHARQEVQILQAYCKNKKTELSQVLQALSERARAGTQHIQRLRAISETVMKSAKRAEDDATAKFDCLIQTIEAKKAELIAAIKEERDRKQSALKEQIFQCTSKLTRSTGLIQFCIEMLKENDAPSFLLVSQSLINRALHTEQSFLHAIEAPPAVTQYCPLTQQPTTSSQSHPPTPSHWSKGRSAPLAYSSFVSLMQLDAIHKVVSDLTLHEGLEDQLIDCSSSSASSDCDVPSAPVFRAEECLSEGNIITLVWQPCPGFGIDYYTLEIDDGAGGAFRKVYRGIETMCTIEGLHFRSVYRARVKAHNQSGYSAYSDRLVMQTSMYSWFHMDSSHSSVGGLQFSNSNRSVTCQSMEDCVVLASTGLSRGVHYWEFVIDRLDQGGQPAFGVAKSDCNKEAMLGHDTRAWAMYIDRKRSWFLHKGEHFERTDGGIHVGSVIGVRLDCDRGSLSYYLDDEPHGPIAFTGLPAGVY-----------------------YPAISLNRSVQVTLRSGLEPP 862          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A0V0J7K4 (E3 ubiquitin-protein ligase TRIM9 (Fragment) OS=Schistocephalus solidus OX=70667 GN=TRIM9 PE=4 SV=1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 331/873 (37.92%), Postives = 465/873 (53.26%), Query Frame = 1
Query:  109 NVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQ-----NQDGNGSH---------------------------FSAILAP-------------TSEQDSDHLSEASETDSGVVVNTRIVSTA--------VSGVDHSFI--------YVNNRPCAYSLQCPTCKRLI-LLDSSGIDCIIQNKALDRVVQNFRGKVAS-----------------------EKSYCQVCSEREEI--------------------------PAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD---------------FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIE---------------------PKMSHSGDFN-IQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVS-NDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVG 2280
            N+A M+ EL+CP C+ +F   +LLPCGHS+C+ CA   +  ++++N T + Q     N+     H                            S  + P             +   DSD  S  SETDSGVV+++R  + A         S +  S +        YV N    + L CP C R++ LLD  G+  + +N AL+RV+    G+ AS                       E   CQ+C E + +                          PA   CEQC I+YC +C DRCHP +GPL++H LH A  G +I+  KR+ K   C  H +E  + FC  CR+ +C  CI +                H++ E+ ++ T CK +KTELS  LQ+LSEKA++G Q I  L+S+SEK+ K   + E + +   D LI  +  KK EL+S IQ+E++ K +  K+ IHQ T+ L R+ G IQFCIEML+ESD+ +F+L++ SL+ +    EQAF+ EIE                     PK     + + + + + E + + IA + L E   DH      +   S ++ P AP F  E+CL   NI T+ WQ  PG  + +YTLE+DDGA GPFRKVYRG E +CTVEGLHF S Y  RV+AHN+ G SPYSD + ++T     F +    ++  +  SN+  +++ +S++D V+L STGLSRGVHYWEF ID++D G QPAFG+A+SDC ++ MLG D + W+MYI+ KRSWFLHK EHFERTDGGI++GS +G+RLDCD+G LSYY++DEPHGPIAF++L    Y                       YPAVS N+ VQ TL  G
Sbjct:   67 NLAKMDPELRCPSCSRYFLSPILLPCGHSLCTSCAMTTLVTLSDVNVTAAIQATISANETALAQHKGGQTLTTRPTTTYEVVVHREEPPDNLISTSIGPEGGSSSTMSGTNSSHGTDSDQQSVLSETDSGVVMSSRPATYAGRLPTIICPSAIGFSQVTPPALIPAYVMNS-ITHGLPCPLCHRIVALLDEKGVTQLPRNTALERVLVKLVGEEASKVTVSSGSGGGGGEAVSDTAVRLEVPICQLCDEPDPLNLDPLSIGGARSVRLGDLAANAAQGTPAIIWCEQCGIFYCEECRDRCHPQKGPLLKHTLHTALRGAEIVRQKRQNKLPACPAHPHEAASQFCLACRVAVCNECIINDPGQLMCVRSPNKYGQHVKQELQSLQTFCKTKKTELSQALQALSEKARAGTQHIQRLRSISEKVMKSSQRAEVDAVEKFDILIQCIETKKAELVSAIQEERNMKQSALKDQIHQCTSKLTRSTGLIQFCIEMLKESDSLAFILVAQSLINRALNAEQAFMHEIEQPPVVLEYMCSPPSTAGSTLWPKGRPVANSSFLSLMETEAVHKAIADLSLHEGIEDHMADCCGSSTSSESEVPPAPSFRAEECLAEGNIMTLVWQACPGFGIDHYTLELDDGAAGPFRKVYRGLETMCTVEGLHFHSIYRARVRAHNRSGYSPYSDRLVIQTSIFAWFHLDRFRSAPGIQFSNSNRSVTCQSSEDCVVLASTGLSRGVHYWEFVIDRLDSGGQPAFGIAKSDCNKEAMLGHDSRSWAMYIDRKRSWFLHKGEHFERTDGGIQVGSVLGLRLDCDRGCLSYYLDDEPHGPIAFSQLPQGVY-----------------------YPAVSLNRAVQVTLQTG 915          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A4S2L9W5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009213 PE=4 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 322/854 (37.70%), Postives = 457/854 (53.51%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNE------INQTLSQQNQDG-----------------------------NGSHFSAILAPT------SEQDSDHLSEASETDSGVVVNTR----IVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLI-LLDSSGIDCIIQNKALDRVVQNFRGK-----------VASEKSY----------------CQVCSEREE--------IPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQ-------DFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEP-------------------------------KMSHSG----DFNIQISDL-----ETLQQLIATMRLTEAQVDHYHAAVVTDYVSN--DAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            M++EL+CP C  +F   LLLPCGHS+C+ CA   +    E      I   L+    D                              N S  S I   T      +  DSD +S  SETDSGVVV +R    I  T+V     +    +     + L CP C R+I LLD  GI  + +N+AL+RVV  F              V + +++                CQ+C E E+        + + W CEQCEI+YC  C ++CHP RGPL+RHALH+A  G +I+  KR+ +   CL H++  +  +C NC++ +C  C++       + H +HE+  +++ CK +KTELS  LQ+LSEKA++G +FI  L+S +E +N+K  + E  +I+ ++ L+ +L +KK EL + +++ +  K    K  I Q T  L R+ G IQFCIEML+ESD ++F+++S SL+ +    E  F QE++                                K+SH      D N+  + L     E ++Q I  + L E Q    +A  + +  +   + P  P+F  E+C+   N+ T+ WQP     +  YTLE+DDGA G FRKVYRG E +CTVEGLHF+S Y  RVKAHNQ GES YS+ ICL+T   T F +     + ++ ++N   T++++  +D VI+GSTGLSRGVHYWEF +D+ D G QPAFG+AR DC ++ MLG+D + WS+Y + KRSWFLH  EHFERTDGG++ GS VGVR DC++G LSYY+NDEPHGPIAFT L    Y                       YPAVS  + +Q TL  G E P
Sbjct:   48 MDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQAALTLPTTDQYNTAAGASFSSASSTTGSSSGCSSQPFGQNQSQASHIPTSTIHHVSSAHSDSDQVSVLSETDSGVVVTSRPGSYIARTSVLASHSNGPSSSLNTITHGLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEMLQQNLIETTVVNTETFPLLSATDPLNRPGGPLCQLCEEPEKGASEQTGNVASVW-CEQCEIFYCTSCREKCHPSRGPLVRHALHSAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLESDGNLSNETHGKHEVQPLNSACKSKKTELSQALQALSEKARTGTEFIQQLRSRTEGVNQKMLESERLVIAQLNLLLEVLEKKKLELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRARDAEYHFTQELDQAVPTSDQEDLDVYQYPASPDHEMHLSKGVVRKVSHKNMRKYDRNVSETSLHGNAVEAIRQAILELHLQEDQTVKTYACELEETTNRKREVPAPPMFLVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSTVAAPEILLTNGNRTVTSQVAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRAGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVY-----------------------YPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A4S2LFT7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009213 PE=4 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 322/854 (37.70%), Postives = 457/854 (53.51%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNE------INQTLSQQNQDG-----------------------------NGSHFSAILAPT------SEQDSDHLSEASETDSGVVVNTR----IVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLI-LLDSSGIDCIIQNKALDRVVQNFRGK-----------VASEKSY----------------CQVCSEREE--------IPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQ-------DFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEP-------------------------------KMSHSG----DFNIQISDL-----ETLQQLIATMRLTEAQVDHYHAAVVTDYVSN--DAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            M++EL+CP C  +F   LLLPCGHS+C+ CA   +    E      I   L+    D                              N S  S I   T      +  DSD +S  SETDSGVVV +R    I  T+V     +    +     + L CP C R+I LLD  GI  + +N+AL+RVV  F              V + +++                CQ+C E E+        + + W CEQCEI+YC  C ++CHP RGPL+RHALH+A  G +I+  KR+ +   CL H++  +  +C NC++ +C  C++       + H +HE+  +++ CK +KTELS  LQ+LSEKA++G +FI  L+S +E +N+K  + E  +I+ ++ L+ +L +KK EL + +++ +  K    K  I Q T  L R+ G IQFCIEML+ESD ++F+++S SL+ +    E  F QE++                                K+SH      D N+  + L     E ++Q I  + L E Q    +A  + +  +   + P  P+F  E+C+   N+ T+ WQP     +  YTLE+DDGA G FRKVYRG E +CTVEGLHF+S Y  RVKAHNQ GES YS+ ICL+T   T F +     + ++ ++N   T++++  +D VI+GSTGLSRGVHYWEF +D+ D G QPAFG+AR DC ++ MLG+D + WS+Y + KRSWFLH  EHFERTDGG++ GS VGVR DC++G LSYY+NDEPHGPIAFT L    Y                       YPAVS  + +Q TL  G E P
Sbjct:   48 MDSELRCPACRRYFYCPLLLPCGHSLCTSCAAAGLLPATEPHVAAAIQAALTLPTTDQYNTAAGASFSSASSTTGSSSGCSSQPFGQNQSQASHIPTSTIHHVSSAHSDSDQVSVLSETDSGVVVTSRPGSYIARTSVLASHSNGPSSSLNTITHGLICPACNRIIALLDDKGIGHLPRNRALERVVFKFASPEMLQQNLIETTVVNTETFPLLSATDPLNRPGGPLCQLCEEPEKGASEQTGNVASVW-CEQCEIFYCTSCREKCHPSRGPLVRHALHSAAKGVEIVRRKRQNQPPPCLVHSHSPVTFYCLNCQVAVCTECLESDGNLSNETHGKHEVQPLNSACKSKKTELSQALQALSEKARTGTEFIQQLRSRTEGVNQKMLESERLVIAQLNLLLEVLEKKKLELTNRLREARESKVCSMKGQISQITGLLTRSTGLIQFCIEMLKESDPSAFMVVSQSLIMRARDAEYHFTQELDQAVPTSDQEDLDVYQYPASPDHEMHLSKGVVRKVSHKNMRKYDRNVSETSLHGNAVEAIRQAILELHLQEDQTVKTYACELEETTNRKREVPAPPMFLVEECISERNVITLVWQPSSTTSIDRYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNQVGESAYSERICLQTSDFTWFHLDSTVAAPEILLTNGNRTVTSQVAEDRVIIGSTGLSRGVHYWEFTVDRCDAGGQPAFGIARQDCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRAGSVVGVRFDCNRGTLSYYLNDEPHGPIAFTNLPPGVY-----------------------YPAVSLTRAIQLTLHCGLEAP 877          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Match: A0A4E0S1L8 (E3 ubiquitin protein ligase TRIM9 OS=Fasciola hepatica OX=6192 GN=D915_002585 PE=4 SV=1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 335/895 (37.43%), Postives = 462/895 (51.62%), Query Frame = 1
Query:  112 VANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQN---QDGNGSHFSAIL--AP------------------------------------------TSEQDSDHLSEASETDSGVVVNTR---------------IVSTAVSGVDHSFIYVNNRPCA--------YSLQCPTCKRLI-LLDSSGIDCIIQNKALDRVVQNFRGKVASEKS-----------------------YCQVCSEREE------------------IPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCI-------QDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEP----------------------------------KMSHSG-----------DFNIQISDLETLQQLIATMRLTEAQ----VDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            V  M+AEL+CP C+ +F   +LLPCGHS+C+ CA   +    E +   S  N      +G  + AI+  AP                                          +S  DSD LS  SETDSGVVV++R                ++ A +    S   VN  P +        + L CP+C R + LLD  G+  + +N+AL+RV+  F      ++                         CQ+C E E+                  +   W CEQCEI+YC  C +RCHP RGPL+RH LH A  G +I + KR+ + + C  H +   NLFC  C+  +C  C+        D H +HE+  + TICK +K EL+  LQSLSE+A++G + I  L++ SE  N K  + E ++   +D LI  L +KK +L   ++  + +K    +E I Q T  L ++ G IQFCIEML+E D T+FL++S SL+T+ +  E  FIQE+E                                   K S SG           +F ++ + +ET+++ I  +RL+E Q    VD  + +   D   N+ P AP F  E C+   N+ T+ WQP     V  YTLE+DDGA G FRKVYRG E +CTVEGLHF+S Y  RVKAHN  GES YS+ +CL+T  LT F M  ++   D+ ++N   T++++  +D VILGSTGLSRGVHYWEF +D+ DPG QPAFG+AR+DC ++ MLG+D + WS+Y + KRSWFLH  EHFERTDGG+++GS VGVRLD ++G LSYY+NDEPHGPIAFT L    Y                       YPAVS ++ VQ TL  G E P
Sbjct:   47 VHKMDAELRCPACHRYFHCPVLLPCGHSLCTACAAGALLPSTEPSIAASIHNIMNLVSSGDSYRAIIPGAPHSSSSSASSTAGSSIAGSSLAGTVNMNVSLGTASVSQQPTGSSSHSDSDQLSVVSETDSGVVVSSRPGSYIGRLPAIFCQSTITAASAVAAVSSPGVNQNPSSAINLNLITHGLICPSCNRTVGLLDEHGLSQLPRNRALERVIGKFVSPDQLQEKPIIELGTFPLLPPSDPTSRPGGPLCQLCEEPEDPADPSTDPGSNISHSSANLATTW-CEQCEIFYCTPCRERCHPSRGPLVRHCLHTAAKGVEITKRKRQNQPAPCPLHPHMLTNLFCVQCQTQVCHECLVSEGNTTHDNHGKHEVQPLTTICKARKAELTQALQSLSERARAGTECIQRLRNKSEAYNHKMFESERQVTEQLDALIRTLEKKKADLTERLRTARDEKVQFMREQITQVTQMLTKSTGLIQFCIEMLKEGDPTAFLVVSQSLVTRTHETENLFIQELEQASAMSDHAEAMLHYSVCSTPTTITSEQQRRNSPRKTSKSGKSDLKGSQRLNEFTLEQNSIETIRRAINDLRLSEEQGKKSVDEDNKSAA-DLQPNEVPAAPRFIVEACISERNVITLVWQPTSSILVTKYTLELDDGANGNFRKVYRGPETICTVEGLHFRSVYRARVKAHNPAGESLYSERLCLQTSDLTWFHMDPSTACPDILLTNGNRTITSQINEDRVILGSTGLSRGVHYWEFTVDRCDPGGQPAFGIARADCNKEIMLGLDMRSWSVYFDHKRSWFLHNGEHFERTDGGVRLGSVVGVRLDFNRGSLSYYLNDEPHGPIAFTNLPAGIY-----------------------YPAVSLSRAVQLTLHSGLEAP 916          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:103027505])

HSP 1 Score: 442.58 bits (1137), Expect = 7.807e-142
Identity = 271/763 (35.52%), Postives = 395/763 (51.77%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQ-DSDHLSEASETDSGVVVNTRIVSTAVSGVD--HSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL-----------------HAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTE-------AQVDHYHAAVVTDYVSND----APKAPIFWPEQCLCTNNIFTVFW-----QPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F   ++LPC H++C+ CA +I   V   +          +G   ++  AP  +  D D +S  SETDSG    T    +  +GV      + +  R C  S+ CP C R + LD  G+    +N+ L+ VV   R G+  + K  CQ+C +R    A   CEQC++ YC  C  RCHP RGPL +H L                  AA     +      +  S C+ H  E  + +C +CR  +C  C++D  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK+L ++I +   + E  +++  D LI  L  +K +L++ +  EK  K    ++ I   T  L +  G +++C+E+++E+D + FLLIS++L+ +V   +  +++  +EPK+    +F + I + + L Q I  +  T+       A +   HA V T+  S       P AP+   E+C   NN  T+ W     Q  P   V  Y LE+DDG GG +R+VY G E VCTV+GLHF SSYN RVKA+N  G   YS  + L+T  +  FT    S   D+ +SN   T+S  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVGV LD  K  L+++IN E HGP+AF  L                           F PAVS N+ VQ TLI G EVP
Sbjct:    1 MEEELKCPVCGSLFTDPIILPCSHNVCAGCARSIA--VQTPDGETPPHAAATHGRLAASAGAPDYDYLDVDKMSTHSETDSGYGSYTPCAKSP-NGVRVFPPPVLLAARHC--SVTCPLCHRSVSLDERGLRAFPRNRLLEAVVARHRQGRARAVK--CQLC-DRNPPDATVTCEQCDVSYCNACQQRCHPARGPLAKHRLVPPAALAQQQQPAASSAGAANCTVNVAVATTARVPSTCVEHEAENYSAYCASCRTPVCYVCVEDGKHGKHDVKPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNLLQQIQENGVEFEACLVAQCDALIEALTRQKAKLLTKVTKEKESKLKTVRDQITHCTMKLRQTTGMMEYCLEVIKENDPSGFLLISDALIKRVQASQDQWVKGALEPKVC--PEFALSI-NTDPLMQSILQLDFTQGKDGQKPALMKQMHAGVQTEMESTGDTPAVPPAPLLQLEKCCMRNNSATLAWRITAVQALP---VEGYILELDDGNGGQYREVYVGKETVCTVDGLHFNSSYNARVKAYNSIGVGAYSKTVVLKTSDVAWFTFDPTSAHRDIVLSNENQTVSCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGITKGSTVGVLLDLTKHTLTFFINKEQHGPVAFENLEGV------------------------FMPAVSLNRNVQVTLITGLEVP 725          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:103027505])

HSP 1 Score: 436.417 bits (1121), Expect = 1.037e-139
Identity = 265/752 (35.24%), Postives = 389/752 (51.73%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQ-DSDHLSEASETDSGVVVNTRIVSTAVSGVD--HSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHAL-----------------HAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFW-----QPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C   F   ++LPC H++C+ CA +I   V   +          +G   ++  AP  +  D D +S  SETDSG    T    +  +GV      + +  R C  S+ CP C R + LD  G+    +N+ L+ VV   R G+  + K  CQ+C +R    A   CEQC++ YC  C  RCHP RGPL +H L                  AA     +      +  S C+ H  E  + +C +CR  +C  C++D  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK+L ++I +   + E  +++  D LI  L  +K +L++ +  EK  K    ++ I   T  L +  G +++C+E+++E+D + FLLIS++L+ +V   +  +++  +EPK+    +F + I + + L Q I  +  T+ +             +   P AP+   E+C   NN  T+ W     Q  P   V  Y LE+DDG GG +R+VY G E VCTV+GLHF SSYN RVKA+N  G   YS  + L+T  +  FT    S   D+ +SN   T+S  S DD V+LG+   S+GVHYWE  +D+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVGV LD  K  L+++IN E HGP+AF  L                           F PAVS N+ VQ TLI G EVP
Sbjct:    1 MEEELKCPVCGSLFTDPIILPCSHNVCAGCARSIA--VQTPDGETPPHAAATHGRLAASAGAPDYDYLDVDKMSTHSETDSGYGSYTPCAKSP-NGVRVFPPPVLLAARHC--SVTCPLCHRSVSLDERGLRAFPRNRLLEAVVARHRQGRARAVK--CQLC-DRNPPDATVTCEQCDVSYCNACQQRCHPARGPLAKHRLVPPAALAQQQQPAASSAGAANCTVNVAVATTARVPSTCVEHEAENYSAYCASCRTPVCYVCVEDGKHGKHDVKPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNLLQQIQENGVEFEACLVAQCDALIEALTRQKAKLLTKVTKEKESKLKTVRDQITHCTMKLRQTTGMMEYCLEVIKENDPSGFLLISDALIKRVQASQDQWVKGALEPKVC--PEFALSI-NTDPLMQSILQLDFTQGKD------------TPAVPPAPLLQLEKCCMRNNSATLAWRITAVQALP---VEGYILELDDGNGGQYREVYVGKETVCTVDGLHFNSSYNARVKAYNSIGVGAYSKTVVLKTSDVAWFTFDPTSAHRDIVLSNENQTVSCNSYDDRVVLGTAAFSKGVHYWELSVDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMHNNSHTNRAEGGITKGSTVGVLLDLTKHTLTFFINKEQHGPVAFENLEGV------------------------FMPAVSLNRNVQVTLITGLEVP 702          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: trim9 (tripartite motif containing 9 [Source:ZFIN;Acc:ZDB-GENE-030131-8043])

HSP 1 Score: 432.95 bits (1112), Expect = 1.322e-138
Identity = 249/741 (33.60%), Postives = 381/741 (51.42%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRN----------VNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQD-FHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISD---LETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLY--YTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  +F++ ++LPC H+IC   +    R           ++    +L  +   G GS+     APT+           ++ +GV V                         + L  PTC R + LD  G+    +N+ L+ VV+ ++   A+    CQ+C E+    A  +CEQC+++YC  C  RCHPPRGPL +H L     G +I      +K S C  H  E L+++C  C+M +C  C+++  H  HE+  +  + K  K +LS  L  LS++A    +F+  L+++ + I +   + E  +++  D LI  LN +K +L++ +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS++L+ +V+  E  + +  + P+M+   DF++ +     L+T+QQL                    D+V    P API   E+C    N  T+ W+  P   +    Y LE+DDG GG FR+VY G E +CTV+GLHF S+Y  RVKA N  G   YS  + ++T ++  FT    S   D+ +SN+  T++  S DD V++G+T  SRGVHYWE  ID+ D    PAFG+AR D  +D MLG DDK W+MY++  RSWF+H + H  RTDGGI  G+TVGV LD  +G L + INDE  GP+AF  L                           +YPA+S N+ VQ TL  G  +P
Sbjct:    4 MEEELKCPVCGSFFREPIILPCSHNICLAYSPQSARASGSAASDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTP--------CPKSPNGVRVFPPAPPPPQQSQQ-----------QHLLPPPTCHRSLTLDDRGLRGFPKNRVLEAVVERYQQSKAAALR-CQLC-EKTPREATVLCEQCDVFYCDACRVRCHPPRGPLAKHRLVPPAQG-RISRRASPRKTSTCTEHELENLSMYCVQCKMPVCYQCLEEGRHSAHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIEALNRRKAQLLTRVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHMTEGQWGKGTLTPRMT--SDFDLTLDSGPLLQTIQQL--------------------DFVQMKVPAAPILQLEECCSQTNSATLSWKQPPLSTIAVDGYILELDDGNGGQFREVYVGIETICTVDGLHFNSTYKSRVKAFNSSGVGQYSKTLVMQTSEIAWFTFDPASAHPDIILSNDNLTVTCNSYDDRVVMGNTAFSRGVHYWEITIDRYDNHPDPAFGIARGDVLKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIGKGATVGVLLDFSRGILLFLINDEQQGPVAFDSLEGL------------------------YYPAISLNRNVQVTLHTGLPIP 676          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: trim36 (tripartite motif containing 36 [Source:NCBI gene;Acc:103044100])

HSP 1 Score: 136.732 bits (343), Expect = 1.448e-32
Identity = 147/622 (23.63%), Postives = 256/622 (41.16%), Query Frame = 1
Query:  106 INVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIR-NVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGD-FNIQISDLETLQQLIATMRLTE-AQVDHYHAAVVTDYVSNDAPKAPIFW--PEQCLCTNNIFTVFWQPYPGPEVLYYTLE-IDDGAGGPFR---KVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHN-------------SNSDDV-YISNNGFTLSTE--STDDHV----ILGSTGLSRGVHYWEFRID 1878
            + + N+E EL CP+C   F   L+LPC HS+C +C   ++  N ++   T +       GS  S + +P+ E+  D L       SG V +     ++V+            P   +  CP C+  I L   GI  + +N  L+ +V+ +R    A+    C +C    +   K  C  C+  YC +C    HP   P  +H      +         R K   C  H  E++N++C  CR  +C  C +   H  H++ ++ +  K  K +LS  +  L  K       I  L+ L  +  +     E       +EL  IL EKK E++ +I   ++++  + +  + +    L   +G + +  E+L+E+D + F+  +  L  +V    ++ ++  +   S S D F +  S  E L + ++   + +   +D   + V  + +        I W  PE  L T++             VL Y  E  +D    P++   +V+     VC ++       Y  RV++      SPYS  +   T    VF    N                D V  ++   F L+ E   T  ++    I+G TG+S G HYW FR++
Sbjct:    9 VPIKNIERELICPICKELFTHPLILPCQHSVCHKCVKELLMLNHDDSFSTDAGSECSNPGSPRSRVPSPSMER-LDRL-----VRSGSVSSPGWRRSSVT------------PRVTTFPCPGCQHDIDLGERGISMLFRNFTLESIVERYRQAARAAMAIMCNMCKPPVQEATK-SCMDCKASYCNECFKLHHPWGTPKAQHEYVGPTTNF-------RPKVLMCPEHEMEKVNMYCEVCRRPVCHLCKLGGSHANHKVTSMSSAYKILKEKLSKSIHYLISKEDQVRTQITELEVLIRETEENGQLAERRANEHFEELFEILQEKKTEMLRSIAQSRNRRMDKLRSQVEEYQGML-ENSGLVGYAQEVLKETDQSCFVQTAKQLHVRVQKATES-LKTFQAAASPSFDEFALDTSKEECLLKDLSFGGVPDPPMIDLSQSRVYNEGL--------IHWRLPEDSLPTDH------------HVLEYRKEAAEDEEKSPWQTTDRVFGSSAVVCDLDS---NCRYAFRVRSCRNTIYSPYSPAVSFHTPPAPVFGFLFNEKCGFSAERLILSKRRDSVESVAGMAFLLAAERVQTGSYICLDYIIGDTGISHGRHYWAFRVE 579          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Match: trim36 (tripartite motif containing 36 [Source:NCBI gene;Acc:103044100])

HSP 1 Score: 136.346 bits (342), Expect = 1.970e-32
Identity = 147/622 (23.63%), Postives = 256/622 (41.16%), Query Frame = 1
Query:  106 INVANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIR-NVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGD-FNIQISDLETLQQLIATMRLTE-AQVDHYHAAVVTDYVSNDAPKAPIFW--PEQCLCTNNIFTVFWQPYPGPEVLYYTLE-IDDGAGGPFR---KVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHN-------------SNSDDV-YISNNGFTLSTE--STDDHV----ILGSTGLSRGVHYWEFRID 1878
            + + N+E EL CP+C   F   L+LPC HS+C +C   ++  N ++   T +       GS  S + +P+ E+  D L       SG V +     ++V+            P   +  CP C+  I L   GI  + +N  L+ +V+ +R    A+    C +C    +   K  C  C+  YC +C    HP   P  +H      +         R K   C  H  E++N++C  CR  +C  C +   H  H++ ++ +  K  K +LS  +  L  K       I  L+ L  +  +     E       +EL  IL EKK E++ +I   ++++  + +  + +    L   +G + +  E+L+E+D + F+  +  L  +V    ++ ++  +   S S D F +  S  E L + ++   + +   +D   + V  + +        I W  PE  L T++             VL Y  E  +D    P++   +V+     VC ++       Y  RV++      SPYS  +   T    VF    N                D V  ++   F L+ E   T  ++    I+G TG+S G HYW FR++
Sbjct:   22 VPIKNIERELICPICKELFTHPLILPCQHSVCHKCVKELLMLNHDDSFSTDAGSECSNPGSPRSRVPSPSMER-LDRL-----VRSGSVSSPGWRRSSVT------------PRVTTFPCPGCQHDIDLGERGISMLFRNFTLESIVERYRQAARAAMAIMCNMCKPPVQEATK-SCMDCKASYCNECFKLHHPWGTPKAQHEYVGPTTNF-------RPKVLMCPEHEMEKVNMYCEVCRRPVCHLCKLGGSHANHKVTSMSSAYKILKEKLSKSIHYLISKEDQVRTQITELEVLIRETEENGQLAERRANEHFEELFEILQEKKTEMLRSIAQSRNRRMDKLRSQVEEYQGML-ENSGLVGYAQEVLKETDQSCFVQTAKQLHVRVQKATES-LKTFQAAASPSFDEFALDTSKEECLLKDLSFGGVPDPPMIDLSQSRVYNEGL--------IHWRLPEDSLPTDH------------HVLEYRKEAAEDEEKSPWQTTDRVFGSSAVVCDLDS---NCRYAFRVRSCRNTIYSPYSPAVSFHTPPAPVFGFLFNEKCGFSAERLILSKRRDSVESVAGMAFLLAAERVQTGSYICLDYIIGDTGISHGRHYWAFRVE 592          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Sea Lamprey
Match: TRIM63 (tripartite motif containing 63 [Source:HGNC Symbol;Acc:HGNC:16007])

HSP 1 Score: 54.6842 bits (130), Expect = 6.343e-8
Identity = 41/182 (22.53%), Postives = 83/182 (45.60%), Query Frame = 1
Query:  730 TKILENKRRQKKSN---CLCHTNEELNLFCNNCRMIICPSC-IQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKV 1263
            ++ +EN R  KK +   C+ H  E++N+FC  C M  C  C +   H   ++  + ++ K  K +LS  +  L          I  ++   + I++    ++  +    D + + L E+K E++  I  E+  K    ++ I Q    L  A+  ++   + + E +A +FL  +++L   V
Sbjct:  103 SRAVENHRPVKKVDHPMCVEHAEEKINIFCLTCSMPTCSLCKVFGAHKDCQVAPLGSVYKSHKNDLSDSISRLVASNDRVQLMISEMEHSCKVIDENSRVQKQMLCEQFDGVYAALEERKQEMLMVISQEQEDKNQHVRDLIKQYNEHLQSASKLVETAFQAMEEPEAAAFLQSASALQKSV 284          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO41245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S501])

HSP 1 Score: 378.252 bits (970), Expect = 7.138e-119
Identity = 244/725 (33.66%), Postives = 344/725 (47.45%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME EL+CP+CN  +   ++LPC HSIC  C   I        Q  S + +            P ++  SD        DSG V        +V  V+H +  + N PC   L+CP C+++  LD  G++   +NK L+ +V     K ++   YCQ+C   +  PA  MCEQCE+ YC +C   CHP RGPL +H L    S           K   C  H  E  +++C  CR+ +C  CI+   H  HE+  +  + K QK+EL + L  L E       +I+ L+     I +     E  +++  D LI  +  +K ELI+ I  E   K    K+ I +    L    G + +  E L+E+D  SFLL+  ++++   C     I    P    S + ++ +    T Q L              H      +V   AP AP   P+QC  TNN  T+ W P     +  Y +EIDDG GG F +VYRG    CTV+GL F S+Y  RVK  N+ GE   SD + L T  +  F++   +   D+ +SN+  T +  S DD V+LG  G S+G HYWE  ID+ D    PA GVA  D  +D +LG DDK W MYI+  RSWF H +EH  R DGGI++GS +G+ LD     +S+Y+ND+  G I    +S                   G L     YPA S N+ VQ TL  G E P
Sbjct:    1 MEEELQCPVCNKPYNCPVVLPCSHSICMSCTKAITTTSGADYQVSSGEKE------------PVADPFSD--------DSGYV--------SVYEVNHLYQAIGNFPC---LKCPICRKIFPLDGRGVNGFPRNKLLENIVNRHYAK-SNGNVYCQLCEGSQPAPATVMCEQCEVSYCEECCKTCHPSRGPLAKHNLIHPASSKASSVKSSLVK---CKDHLEEHNSMYCVVCRIPVCYVCIERGQHKGHEVKALGAMFKEQKSELGNNLNLLEENRNHLQNYINQLQESCSVIQENGLDFEASVVAQCDGLIQFIENRKMELINAINKEMQTKVENVKQQITEYEHTLKDTVGLLGYSREALKETDPASFLLV-RTIISHEICGTGTGI----PSEPPSVELDLTLDTSATAQAL-----------HELH------FVELKAPDAPDIIPDQCSVTNNTITLCWMPRKQSCIESYLVEIDDGNGGSFVEVYRGNSLECTVQGLQFDSTYRARVKGINKSGEGGPSDEVYLTTSDIAWFSLDLETAHPDIILSNDNNTATCTSFDDRVVLGGAGFSKGCHYWEVTIDRYDGNPDPAMGVAFIDTIKDSILGKDDKAWCMYIDSSRSWFRHNNEHSNRRDGGIEVGSCIGILLDISNLKVSFYLNDQRRGAIRLPSIS-------------------GAL-----YPAFSLNRNVQITLHTGLEPP 644          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO40277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Q5])

HSP 1 Score: 206.453 bits (524), Expect = 2.586e-56
Identity = 178/714 (24.93%), Postives = 305/714 (42.72%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR------GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLC--HTNEELNLFCNNCRMIICPSCIQ-DFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFL--LISNSLLTKVNCIEQAFIQEIEPKMSH-SGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEID--DGAGG-----PFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAF---GVARSDCKRDEMLGIDDKGWSMYINEKRSWF---LHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDE--PHGPIAFTKLSTYNYNSLSTCG 2181
            ME EL CP+C   F++ ++LPC H++C++CA  I+      ++  +    +  G ++ + L P                                                ++CP+C+R I +D  G+D + +N  L+ V++ F+      G+ A +   CQ C +     A   C+QC   YC  C D CHP +GPL  H L   +      +  + +  SN +C  H +E + L+C  CR  +C  C +   H  H +  ++ + +  K  ++  L +L  +  +  + +  L+ +     K     E+ +    D L++I+ +KK EL+ N+  E ++K A+  E I +    L ++ G ++F  E L+E +  +FL  +++  L  K   ++    +   P  +  SG F+  +S   T  Q+     L                     P  P+   E C   N   +  W P     V  Y +E+D  D  G       F KVY+G     T+ GL +  +   RVKA N  GE   S+ I L T K   F +  ++ + ++ +S +  T++ +S     ILG+  LS G HYW   +D+     Q +    G+AR     D +LG D   +++ INE  +            +R+   +   S VGV L+ D   L+ Y N +  P+GP  F  ++   Y +LS  G
Sbjct:    1 MEGELTCPICLELFQRPVVLPCSHNLCTRCARRILEPRGS-SKAWADWVTENKGPNYKSHLEP-----------------------------------------------DVKCPSCRRKIPVDPRGVDALPRNLILENVIERFKEERAVPGRQAQQPVLCQFCEDVAPQTATCTCKQCGFSYCGTCFDACHPMKGPLASHTLGPPDD-----KAPKPKNTSNMMCPDHPHERMALYCYGCRSAVCYLCKEAGSHRAHHVELLEKVFRKTKVRVTRSLGTLMRRNTATQKLVDTLEGMCAVAKKSGNDVESHVKKECDALLAIVEKKKAELLDNVNSEYNEKLAELHETILECDKTLQQSLGLVEFSQEALKEDNPVTFLQQMMNVYLNGK---LQTPDTRPGGPSFAGVSGTFSPALSVYGTSAQMTLIPGLQSPST---------------PPGIPVINLEDCSIDNTKISFAWVPPEQCNVDCYIMEVDILDREGDIHQERTFTKVYQGPRNKFTLRGLEYNVTVVARVKAVNTAGEGEPSEEISLSTEKGLYFQLDPSTANHELEMSPDDCTVALKSPMYTFILGNVKLSSGRHYWRVHVDEFSSPNQLSIIGVGIARGIID-DPILGEDSHSYAVQINEHPTTTCINTKNRIQIKRSSAEM-TNSNVGVLLNLDDHLLNIYFNGKSVPNGP-TFHGITQAFYPALSLYG 640          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO41244 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S500])

HSP 1 Score: 87.8113 bits (216), Expect = 7.805e-21
Identity = 44/91 (48.35%), Postives = 53/91 (58.24%), Query Frame = 1
Query: 1444 APKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLET 1716
            AP AP   P+QC  TNN  T+ W P     +  Y +EIDDG GG F +VYRG    CTV+GL F S+Y  RVK  N+ GE   SD + L T
Sbjct:    2 APDAPDIIPDQCSVTNNTITLCWMPRKQSCIESYLVEIDDGNGGSFVEVYRGNSLECTVQGLQFDSTYRARVKGINKSGEGGPSDEVYLTT 92          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO33118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST50])

HSP 1 Score: 71.2478 bits (173), Expect = 5.944e-13
Identity = 69/287 (24.04%), Postives = 126/287 (43.90%), Query Frame = 1
Query:  454 LQCPTCKRLILLDSSGIDCIIQNKALDRVVQNF---RGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRH---ALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKI------NKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQ 1278
            L CP CK    +  + +  +  N  ++ ++        + + +K+ CQ+C   E  PA+  C +C+ + C  C+   H    PL  H   +L   +SG K+L      K S C  H  ++L LFC +C+ +IC  C    H  H+      +   +K E+       ++K  S +  I    +L EK       NK+ A+++ +    ID+ I  L + + +L   I+    K+  Q        +  L  A   ++F   M RE++    L I N +L++++ + +
Sbjct:   57 LVCPLCKAEFQISPADVLSLKVNFMINSIISVLPLLTSEDSKKKTVCQMCDSGE--PAQGRCNECDHFVCEQCIS-AHKRLRPLQHHTILSLDEIKSG-KLLA---MSKTSYCTKHKGKKLKLFCESCKEVICRDCTVVDHKNHDYRFTSDVIAREKEEILE----RAKKVTSKLTDIEQAMALVEKAQQHLDENKRAARRDLD--QFIDKQIGALEKMRSDLRGEIESACQKQEKQLTAQRENLSMRLASARSSLEFAERMCREANDVDVLSIRNEVLSQLSSLAE 330          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Match: EDO34297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ6])

HSP 1 Score: 68.1662 bits (165), Expect = 6.469e-12
Identity = 50/262 (19.08%), Postives = 120/262 (45.80%), Query Frame = 1
Query:  583 CQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLI 1368
            C+ C+ +++  A+  C  C ++ C  C+ + H     L  H + A ++  +  E +   KK  C  H +EE++ +C +C +++C  C    H  HE   +  I   ++  L   +QS S+   +    + + K +++++ ++      ++ S I++ I++L   + +L   +      K +  +  + +    L   N  ++F  + L  S +   LL+   +LT++  + +   Q ++ +   +    ++I+   ++ Q I
Sbjct:   17 CENCNNKKQAIAR--CAHCSVFLCSFCV-KAHRRMNILKDHEILAFDAVQRA-EPREMAKKMYCKQHKDEEMSFYCEDCCVMLCRDCTVLDHRGHEYVRVSKIMARERKVLQEAIQSTSQLIPTLNLVLRDTKEMADRVAERIEVTNGQVDSFIEQQITMLEIARDQLKEGVNAVGRTKQSLLESQLRRIDLQLRSTNNAVEFAKQALTHSSSAQVLLLKKHILTRLKYLSE---QPVDRRPCQNDGLGLRITPGASIVQFI 271          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: trim9 (tripartite motif containing 9 [Source:NCBI gene;Acc:101167580])

HSP 1 Score: 448.743 bits (1153), Expect = 2.143e-144
Identity = 266/758 (35.09%), Postives = 390/758 (51.45%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSG-------VVVNTRIVSTAVSGV-------------------DHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISD---LETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H+IC  CA NI+    E     S Q+   +GS      A     D D +S  SE DSG       V   T     + +GV                     SF  +    C   + CP C R ++LD  G+    +N+ L+ VV  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G +I      +K S C  H  E L+++C  C+  +C  C+++  H  HE+  +  + K  K +LS  L  LS++A    +F+  L+++ + I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS+ L+ +V+  E  + +  + P+M+   DF++ +     L+T+ QL                    D+V    P API   E+C   NN  T+ W+  P     V  Y LE+DDG GGPFR+VY G E +CTV+GLHF S+Y  RVKA N  G   YS  + ++T ++  FT   +S   D+  SN+  T++  S DD V++G+   SRGVHYWE  ID+ D    PAFG+AR D  +D MLG DDK W+MY++  RSWF+H + H  RTDGGI  GSTVG+ LD  +  L + INDE  GP+AF  L                           FYPAVS N+ VQ TL  G  +P
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNICLACARNILVQTPEAE---SPQSSRASGS------ADYDYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPAVPQPPPQQHLLQPPGSFPPIPRNSC---ITCPQCHRSLILDERGLRGFPKNRVLEGVVDRYQQSKAAALK--CQLC-EKSPREATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEEGKHGPHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIDALNRRKAQLLSQVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDPLIRRVHMTEGQWGKGTLTPRMT--SDFDLTLDSGPLLQTIHQL--------------------DFVQMKVPAAPILQLEECCTQNNSATLSWKQPPLSTIAVEGYILELDDGNGGPFREVYVGTETICTVDGLHFNSTYRSRVKAFNASGVGQYSKTLIMQTSEMAWFTFDPSSAHPDILFSNDNLTVTCNSYDDRVVMGNAAFSRGVHYWEITIDRYDNHPDPAFGIARGDVVKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIAKGSTVGMLLDFSRRILIFLINDEQQGPVAFEGLEG------------------------AFYPAVSLNRNVQVTLHTGLPIP 699          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 444.121 bits (1141), Expect = 2.007e-142
Identity = 269/762 (35.30%), Postives = 397/762 (52.10%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSY-------CQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRR-----------QKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQI-SDLETLQQL----------IATMRLTEAQVDHYHAAVVTDYVSND----APKAPIFWPEQCLCTNNIFTVFWQ---PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            M+ ELKCP+C   FK+ +LLPC H++C  CA NI     +  +T +Q    G+  +           D D +S  SETDSG    T     + +GV      +  R C  SL CP C R + LD  G+    +N+ L+ +V   +   AS  S        CQ+C +R  + A  MCEQC++YYC  C  RCHP RGPL +H L                          +K + C+ H  E  +++C +CR  +C  C+++  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +   + E   ++  D LI  L  +K +L++ +  EK  K    ++ I   T  L +  G +++C+E+L+E+D + +L IS++L+ +V   +  +++  +EPK+S   D  +   S L+T+ QL             ++  +A  D Y A + T+    +     P AP+   E+C   NN  T+ W+   P   P +  Y LE+DDG GG +R+VY G E VCTV+GLHF SSYN RVKA+N  G  PYS  + L+T  +  FT   +S   D+ +SN   T+S  S DD V+LG+   S+GVHYWE RID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVG+ LD  K  L++YIN + HGP AF  L                           F PAVS N+ VQ TL+ G EVP
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPD-GETPAQSRASGSSDY--------DYLDMDKMSLYSETDSGYGSFTPCQLKSPNGVRVFPPVLPQRHC--SLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAPKCQLC-DRNPVDATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGALEPKVSSDFDLVLNTDSLLQTILQLDFCHGKDVQEKPLLKQMQA-ADSYEAEMETESPGVEPGPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMH-NSHTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGV------------------------FVPAVSLNRNVQVTLVTGLEVP 723          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: trim9 (tripartite motif containing 9 [Source:NCBI gene;Acc:101167580])

HSP 1 Score: 441.039 bits (1133), Expect = 2.608e-141
Identity = 267/771 (34.63%), Postives = 390/771 (50.58%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSG-------VVVNTRIVSTAVSGV-------------------DHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFR-GKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISD---LETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ--PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLET-------------GKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            ME ELKCP+C  ++++ ++LPC H+IC  CA NI+    E     S Q+   +GS      A     D D +S  SE DSG       V   T     + +GV                     SF  +    C   + CP C R ++LD  G+    +N+ L+ VV  ++  K A+ K  CQ+C E+    A  MCEQC+++YC  C  RCHPPRGPL +H L     G +I      +K S C  H  E L+++C  C+  +C  C+++  H  HE+  +  + K  K +LS  L  LS++A    +F+  L+++ + I +   + E  +++  D LI  LN +K +L+S +  E   K    ++ I   T  L +  G +++C+E+++E+D + FL IS+ L+ +V+  E  + +  + P+M+   DF++ +     L+T+ QL                    D+V    P API   E+C   NN  T+ W+  P     V  Y LE+DDG GGPFR+VY G E +CTV+GLHF S+Y  RVKA N  G   YS  + ++T             G +  FT   +S   D+  SN+  T++  S DD V++G+   SRGVHYWE  ID+ D    PAFG+AR D  +D MLG DDK W+MY++  RSWF+H + H  RTDGGI  GSTVG+ LD  +  L + INDE  GP+AF  L                           FYPAVS N+ VQ TL  G  +P
Sbjct:    4 MEEELKCPVCGSFYREPIILPCSHNICLACARNILVQTPEAE---SPQSSRASGS------ADYDYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPAVPQPPPQQHLLQPPGSFPPIPRNSC---ITCPQCHRSLILDERGLRGFPKNRVLEGVVDRYQQSKAAALK--CQLC-EKSPREATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQG-RISRRASPRKISTCTEHELENLSMYCVQCKTPVCYQCLEEGKHGPHEVKALGAMWKLHKGQLSQALNVLSDRATEAKEFLVQLRNMVQHIQENGVEFEACLVAQCDALIDALNRRKAQLLSQVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDPLIRRVHMTEGQWGKGTLTPRMT--SDFDLTLDSGPLLQTIHQL--------------------DFVQMKVPAAPILQLEECCTQNNSATLSWKQPPLSTIAVEGYILELDDGNGGPFREVYVGTETICTVDGLHFNSTYRSRVKAFNASGVGQYSKTLIMQTSETGLPPCDIQSIGAVAWFTFDPSSAHPDILFSNDNLTVTCNSYDDRVVMGNAAFSRGVHYWEITIDRYDNHPDPAFGIARGDVVKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTDGGIAKGSTVGMLLDFSRRILIFLINDEQQGPVAFEGLEG------------------------AFYPAVSLNRNVQVTLHTGLPIP 712          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 439.113 bits (1128), Expect = 6.941e-141
Identity = 264/748 (35.29%), Postives = 391/748 (52.27%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSY-------CQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRR-----------QKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQ---PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVG-REVP 2292
            M+ ELKCP+C   FK+ +LLPC H++C  CA NI     +  +T +Q    G+  +           D D +S  SETDSG    T     + +GV      +  R C  SL CP C R + LD  G+    +N+ L+ +V   +   AS  S        CQ+C +R  + A  MCEQC++YYC  C  RCHP RGPL +H L                          +K + C+ H  E  +++C +CR  +C  C+++  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +   + E   ++  D LI  L  +K +L++ +  EK  K    ++ I   T  L +  G +++C+E+L+E+D + +L IS++L+ +V   +  +++  +EPK+S   DF++ ++    LQ ++        Q+D  H  V         P AP+   E+C   NN  T+ W+   P   P +  Y LE+DDG GG +R+VY G E VCTV+GLHF SSYN RVKA+N  G  PYS  + L+T  +  FT   +S   D+ +SN   T+S  S DD V+LG+   S+GVHYWE RID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVG+ LD  K  L++YIN + HGP AF  L                           F PAVS N+ VQF L +  R +P
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPD-GETPAQSRASGSSDY--------DYLDMDKMSLYSETDSGYGSFTPCQLKSPNGVRVFPPVLPQRHC--SLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAPKCQLC-DRNPVDATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGALEPKVS--SDFDLVLNTDSLLQTIL--------QLDFCHGKVEP---GPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMH-NSHTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGV------------------------FVPAVSLNRNVQFRLRMWCRPIP 697          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Match: TRIM67 (tripartite motif containing 67 [Source:NCBI gene;Acc:105357218])

HSP 1 Score: 434.491 bits (1116), Expect = 7.866e-139
Identity = 267/763 (34.99%), Postives = 396/763 (51.90%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSY-------CQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRR-----------QKKSNCLCHTNEELNLFCNNCRMIICPSCIQDF-HLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQ-EIEPKMSHSGDFNIQI-SDLETLQQL----------IATMRLTEAQVDHYHAAVVTDYVSND----APKAPIFWPEQCLCTNNIFTVFWQ---PYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVG-REVP 2292
            M+ ELKCP+C   FK+ +LLPC H++C  CA NI     +  +T +Q    G+  +           D D +S  SETDSG    T     + +GV      +  R C  SL CP C R + LD  G+    +N+ L+ +V   +   AS  S        CQ+C +R  + A  MCEQC++YYC  C  RCHP RGPL +H L                          +K + C+ H  E  +++C +CR  +C  C+++  H +H++  +  + K  K +LS  L  +S+KAK   +F+  LK++ ++I +   + E   ++  D LI  L  +K +L++ +  EK  K    ++ I   T  L +  G +++C+E+L+E+D + +L IS++L+ +V   +  +++  +EPK+S   D  +   S L+T+ QL             ++  +A  D Y A + T+    +     P AP+   E+C   NN  T+ W+   P   P +  Y LE+DDG GG +R+VY G E VCTV+GLHF SSYN RVKA+N  G  PYS  + L+T  +  FT   +S   D+ +SN   T+S  S DD V+LG+   S+GVHYWE RID+ D    PAFGVAR +  +D MLG DDK W+MY++  RSWF+H + H  R +GGI  GSTVG+ LD  K  L++YIN + HGP AF  L                           F PAVS N+ VQF L +  R +P
Sbjct:    1 MDEELKCPVCGSLFKEPILLPCSHNVCLMCARNITVQTPD-GETPAQSRASGSSDY--------DYLDMDKMSLYSETDSGYGSFTPCQLKSPNGVRVFPPVLPQRHC--SLTCPLCHRSVSLDERGLRGFPRNRLLESIVARCQQNRASSSSSSSSGAPKCQLC-DRNPVDATVMCEQCDVYYCGACQQRCHPSRGPLAKHRLVPPPRQAAAGGAAMAPGGGQQPPVAARKPATCVDHEAENFSMYCCSCRAPVCTKCLEEGKHGKHDVRPLAVMWKQHKCQLSQALNGVSDKAKDAKEFLVQLKNMLQQIQENGVEFEACFVAQCDSLIEALTRQKAKLLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGYLQISDALIKRVTSSQDQWVKGALEPKVSSDFDLVLNTDSLLQTILQLDFCHGKDVQEKPLLKQMQA-ADSYEAEMETESPGVEPGPSVPAAPLLQLEKCCTRNNSATLAWRVTVPTSNP-IDGYILELDDGNGGQYREVYVGRETVCTVDGLHFNSSYNARVKAYNTIGVGPYSKTVVLKTSDVAWFTFDPSSAHRDIVLSNENLTVSCNSYDDRVVLGTAAFSKGVHYWEVRIDRYDNHPDPAFGVARINTMKDMMLGKDDKAWAMYVDNNRSWFMH-NSHTNRAEGGINKGSTVGILLDLVKRTLTFYINQKQHGPTAFDSLDGV------------------------FVPAVSLNRNVQFRLRMWCRPIP 724          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000016119.1 (SMESG000016119.1)

HSP 1 Score: 1530.77 bits (3962), Expect = 0.000e+0
Identity = 749/749 (100.00%), Postives = 749/749 (100.00%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVPXXXXXXXXXXXXXXXXILLDPMEKN 2367
            MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVPSESGESSEDDDTASTAILLDPMEKN
Sbjct:    1 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVPSESGESSEDDDTASTAILLDPMEKN 749          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 381/743 (51.28%), Postives = 513/743 (69.04%), Query Frame = 1
Query:  115 ANMEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTS---EQDSDHLSEASETDSGVVVNTRIVSTAVSG----VDHSFI--YVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKS--------YCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            + MEAELKCP CN W+K  LLLPC HS+C+ CA   + + ++  +   +Q+ D        IL+  +   E   D +S  SE DSGVVV ++  S+        V H  I  +  NR   +++ C  C R+ LLD +GI+C++ N+AL+ VV +F  KV   +S         C +C E    PA  +CEQCE+YYC +C +RCHP RGPL +H LH A +GT+IL++K++QKK+ C  H+ EEL+++C  CR ++C  C+Q+ HL+HE+H ++TICK QKTELS LLQSL+EKAK+G  FI NLKSLSEKIN+   +KE EIIS+ID +I  L +KK ELIS ++ EK +K  +FK++IHQ+TAALGRANG +QFCIEML+ESD T+FLL+S SL+TKV   EQAF+QE+E K   S DF++++S+++ L+  I+++RL E Q   Y +++ +  + ++AP API W EQC   +NI TV WQPYPGP V  YTLEIDDGA G FRKVYRGCE +CT+EGLHF+S Y +RVKAHN+HG+S YSD +CL+T  +  F M   +   DV  SN+  T++T+S ++  +L +T LSRGVHYWEF +DK++PG QP+FGVA+SDC ++ MLG D+ GW+MYI+ KRSWF++ ++HFERTDGGIK GS VG+R+DCDKG LSYYINDEPHGPIAFTKL                          + YPAVSFNK VQ TL++GRE P
Sbjct:    4 SKMEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHAD--------ILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKG------------------------SLYPAVSFNKFVQLTLVLGREAP 714          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000048786.1 (SMESG000048786.1)

HSP 1 Score: 773.852 bits (1997), Expect = 0.000e+0
Identity = 381/741 (51.42%), Postives = 512/741 (69.10%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQDGNGSHFSAILAPTS---EQDSDHLSEASETDSGVVVNTRIVSTAVSG----VDHSFI--YVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVASEKS--------YCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVYISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRLQNFYPAVSFNKLVQFTLIVGREVP 2292
            MEAELKCP CN W+K  LLLPC HS+C+ CA   + + ++  +   +Q+ D        IL+  +   E   D +S  SE DSGVVV ++  S+        V H  I  +  NR   +++ C  C R+ LLD +GI+C++ N+AL+ VV +F  KV   +S         C +C E    PA  +CEQCE+YYC +C +RCHP RGPL +H LH A +GT+IL++K++QKK+ C  H+ EEL+++C  CR ++C  C+Q+ HL+HE+H ++TICK QKTELS LLQSL+EKAK+G  FI NLKSLSEKIN+   +KE EIIS+ID +I  L +KK ELIS ++ EK +K  +FK++IHQ+TAALGRANG +QFCIEML+ESD T+FLL+S SL+TKV   EQAF+QE+E K   S DF++++S+++ L+  I+++RL E Q   Y +++ +  + ++AP API W EQC   +NI TV WQPYPGP V  YTLEIDDGA G FRKVYRGCE +CT+EGLHF+S Y +RVKAHN+HG+S YSD +CL+T  +  F M   +   DV  SN+  T++T+S ++  +L +T LSRGVHYWEF +DK++PG QP+FGVA+SDC ++ MLG D+ GW+MYI+ KRSWF++ ++HFERTDGGIK GS VG+R+DCDKG LSYYINDEPHGPIAFTKL                          + YPAVSFNK VQ TL++GRE P
Sbjct:    1 MEAELKCPKCNDWYKVPLLLPCCHSLCTNCAAASLMSPDDAVRLQQKQHAD--------ILSQNTNDHESYDDRISVFSEADSGVVVGSKTGSSVGGASGGIVIHGQICLHATNRSTHFAILCGVCLRITLLDDTGIECLLTNRALENVVNHFLTKVTPNQSPSKQISPILCNLCEEGNVEPASVVCEQCEVYYCKNCCERCHPQRGPLAKHNLHDASTGTEILKHKKQQKKTRCRLHSQEELSIYCVTCRTVVCCVCMQESHLKHELHQLNTICKAQKTELSQLLQSLTEKAKTGTYFIQNLKSLSEKINRNFPKKEEEIISSIDGIIRCLEQKKLELISQLKVEKERKNVKFKDHIHQATAALGRANGLLQFCIEMLKESDPTAFLLVSYSLITKVTAAEQAFLQEVELKPRTSTDFDLKLSNIDILRSAISSVRLAEHQNPQYPSSLGSVSMDSEAPIAPIIWREQCRVESNIITVIWQPYPGPTVECYTLEIDDGANGSFRKVYRGCESICTIEGLHFKSIYRIRVKAHNRHGDSSYSDPVCLQTSSVLWFCMDPKTAKTDVIFSNDNRTMTTDSVEEKTVLATTSLSRGVHYWEFIVDKIEPGGQPSFGVAKSDCNKEMMLGKDNIGWAMYIDSKRSWFINNNDHFERTDGGIKSGSVVGIRIDCDKGNLSYYINDEPHGPIAFTKLKG------------------------SLYPAVSFNKFVQLTLVLGREAP 709          
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Match: SMESG000032020.1 (SMESG000032020.1)

HSP 1 Score: 383.645 bits (984), Expect = 8.455e-119
Identity = 248/771 (32.17%), Postives = 392/771 (50.84%), Query Frame = 1
Query:  121 MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQ-----------QNQDGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSFIYVNNRPCAY---------SLQCPTCKRLILL--DSSGIDCIIQNKALDRVVQNFR-------GKVASEKSYCQVC--SEREEI-PAKWMCEQCEIYYCIDCLDRCHPPRGPLIRH-ALHAAESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHEIHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQKETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGRANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQE---IEPKMSHSGDFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWPEQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTVEGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMY--HNSNSDDVYISNNGFTL-STESTDDH-VILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVARSDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVRLDCDKGYLSYYINDEPHGPIAFTKL---STYNYNSL---STCGTISSTSTMGCL-RLQNFYPAVSFNKLVQFTLIVGREVP 2292
            +E+ELKC  C  +F    +L CGHS+C +C    I+ +N       Q           Q Q    S  S+     SEQD+     ASE+DSG+ ++    S    G +++F    N+P +           L CP+C    +L  ++S IDC   N +L  +   ++         + S    CQ+C  S+++ I PA  +CEQC+++YC  C ++CHP RGP  +H  L  AE+  K      ++K  NC  H+ E L  FC+ C  +IC  CI   H +H    I    K  K  LS  LQ +S + K+  +FI +LKS  +++  K       + S ID LI +L  K+  L    + E   K    K+ I++    + +    +   +E+++E +   F +I++ ++ +   +E  FIQE   ++PK     ++ ++    +++ + I+ ++  E +                 P +P F  E+C   +N+  V W P    EV  Y LEIDDG GG F+  Y G E +CT+E L+F S+Y +R+++ N+ G S   D I L T  +  F M     ++   + +S +G  + S E   +H V++ STG  +G+HYWEFR+D  D  A+ +FGVA  +C +++ LG D   WSM+++ +RSWF+H   H ER D  + IG  +G+RLD +   LSY+IN++PHGPIAFTK    S+ +YN L   S  G+ S+ S   C  R +  YPA+SFN  ++ +LI G   P
Sbjct:    6 LESELKCGFCQQFFNTPHILDCGHSVCDECGKLNIQKINLPQPKFYQTSNSNSSLSTFQRQKDQTSFASS---HESEQDA-----ASESDSGIFLSH--TSHTSLGYENTFAASMNQPGSTVKLSNRHQCQLICPSCGYSSILSQNNSTIDCFPLNLSLASICNRYQVENSSPINSLKSSSHLCQLCDDSDKDRIQPASLICEQCDVFYCYQCREKCHPMRGPFEKHNLLPVAEADLKF-----KRKIHNCSQHSEENLEYFCDQCNRLICRQCITTEHSRHLTTPISAHTKKAKVSLSKCLQRISGQVKTTTEFIQSLKSTIDQLKAKHDGFVENVDSKIDYLIEVLESKRKSLHEQAKQELENKEKIIKDQINEGGIFISQTMSMMNLAVELIKEPNGAQFSMIADKMINRTERLETKFIQEYGDMKPKCRKRFEWCLET---DSVMKEISNLQFKEFK----------------CPDSPKFIFERCTVWDNLINVVWHPQGSIEVDKYLLEIDDGIGGQFKNAYCGPESMCTIENLNFSSNYRLRIRSINEAGVSRKGDVIKLSTSSIAKFRMLPLFGASKTGINMSGDGTIIESVELGSEHSVLMASTGFIKGIHYWEFRVDHFDGKAEFSFGVAMENCVKNKKLGSDMFSWSMFVDSRRSWFIHNSVHSERIDVKLSIGDRIGIRLDLNNQRLSYFINNQPHGPIAFTKFLVGSSRSYNQLLNNSQTGSGSNHSLNECTSRTKMLYPALSFNHNIKVSLITGIPPP 742          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM91.245e-14734.54tripartite motif containing 9 [Source:HGNC Symbol;... [more]
TRIM673.652e-13332.68tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM673.918e-13031.49tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM679.944e-12931.37tripartite motif containing 67 [Source:HGNC Symbol... [more]
TRIM91.301e-8731.74tripartite motif containing 9 [Source:HGNC Symbol;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
madd-24.253e-11832.57pep chromosome:WBcel235:V:1223908:1235445:-1 gene:... [more]
madd-26.745e-11832.84pep chromosome:WBcel235:V:1223901:1235445:-1 gene:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Trim97.970e-13237.44gene:FBgn0051721 transcript:FBtr0304114[more]
Trim99.226e-13237.15gene:FBgn0051721 transcript:FBtr0080096[more]
CG84197.977e-1622.13gene:FBgn0031999 transcript:FBtr0079589[more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM673.164e-14334.94tripartite motif containing 67 [Source:NCBI gene;A... [more]
trim93.418e-13333.47tripartite motif containing 9 [Source:ZFIN;Acc:ZDB... [more]
trim46a6.585e-3121.67tripartite motif containing 46a [Source:ZFIN;Acc:Z... [more]
trim46a3.749e-3021.55tripartite motif containing 46a [Source:ZFIN;Acc:Z... [more]
mid24.075e-2822.71midline 2 [Source:ZFIN;Acc:ZDB-GENE-090220-1][more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk359.978e-13933.42serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk351.004e-13633.20serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk354.587e-13232.11serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
stk352.659e-13131.98serine/threonine kinase 35 [Source:Xenbase;Acc:XB-... [more]
TRIM673.580e-13032.72tripartite motif containing 67 [Source:NCBI gene;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim91.364e-14734.94tripartite motif-containing 9 [Source:MGI Symbol;A... [more]
Trim95.685e-12932.77tripartite motif-containing 9 [Source:MGI Symbol;A... [more]
Trim674.920e-12731.13tripartite motif-containing 67 [Source:MGI Symbol;... [more]
Trim674.920e-12731.13tripartite motif-containing 67 [Source:MGI Symbol;... [more]
Trim674.920e-12731.13tripartite motif-containing 67 [Source:MGI Symbol;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C026|TRIM9_HUMAN5.980e-14734.54E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens ... [more]
sp|Q91ZY8|TRIM9_RAT9.541e-14734.94E3 ubiquitin-protein ligase TRIM9 OS=Rattus norveg... [more]
sp|Q29RQ5|TRIM9_BOVIN8.057e-14634.94E3 ubiquitin-protein ligase TRIM9 OS=Bos taurus OX... [more]
sp|M9MRI4|TRIM9_DROME7.989e-13137.44E3 ubiquitin-protein ligase TRIM9 OS=Drosophila me... [more]
sp|Q6ZTA4|TRI67_HUMAN4.775e-12831.37Tripartite motif-containing protein 67 OS=Homo sap... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EXH80.000e+039.44Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J7K40.000e+037.92E3 ubiquitin-protein ligase TRIM9 (Fragment) OS=Sc... [more]
A0A4S2L9W50.000e+037.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LFT70.000e+037.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0S1L80.000e+037.43E3 ubiquitin protein ligase TRIM9 OS=Fasciola hepa... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM677.807e-14235.52tripartite motif containing 67 [Source:NCBI gene;A... [more]
TRIM671.037e-13935.24tripartite motif containing 67 [Source:NCBI gene;A... [more]
trim91.322e-13833.60tripartite motif containing 9 [Source:ZFIN;Acc:ZDB... [more]
trim361.448e-3223.63tripartite motif containing 36 [Source:NCBI gene;A... [more]
trim361.970e-3223.63tripartite motif containing 36 [Source:NCBI gene;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TRIM636.343e-822.53tripartite motif containing 63 [Source:HGNC Symbol... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412457.138e-11933.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402772.586e-5624.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412447.805e-2148.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331185.944e-1324.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342976.469e-1219.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim92.143e-14435.09tripartite motif containing 9 [Source:NCBI gene;Ac... [more]
TRIM672.007e-14235.30tripartite motif containing 67 [Source:NCBI gene;A... [more]
trim92.608e-14134.63tripartite motif containing 9 [Source:NCBI gene;Ac... [more]
TRIM676.941e-14135.29tripartite motif containing 67 [Source:NCBI gene;A... [more]
TRIM677.866e-13934.99tripartite motif containing 67 [Source:NCBI gene;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRIM9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016119.10.000e+0100.00SMESG000016119.1[more]
SMESG000048786.10.000e+051.28SMESG000048786.1[more]
SMESG000048786.10.000e+051.42SMESG000048786.1[more]
SMESG000032020.18.455e-11932.17SMESG000032020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018687 ID=SMED30018687|Name=E3 ubiquitin-protein ligase TRIM9|organism=Schmidtea mediterranea sexual|type=transcript|length=3042bp
TGGATGAAAATGCTAACCAATCAAACGAGCAGAAGCAATTTTCCAAAAAT
AACTATGTAAATTTACTTTGCATTGCCATGAAATAAATTTTTATTTATTA
CACCAATAAATGTTGCCAACATGGAGGCAGAACTAAAATGTCCTCTATGT
AATTTTTGGTTTAAAAAGGCGCTTTTGTTGCCATGTGGACATTCTATTTG
TTCTCAGTGTGCAACGAATATCATTAGAAATGTCAACGAAATCAATCAAA
CTTTGTCGCAACAAAATCAAGACGGAAACGGTTCCCATTTCTCTGCGATT
TTAGCCCCAACCAGTGAGCAGGATTCTGATCATTTGAGCGAAGCAAGCGA
AACCGATTCCGGAGTTGTCGTTAACACTCGAATTGTGTCGACTGCTGTCA
GTGGTGTTGATCATTCGTTTATTTATGTCAATAACCGACCGTGTGCTTAT
TCACTGCAATGTCCGACTTGTAAAAGACTAATTCTCCTCGACAGCAGTGG
AATTGACTGTATCATTCAAAACAAAGCACTCGACCGAGTTGTTCAGAATT
TTCGTGGAAAGGTAGCCAGTGAAAAATCATACTGTCAAGTCTGTTCTGAA
CGGGAAGAAATCCCCGCAAAATGGATGTGTGAACAATGTGAAATTTATTA
CTGCATCGATTGTCTGGATCGCTGCCACCCTCCTCGTGGACCACTAATTC
GGCACGCTCTTCATGCCGCAGAATCAGGAACAAAAATCTTAGAAAACAAG
CGACGACAAAAGAAATCGAATTGTCTTTGTCACACGAATGAAGAACTAAA
CTTATTTTGTAACAACTGTCGAATGATAATTTGTCCTTCTTGTATTCAAG
ATTTCCATTTGCAGCACGAAATCCACACAATTGATACTATATGCAAATAC
CAAAAGACCGAACTATCTCATTTGCTTCAATCGCTATCTGAAAAGGCTAA
ATCCGGCATGCAGTTTATCCACAATCTCAAATCTTTATCAGAGAAAATTA
ACAAAAAGTGTGCCCAAAAAGAAACTGAAATCATATCAACTATAGATGAG
CTCATTTCAATATTAAATGAAAAGAAAGGTGAGCTTATTAGCAATATACA
AGACGAAAAATCAAAAAAGACAGCACAATTTAAAGAATATATTCATCAAT
CAACCGCAGCATTGGGGAGGGCGAATGGATATATTCAGTTCTGCATTGAG
ATGCTACGAGAAAGTGATGCGACTTCCTTTTTATTGATCTCGAATTCATT
ACTGACCAAAGTCAACTGCATCGAGCAGGCATTTATCCAGGAAATTGAGC
CAAAAATGAGCCATAGTGGGGATTTCAATATCCAAATATCAGATTTGGAA
ACTTTGCAACAGTTGATTGCTACAATGAGACTGACAGAGGCCCAAGTGGA
CCATTATCATGCTGCTGTGGTAACAGATTACGTGTCAAACGATGCACCGA
AAGCACCGATATTTTGGCCAGAACAGTGTTTGTGCACTAATAACATTTTT
ACCGTTTTCTGGCAGCCCTATCCCGGACCTGAGGTTCTATATTACACGCT
GGAAATCGACGATGGAGCTGGTGGACCGTTTCGAAAAGTTTACCGAGGTT
GCGAATGTGTTTGTACTGTCGAAGGTCTTCATTTTCAATCCAGTTATAAC
GTCAGAGTCAAAGCTCACAATCAGCACGGAGAAAGTCCATATAGTGACAA
CATTTGTTTAGAAACTGGAAAGCTGACAGTTTTCACCATGTACCATAACT
CAAATAGTGATGACGTTTACATTTCAAACAATGGTTTTACCCTGTCAACA
GAATCTACCGATGATCACGTCATTCTTGGAAGTACAGGCTTGTCTCGTGG
GGTACATTATTGGGAATTCAGAATTGATAAAATGGATCCTGGAGCTCAAC
CAGCTTTTGGTGTCGCAAGGTCGGACTGCAAACGAGATGAAATGCTCGGA
ATTGATGATAAAGGATGGTCAATGTATATAAATGAAAAAAGAAGTTGGTT
TCTGCATAAGCATGAGCATTTCGAACGAACGGATGGCGGAATAAAAATTG
GCTCAACCGTTGGAGTTCGATTAGACTGTGACAAAGGTTACTTGAGCTAT
TATATCAATGACGAACCCCATGGTCCAATTGCTTTCACAAAGCTTTCAAC
GTACAATTATAATTCACTGTCTACGTGTGGTACAATATCAAGTACTAGTA
CAATGGGATGTTTGCGTCTCCAGAATTTCTATCCTGCCGTGAGTTTCAAT
AAATTAGTCCAATTTACTCTTATTGTCGGCCGAGAAGTTCCGAGTGAAAG
TGGAGAAAGTAGTGAAGACGACGACACCGCCAGTACAGCAATTTTATTAG
ACCCAATGGAAAAGAATTAACGTCGATAAAGTCGTGGACTTATACAGCTT
AGTTATACCTAGTTATTCAATATGAAGCTCACTTTTTCTTTTTCGATCGT
CGGTTCTGCATGAGTGGAGACTGTATTCAACACTGTCAGTTTAATATTTT
AATAAGCTTCAACTAAGTCTAATTAAAACAAAAAATTTAATCCGTCTTTT
GTTGAAGTATTATTTCACGCATTTCTGTCATAATTGTTGTGGATAAATAA
CATTTCTCTATTCTTGCCAACTTTAAATTCTAGATTTTTTTTACTAAATA
ATGAGATTAAATATTAGTGATTTTAATTAAAAGAAAGTTATTATTGTTAT
AGAGAAAAATACTTTAAAAATTCTTTATAAATTTTTTTAATAGACTTATC
GAAGATTTTTTTTTGGTAAATTTACAAAAAAAATCAGTAATTTGGTATTT
TATGATTTGGATTCTTTATTTACAAAACACTCGTAAAACTTCACTTCCAA
AATGAAAATCTAGATCAAGATTGAAAAAGTACAAAATGTGGACAGATACG
AATATTTGGTGATATTTTAGTGGATTTGACCGTGTTGTTTTTTGTGGACT
GTGTTAATAGAGGGAGAAATGTTTATTGTTTATATCTTCATTATTGTACC
ATGCATTTGGTTTTTTGGCGAATAAATGGTTTTCAGTGTTAT
back to top

protein sequence of SMED30018687-orf-1

>SMED30018687-orf-1 ID=SMED30018687-orf-1|Name=SMED30018687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=750bp
MEAELKCPLCNFWFKKALLLPCGHSICSQCATNIIRNVNEINQTLSQQNQ
DGNGSHFSAILAPTSEQDSDHLSEASETDSGVVVNTRIVSTAVSGVDHSF
IYVNNRPCAYSLQCPTCKRLILLDSSGIDCIIQNKALDRVVQNFRGKVAS
EKSYCQVCSEREEIPAKWMCEQCEIYYCIDCLDRCHPPRGPLIRHALHAA
ESGTKILENKRRQKKSNCLCHTNEELNLFCNNCRMIICPSCIQDFHLQHE
IHTIDTICKYQKTELSHLLQSLSEKAKSGMQFIHNLKSLSEKINKKCAQK
ETEIISTIDELISILNEKKGELISNIQDEKSKKTAQFKEYIHQSTAALGR
ANGYIQFCIEMLRESDATSFLLISNSLLTKVNCIEQAFIQEIEPKMSHSG
DFNIQISDLETLQQLIATMRLTEAQVDHYHAAVVTDYVSNDAPKAPIFWP
EQCLCTNNIFTVFWQPYPGPEVLYYTLEIDDGAGGPFRKVYRGCECVCTV
EGLHFQSSYNVRVKAHNQHGESPYSDNICLETGKLTVFTMYHNSNSDDVY
ISNNGFTLSTESTDDHVILGSTGLSRGVHYWEFRIDKMDPGAQPAFGVAR
SDCKRDEMLGIDDKGWSMYINEKRSWFLHKHEHFERTDGGIKIGSTVGVR
LDCDKGYLSYYINDEPHGPIAFTKLSTYNYNSLSTCGTISSTSTMGCLRL
QNFYPAVSFNKLVQFTLIVGREVPSESGESSEDDDTASTAILLDPMEKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043136B30.2/SPRY_sf
IPR036116FN3_sf
IPR003877SPRY_dom
IPR001841Znf_RING
IPR003649Bbox_C
IPR003961FN3_dom
IPR000315Znf_B-box
IPR013083Znf_RING/FYVE/PHD
IPR013783Ig-like_fold
IPR018957Znf_C3HC4_RING-type
IPR001870B30.2/SPRY
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003877SPRY domainSMARTSM00449SPRY_3coord: 576..723
e-value: 7.2E-8
score: 42.1
IPR003877SPRY domainPFAMPF00622SPRYcoord: 579..676
e-value: 5.1E-8
score: 33.1
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 7..117
e-value: 1.7E-4
score: 31.0
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 443..522
e-value: 7.1E-5
score: 32.2
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 442..535
score: 13.491
IPR003961Fibronectin type IIICDDcd00063FN3coord: 460..532
e-value: 6.59711E-9
score: 51.7283
IPR003649B-box, C-terminalSMARTSM00502RAD_5coord: 261..387
e-value: 7.3E-9
score: 45.4
IPR000315B-box-type zinc fingerPFAMPF00643zf-B_boxcoord: 214..254
e-value: 1.7E-5
score: 24.9
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 213..254
score: 10.964
IPR018957Zinc finger, C3HC4 RING-typePFAMPF00097zf-C3HC4coord: 7..37
e-value: 5.2E-6
score: 26.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 436..535
e-value: 3.1E-16
score: 61.5
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 542..716
e-value: 3.0E-21
score: 77.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1..52
e-value: 4.3E-8
score: 34.5
NoneNo IPR availableGENE3DG3DSA:3.30.40.90coord: 132..199
e-value: 2.7E-11
score: 45.3
NoneNo IPR availableGENE3DG3DSA:3.30.40.200coord: 200..280
e-value: 1.4E-9
score: 39.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 724..749
NoneNo IPR availablePANTHERPTHR24099FAMILY NOT NAMEDcoord: 1..730
NoneNo IPR availablePANTHERPTHR24099:SF15E3 UBIQUITIN-PROTEIN LIGASE TRIM9coord: 1..730
NoneNo IPR availableCDDcd12889SPRY_PRY_TRIM67_9coord: 529..724
e-value: 3.72588E-81
score: 254.473
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 2..43
NoneNo IPR availableSUPERFAMILYSSF57845B-box zinc-binding domaincoord: 211..272
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 517..725
score: 15.668
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 441..532
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 504..678