TGc domain-containing protein

Overview
NameTGc domain-containing protein
Smed IDSMED30018684
Length (bp)5127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TGc domain-containing protein (SMED30018684) t-SNE clustered cells

Violin plots show distribution of expression levels for TGc domain-containing protein (SMED30018684) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TGc domain-containing protein (SMED30018684) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TGc domain-containing protein (SMED30018684) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018684

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018684h1SMcG0012838 SmedASXL_000952SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018684h1SMcG0012838 SmedASXL_013499SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018684h1SMcG0012838 dd_Smed_v4_10479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018684h1SMcG0012838 dd_Smed_v4_10479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018684h1SMcG0012838 dd_Smed_v4_10479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018684h1SMcG0012838 dd_Smed_v6_10479_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30018684h1SMcG0012838 dd_Smed_v4_10479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 112.464 bits (280), Expect = 2.081e-24
Identity = 114/466 (24.46%), Postives = 195/466 (41.85%), Query Frame = 3
Query: 2769 FETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF-RFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI---IADISTE-QTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFE-IQFKSTKRTDCT-SCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPI 4145
             + LV  L+ E     TDL++ RA++ W+ +      H +Y       K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W +    G       + +   + FYFL HP      HFP +K+WQL+  P SL  FE     K  F+ +  LS H +   I   N    + +     +S     F   F   GK             GL+ + K       ++  +  P  G++K+ IFAK   D ++S V EY +     D+  +   E  +P  P                   SW +E +  ++ S  + I   S  R   + S    +  L     DD  ++++        T+ +Y   +   ++  ++  LP   ++AL+I+    +  G+  F ++ +L+ C    ++ P+
Sbjct:  168 LDELVSDLLQE---AHTDLERVRAIWIWICH------HIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGS----GLVDTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTI-----ESCAPTLF--MFMLNGK----------QEHGLLSLRKNG-----MKLEVYPPTMGTHKLQIFAKGNSD-IYSSVLEYTLKCNYVDMGVQLPAELHQPVGP-------------------SWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEEGINVLASLHGDDGPITEE--------TQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIF-VFNYLVCCANTKVNWPM 567          
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 112.079 bits (279), Expect = 2.343e-24
Identity = 114/466 (24.46%), Postives = 195/466 (41.85%), Query Frame = 3
Query: 2769 FETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF-RFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI---IADISTE-QTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFE-IQFKSTKRTDCT-SCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPI 4145
             + LV  L+ E     TDL++ RA++ W+ +      H +Y       K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W +    G       + +   + FYFL HP      HFP +K+WQL+  P SL  FE     K  F+ +  LS H +   I   N    + +     +S     F   F   GK             GL+ + K       ++  +  P  G++K+ IFAK   D ++S V EY +     D+  +   E  +P  P                   SW +E +  ++ S  + I   S  R   + S    +  L     DD  ++++        T+ +Y   +   ++  ++  LP   ++AL+I+    +  G+  F ++ +L+ C    ++ P+
Sbjct:  147 LDELVSDLLQE---AHTDLERVRAIWIWICH------HIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGS----GLVDTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTI-----ESCAPTLF--MFMLNGK----------QEHGLLSLRKNG-----MKLEVYPPTMGTHKLQIFAKGNSD-IYSSVLEYTLKCNYVDMGVQLPAELHQPVGP-------------------SWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEEGINVLASLHGDDGPITEE--------TQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIF-VFNYLVCCANTKVNWPM 546          
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 73.9442 bits (180), Expect = 4.219e-13
Identity = 41/131 (31.30%), Postives = 65/131 (49.62%), Query Frame = 3
Query: 2769 FETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTA 3161
             + LV  L+ E     TDL++ RA++ W+ +      H +Y       K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W +
Sbjct:  168 LDELVSDLLQE---AHTDLERVRAIWIWICH------HIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGS 287          
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 147.132 bits (370), Expect = 8.152e-37
Identity = 121/461 (26.25%), Postives = 210/461 (45.55%), Query Frame = 3
Query: 2727 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL--AGRNSNQGKQNST---QLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSF-HNQFEAIVKTNN----DIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQL--------FSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIY 4055
            D VA++  + ++ +F  L+  L   +   ++D+D ARA++ W+T  N     FD        +ND   +P+  L G+  G  +Y   F+ LC +AG+ C +++G++K   ++PG   +  +  ++ WN+V + G+W     +W AR L  A   S++ K +     + D  YF+   ++  Y  FP D +WQL+P P+SL  FE++  V+  FF++ LSF  N+ E+ V T+      I I L  P  DS   + F Y  +      ++   + L RF +  +     T  +V F +  P +    + IFA +V            F  VC++ ++ +  + Q   V P P      +G  +    + +    + +AI      + EI+F+ T+          +A L  N  DD  L         A T    K D+     V+I+   P   +Y L+IY
Sbjct:   45 DEVAIHCARNEVASFTDLIRTL---SSGARSDVDVARAIYRWITIKNLNTMIFD-----DSIQND---TPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRF-RNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLP-PKGDS---LIFHYNLKFFDSEENTISGMSLKRFVMQSV-----TEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE--SLQVIMV-PLPECASGEWGPAKATRLFGLLPISHPDAIINTGRYV-EIRFRMTR-----PLSEFVASLHRNRTDDRALQ--------ACTRSALKGDM-----VYIQIEFPGEGQYGLDIY 462          
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 146.747 bits (369), Expect = 1.332e-35
Identity = 121/461 (26.25%), Postives = 210/461 (45.55%), Query Frame = 3
Query: 2727 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL--AGRNSNQGKQNST---QLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSF-HNQFEAIVKTNN----DIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQL--------FSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIY 4055
            D VA++  + ++ +F  L+  L   +   ++D+D ARA++ W+T  N     FD        +ND   +P+  L G+  G  +Y   F+ LC +AG+ C +++G++K   ++PG   +  +  ++ WN+V + G+W     +W AR L  A   S++ K +     + D  YF+   ++  Y  FP D +WQL+P P+SL  FE++  V+  FF++ LSF  N+ E+ V T+      I I L  P  DS   + F Y  +      ++   + L RF +  +     T  +V F +  P +    + IFA +V            F  VC++ ++ +  + Q   V P P      +G  +    + +    + +AI      + EI+F+ T+          +A L  N  DD  L         A T    K D+     V+I+   P   +Y L+IY
Sbjct:  279 DEVAIHCARNEVASFTDLIRTL---SSGARSDVDVARAIYRWITIKNLNTMIFD-----DSIQND---TPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRF-RNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLP-PKGDS---LIFHYNLKFFDSEENTISGMSLKRFVMQSV-----TEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE--SLQVIMV-PLPECASGEWGPAKATRLFGLLPISHPDAIINTGRYV-EIRFRMTR-----PLSEFVASLHRNRTDDRALQ--------ACTRSALKGDM-----VYIQIEFPGEGQYGLDIY 696          
BLAST of TGc domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086255)

HSP 1 Score: 164.081 bits (414), Expect = 1.020e-40
Identity = 131/474 (27.64%), Postives = 225/474 (47.47%), Query Frame = 3
Query: 2670 IPNPESIEQSRISPSEKYF---DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL--AGRNSNQGKQNSTQL----DLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQ-FEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV--------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTK-RTDCTSCPRLMARLKCNSIDDSELSKKL----LIRIIA-----PTEDKYKSDVSSVE 3998
            IP P ++ + +I      F   D +A+++ Q+   TF  LV QL+       TD++KAR +F W+T  N    HFD      D + D   +P+  L G+  G  +Y   F+ LC +AG+ C +++GY+K   ++PG+K +  +  +++WN+V ++G W     +W AR L  A     QG+  +  L    D  YFL  P +  Y  +P  + WQL+  PI+L  FE L  V+  FFR+ L F ++ + A+V T++     + +  P  D    + F Y  +  +     S+  + L RF +  ++      +IV F +  P SG++ + IFA AV        E   F  VC++ I  +   E    + P P      +G T+    + +    + + +     S+ ++QF+ ++  TD       MA L  N I++ +L+K +    L  I+      P E +Y  D+ + E
Sbjct:  334 IPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGR---CTTDIEKARTIFRWITVKNLNAMHFD-----DDLRGD---TPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRF-RNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMP-TDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIG-----NIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE---ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSL-DLQFRMSRPLTD------FMATLHKNGIEEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRE 779          
BLAST of TGc domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086256)

HSP 1 Score: 164.081 bits (414), Expect = 1.020e-40
Identity = 131/474 (27.64%), Postives = 225/474 (47.47%), Query Frame = 3
Query: 2670 IPNPESIEQSRISPSEKYF---DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL--AGRNSNQGKQNSTQL----DLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQ-FEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV--------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTK-RTDCTSCPRLMARLKCNSIDDSELSKKL----LIRIIA-----PTEDKYKSDVSSVE 3998
            IP P ++ + +I      F   D +A+++ Q+   TF  LV QL+       TD++KAR +F W+T  N    HFD      D + D   +P+  L G+  G  +Y   F+ LC +AG+ C +++GY+K   ++PG+K +  +  +++WN+V ++G W     +W AR L  A     QG+  +  L    D  YFL  P +  Y  +P  + WQL+  PI+L  FE L  V+  FFR+ L F ++ + A+V T++     + +  P  D    + F Y  +  +     S+  + L RF +  ++      +IV F +  P SG++ + IFA AV        E   F  VC++ I  +   E    + P P      +G T+    + +    + + +     S+ ++QF+ ++  TD       MA L  N I++ +L+K +    L  I+      P E +Y  D+ + E
Sbjct:  334 IPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGR---CTTDIEKARTIFRWITVKNLNAMHFD-----DDLRGD---TPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRF-RNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMP-TDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIG-----NIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE---ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSL-DLQFRMSRPLTD------FMATLHKNGIEEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRE 779          
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 103.99 bits (258), Expect = 2.032e-22
Identity = 82/328 (25.00%), Postives = 145/328 (44.21%), Query Frame = 3
Query: 2811 VKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHN--QFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPL-SRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKS 3785
             + +++K RA++ WL +    +        +K    DE    I    G+C+G   Y+     +CR  GI C  + GY+KG  ++    L   + + H WN+V I G W+L D  W A    G    + K    + D FYFL  P +   SHFP D++WQL+  PIS++ FE   +   AF++  L+  +  Q++ I +    I       +  S+  +TF+Y  +       + K   + S  GL+ +     T   ++  +   E G+Y++ +FA+   +    G   +    ++     +K +P P      +G     S   +K+
Sbjct:   58 ARNEVEKLRAIWIWLCHNIEYDIEGYLGLSQKICSLDEV---IRNGKGVCSG---YSNLCVEMCREVGIECVEVSGYSKGIGYQARHSL-AEECSDHEWNAVFIDGQWWLLDACWGA----GTVDMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIV------SVSSSRLLTFSYEMRQHDPQTGALKQEEVDSSCGLLSV-----THQGMKLRLLPSEPGTYEVKLFARREGE---PGALRWVCSLELECPSVQKRQPLPDNPYLNWGLAAGASALGVKT 360          
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 100.908 bits (250), Expect = 4.227e-21
Identity = 73/281 (25.98%), Postives = 127/281 (45.20%), Query Frame = 3
Query: 2952 GLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHN--QFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPL-SRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKS 3785
            G+C+G   Y+     +CR  GI C  + GY+KG  ++    L   + + H WN+V I G W+L D  W A    G    + K    + D FYFL  P +   SHFP D++WQL+  PIS++ FE   +   AF++  L+  +  Q++ I +    I       +  S+  +TF+Y  +       + K   + S  GL+ +     T   ++  +   E G+Y++ +FA+   +    G   +    ++     +K +P P      +G     S   +K+
Sbjct:   41 GVCSG---YSNLCVEMCREVGIECVEVSGYSKGIGYQARHSL-AEECSDHEWNAVFIDGQWWLLDACWGA----GTVDMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIV------SVSSSRLLTFSYEMRQHDPQTGALKQEEVDSSCGLLSV-----THQGMKLRLLPSEPGTYEVKLFARREGE---PGALRWVCSLELECPSVQKRQPLPDNPYLNWGLAAGASALGVKT 299          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: cnpy1 (canopy FGF signaling regulator 1 [Source:Xenbase;Acc:XB-GENE-981809])

HSP 1 Score: 98.9821 bits (245), Expect = 2.560e-20
Identity = 81/298 (27.18%), Postives = 133/298 (44.63%), Query Frame = 3
Query: 2757 KIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESP---IVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGK--AVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPE-SGSYKIMIFAK 3632
            K  T   LV  LI      +TDL+K RA++TW+ +      H +Y  +  + K+  +  P   ++   G C G   YA  F+ +C  AGI+C  + G++KG  +  G    G     HAWN+V ++  W+L DT W A   A  ++N  K    + + FYFL HP      HFP +++WQL+  P+S++ FE       +F+   L+                    +P     E +    TF  EG   A+ SF      + G++ + K      +      +P  +G +K+ ++ K
Sbjct:   99 KASTVGQLVSSLIR---MARTDLEKVRAIWTWICH------HIEYDLDGMEDKSKRSGDPNQTLLSGKGACEG---YAGLFENMCSHAGIQCLKIGGFSKGFCYTTGQTFSG--ETNHAWNAVFLNKRWHLLDTTWGAG-FANSSTNSFK---FRYNEFYFLTHPALFIEEHFPDNQNWQLLQVPLSMKQFEGNLCRNSSFYNAGLT------------------ASYPETLQVETVNGKATFSIEGHSPALFSFTLNKTEKPGIMTLTKNGMQLDV------YPTVTGRHKLELYTK 354          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: lmbr1 (limb development membrane protein 1 [Source:Xenbase;Acc:XB-GENE-981846])

HSP 1 Score: 94.3597 bits (233), Expect = 4.875e-19
Identity = 63/194 (32.47%), Postives = 92/194 (47.42%), Query Frame = 3
Query: 2757 KIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINER-KDFKNDEAESPIVYL--HGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKL 3329
            K+ T + LV +LI    S   DL+K RA++ W+ +      H +Y  E  KD      +   V     G+C G   Y+  F+ +C  AG++CK + GY+KG  +K G    G   + H WN V + G+W+L D+ W +             N      FYFL HP      HFP +   QL+   +SL+ FEKL
Sbjct:   44 KVTTVDLLVKELIRNTHS---DLEKTRAIWIWICH------HIEYDTEGLKDLSQVSCDPNDVLRTRKGVCAG---YSSLFESMCSIAGVKCKSMSGYSKGGRYKTGQTFSG--DSTHEWNMVYLEGSWHLLDSTWGSVATVSTFCFLNLYNE-----FYFLTHPALFIEDHFPEENKHQLLEPCVSLKQFEKL 218          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026111.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 62.7734 bits (151), Expect = 3.999e-9
Identity = 47/189 (24.87%), Postives = 83/189 (43.92%), Query Frame = 3
Query: 2811 VKTDLDKARAVFTWLT-NINA---TEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFEL 3365
             +  L+K RA++ WL  NI+     E +  +   +K ++ ++    +    G+C+G   YA  F+ +CR  GI CK + GY++  ++  G+     K + H WN+V++   W+L D  W A                 +DL   +  P        P + +WQ   + +  + FE+       FFR  L
Sbjct:  141 ARNHLEKIRAIWIWLCHNISEWYDVEGYLGF--SQKVYRPEDV---LALGKGVCSG---YAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTK-SNHMWNAVQLDTDWHLLDACWGA---------------GTVDLQEKIFIPRISLRPIGPDEATWQSWESVVPFQEFEQKIFKTSEFFRLHL 305          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026106.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 58.9214 bits (141), Expect = 6.270e-9
Identity = 36/119 (30.25%), Postives = 61/119 (51.26%), Query Frame = 3
Query: 2811 VKTDLDKARAVFTWLT-NIN-ATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTA 3161
             +  L+K RA++ WL  NI    E +  +   +K ++    E  +    G+C+G   YA  F+ +CR  GI CK + GY++  ++  G+     K + H WN+V++   W+L D  W A
Sbjct:   64 ARNHLEKIRAIWIWLCHNIRYDVEGYLGF--SQKVYR---PEDVLALGKGVCSG---YAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTK-SNHMWNAVQLDTDWHLLDACWGA 173          
BLAST of TGc domain-containing protein vs. Ensembl Mouse
Match: Ky (kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MGI:96709])

HSP 1 Score: 117.087 bits (292), Expect = 4.390e-26
Identity = 116/465 (24.95%), Postives = 198/465 (42.58%), Query Frame = 3
Query: 2778 LVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF-RFELSFHNQFEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI---IADISTE-QTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFE-IQFKSTKRTDCT-SCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPI 4145
            LV  L+ E     +DL++ RA++ W+ +      H +Y  E    K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W     +G       + +   + FYFL HP      HFP +K+WQL+  P SL  FE     K  F+ +  LS H +   I   N    I IE + P           + F   GK             GL+ + K       ++  +  P  G++K+ IFAK    +++S V EY +     D S +  +E  +P  P                   SW +E +   + S  + I   S  R   + S    ++ L     DD  ++++        T+ +Y   ++  +   ++  LP   ++AL+I+    + +G +F  ++ +L+ C    ++ P+
Sbjct:  171 LVSDLLQE---AHSDLERVRAIWIWICH------HIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWG----SGLVDTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPT---------LFMFMLNGK----------QEHGLLSLRKNG-----MKLEVYPPTMGTHKLQIFAKG-NSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGP-------------------SWFSEQMGITKPSHSDPIIHTSDGRCAISFSVEEGVSVLASLHGDDGPITEE--------TQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQG-NFIFVFNYLLCCANTKVNWPM 567          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0E908|HIL_DROME (Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.022e-39
Identity = 131/474 (27.64%), Postives = 225/474 (47.47%), Query Frame = 3
Query: 2670 IPNPESIEQSRISPSEKYF---DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL--AGRNSNQGKQNSTQL----DLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQ-FEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV--------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTK-RTDCTSCPRLMARLKCNSIDDSELSKKL----LIRIIA-----PTEDKYKSDVSSVE 3998
            IP P ++ + +I      F   D +A+++ Q+   TF  LV QL+       TD++KAR +F W+T  N    HFD      D + D   +P+  L G+  G  +Y   F+ LC +AG+ C +++GY+K   ++PG+K +  +  +++WN+V ++G W     +W AR L  A     QG+  +  L    D  YFL  P +  Y  +P  + WQL+  PI+L  FE L  V+  FFR+ L F ++ + A+V T++     + +  P  D    + F Y  +  +     S+  + L RF +  ++      +IV F +  P SG++ + IFA AV        E   F  VC++ I  +   E    + P P      +G T+    + +    + + +     S+ ++QF+ ++  TD       MA L  N I++ +L+K +    L  I+      P E +Y  D+ + E
Sbjct:  334 IPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGR---CTTDIEKARTIFRWITVKNLNAMHFD-----DDLRGD---TPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRF-RNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMP-TDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIG-----NIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE---ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSL-DLQFRMSRPLTD------FMATLHKNGIEEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRE 779          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8H8|KY_MOUSE (Kyphoscoliosis peptidase OS=Mus musculus OX=10090 GN=Ky PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.097e-25
Identity = 116/465 (24.95%), Postives = 198/465 (42.58%), Query Frame = 3
Query: 2778 LVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF-RFELSFHNQFEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI---IADISTE-QTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFE-IQFKSTKRTDCT-SCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPI 4145
            LV  L+ E     +DL++ RA++ W+ +      H +Y  E    K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W     +G       + +   + FYFL HP      HFP +K+WQL+  P SL  FE     K  F+ +  LS H +   I   N    I IE + P           + F   GK             GL+ + K       ++  +  P  G++K+ IFAK    +++S V EY +     D S +  +E  +P  P                   SW +E +   + S  + I   S  R   + S    ++ L     DD  ++++        T+ +Y   ++  +   ++  LP   ++AL+I+    + +G +F  ++ +L+ C    ++ P+
Sbjct:  171 LVSDLLQE---AHSDLERVRAIWIWICH------HIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWG----SGLVDTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPT---------LFMFMLNGK----------QEHGLLSLRKNG-----MKLEVYPPTMGTHKLQIFAKG-NSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGP-------------------SWFSEQMGITKPSHSDPIIHTSDGRCAISFSVEEGVSVLASLHGDDGPITEE--------TQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQG-NFIFVFNYLLCCANTKVNWPM 567          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NBH2|KY_HUMAN (Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 GN=KY PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 3.060e-23
Identity = 88/306 (28.76%), Postives = 134/306 (43.79%), Query Frame = 3
Query: 2769 FETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF-RFELSFHNQFEAIVKTNND--IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI 3677
             + LV  L+ E     TDL++ RA++ W+ +      H +Y       K+ +A  P   L    T    YA  F+ +CR AG++C  + GY+KG  ++ G    G     HAWN+V + G W+L D+ W +    G       + +   + FYFL HP      HFP +K+WQL+  P SL  FE     K  F+ +  LS H +   I   N    + IE   P           + F   GK             GL+ + K       ++  +  P  G++K+ IFAK   D ++S V EY +
Sbjct:  168 LDELVSDLLQE---AHTDLERVRAIWIWICH------HIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGS----GLVDTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPT---------LFMFMLNGK----------QEHGLLSLRKNG-----MKLEVYPPTMGTHKLQIFAKGNSD-IYSSVLEYTL 433          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A5K3F1I3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 1.272e-107
Identity = 236/710 (33.24%), Postives = 363/710 (51.13%), Query Frame = 3
Query: 2727 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVK-TNNDIKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK--------------------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKED-CRLIRPMNKILTLPS---VNGDGKREEIFEVIIPQAMKVASVID 4778
            D  A+ +  ++  +F  L++QLI+   ++ +D+++ RA+F WL   +           + +F N    SP   L G+ TG+ TYAQ FQ LCR+A + CKLL GYAKG D+ PGM+  G    QH+WN+V + GTW L D HW ARRL  + ++        LD FYFL +P  + Y+HFP DK WQL+ +PI+LE FE L +VK AFF++ LS  +   A++  ++ ++++ + FP  D+     FT      +  + + +K++ L R+   E++  +   S V F+IR P  G+YK++I+AK                    + E  L+  VCEY ++A +       + PFPP Q   YG TE+  ++N+      EA    +  I E++F     T     PR+M+RL C+ + D  L   +L R+           V    E  I  +LPD  E+ LE+YAN+PE +GSSFF IWQ LI  +     + +P+L   + LG   RF ELGL+ +S+PDPLI  +        ++ I+L     + L          +++ QL+ AS    D   D+S ++LQQ  VG      +V FM+R+  +  F+KL IYA+      D++P    YLI+        H    +   FPQQ + W+   C L  P   IL L +   +  +   E  F + +P A  VA V+D
Sbjct:  100 DEHAMAVSYQEQNSFNQLIWQLIYAR-NITSDIERVRAIFLWLCTKDL---------HQMNFNNVSPGSPEEILMGIRTGKSTYAQIFQTLCRYANLHCKLLLGYAKGADYSPGMRFSGASTGQHSWNAVLVDGTWRLVDCHWAARRLIVKRASVENVRYI-LDTFYFLANPSQLIYTHFPHDKDWQLLHHPITLEEFETLPLVKSAFFKYNLSLLSHRTAVILFSDPEVRVVVGFP-KDAENSFLFTIGLSFDDNDSAEHYKNVSLMRYTRQEVIAQE---SCVAFYIRPPRPGAYKLLIYAKQRDSGSNQDVETASVGSNASSGEKNLYGAVCEYRLMARVPANAC--LPPFPPCQTGNYGATEMAKRFNVVPH-TQEATLRAQGGIAEVRFGLAPGTR-QPMPRIMSRLHCSLMSDDALENCILQRV-----------VKDGTETVITVFLPDAGEFGLEVYANDPERDGSSFFAIWQFLITSEVPSAARGLPNLPASY-LGPAARFYELGLQTVSHPDPLIKADA------GELRIQLAYQPQRPL----------KMMAQLIYASNNASD---DHSQMVLQQMRVG------QVYFMVRIP-RLGFFKLQIYALPEGDRNDSLPGVYNYLIEATKTT---HRVRGQLMPFPQQFAHWRRSGCFLDSPTEGILGLDASGRLMANPPAELPFSLAVPSAHTVAVVVD 749          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A5K3EYU7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 5.706e-107
Identity = 236/710 (33.24%), Postives = 365/710 (51.41%), Query Frame = 3
Query: 2727 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVK-TNNDIKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK--------------------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKED-CRLIRPMNKILTLPS---VNGDGKREEIFEVIIPQAMKVASVID 4778
            D  A+ +  ++  +F  L++QLI+   ++ +D+++ RA+F WL   +  + +F+         N    SP   L G+ TG+ TYAQ FQ LCR+A + CKLL GYAKG D+ PGM+  G    QH+WN+V + GTW L D HW ARRL  + ++  +     LD FYFL +P  + Y+HFP DK WQL+ +PI+LE FE L +VK AFF++ LS  +   A++  ++ ++++ + FP  D+     FT      +  + + +K++ L R+   E++  +   S V F+IR P  G+YK++I+AK                    + E  L+  VCEY ++A +       + PFPP Q   YG TE+  ++N+      EA    +  I E++F     T     PR+M+RL C+ + D  L   +L R+           V    E  I  +LPD  E+ LE+YAN+PE +GSSFF IWQ LI  +     + +P+L   + LG   RF ELGL+ +S+PDPLI  +        ++ I+L     + L          +++ QL+ AS    D   D+S ++LQQ  VG      +V FM+R+  +  F+KL IYA+      D++P    YLI+        H    +   FPQQ + W+   C L  P   IL L +   +  +   E  F + +P A  VA V+D
Sbjct:  174 DEHAMAVSYQEQNSFNQLIWQLIYAR-NITSDIERVRAIFLWLCTKDLHQMNFN---------NVSPGSPEEILMGIRTGKSTYAQIFQTLCRYANLHCKLLLGYAKGADYSPGMRFSGASTGQHSWNAVLVDGTWRLVDCHWAARRLIVKRASV-ENVRYILDTFYFLANPSQLIYTHFPHDKDWQLLHHPITLEEFETLPLVKSAFFKYNLSLLSHRTAVILFSDPEVRVVVGFP-KDAENSFLFTIGLSFDDNDSAEHYKNVSLMRYTRQEVIAQE---SCVAFYIRPPRPGAYKLLIYAKQRDSGSNQDVETASVGSNASSGEKNLYGAVCEYRLMARVPANAC--LPPFPPCQTGNYGATEMAKRFNVVPH-TQEATLRAQGGIAEVRFGLAPGTR-QPMPRIMSRLHCSLMSDDALENCILQRV-----------VKDGTETVITVFLPDAGEFGLEVYANDPERDGSSFFAIWQFLITSEVPSAARGLPNLPASY-LGPAARFYELGLQTVSHPDPLIKADA------GELRIQLAYQPQRPL----------KMMAQLIYASNNASD---DHSQMVLQQMRVG------QVYFMVRIP-RLGFFKLQIYALPEGDRNDSLPGVYNYLIEATKTT---HRVRGQLMPFPQQFAHWRRSGCFLDSPTEGILGLDASGRLMANPPAELPFSLAVPSAHTVAVVVD 823          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A564YNS0 (TGc domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7855 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 3.029e-106
Identity = 242/761 (31.80%), Postives = 399/761 (52.43%), Query Frame = 3
Query: 2616 ETPQYFKLNMAEEVSETEIPNPESI---------EQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNN-DIKIELKFPNNDSTEKITFTYTFQT---EGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK--------------------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNI--KSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKED-CRLIRPMNKILTLPSVNG---DGKREEI-FEVIIPQAMKVASVID 4778
            E P+ F   + +     + P+PE+I         ++     + +  D  A+ +  ++  +F  L++QLI+   ++ +DL++ RA+F WL   +  + +FD         N    SP   L G+ TG+ TYAQ FQ LCR+A + CKLL GYAKG D+ PGM+  G    QH+WN+V + GTW+L D HW ARRL  + ++  +     LD FYFL +P  + Y+HFP DK WQL+ +PI+LE FE L +VK AFF++ LS  +   A++  N  ++++ + +P   +    TF +T      + ++ +++++ PL R+   E++  +     V F+IR P  G+Y+++I+ K                    + E  L+  VCEY ++A +S+     + PFPP Q   YG TEL  ++N+    S +  A    +  I E++F     +     PR+MA+L+C+ + +  L   +L+R++       KS   +V  V    +LPD  E+ LEIYA +PE +GSS++ IWQ+LI+ +     + +P+L  G+ LG   RF ELGL+ +S+PDPLI  +       A++ I+          +    +P ++++ QL+ +S    +   DYS ++LQQ  +G      +V F++R+  +  F+KL IYA+      D++P    YLI  ++      L+G+    FPQQ + W+   C L  P   IL +   NG   +    EI F + +P A  VA V+D
Sbjct:   57 EPPKEFVPQLLDPEPAYQKPDPEAIPGRTPVYAMQEDDAFKAFQKVDEHAMAVSYQEQNSFNQLIWQLIYAR-NITSDLERVRAIFLWLCTKDLHQMNFD---------NVTPGSPEEILMGIRTGKSTYAQIFQTLCRYANLHCKLLLGYAKGADYSPGMRFTGAAVGQHSWNAVLVDGTWHLIDCHWAARRLIVKRASV-ENVRYILDTFYFLTNPSQLIYTHFPHDKDWQLLHHPITLEEFESLPLVKSAFFKYNLSLVSHRTAVILFNEPEVRVVIGYPREAAN---TFLFTIGLCFDDSESGENYQNTPLMRYARQEVISKE---CCVAFYIRPPRPGAYRLLIYTKKRDGSGMDGVYQPEDLGSPGSGEKSLYGAVCEYRLMARVSSNAC--LPPFPPCQTGNYGPTELFQRFNVVPVGSDSGGAFIRAQEGIAEVRFAMGGGSQ-HPLPRMMAKLRCSLLSEEALDNCILLRVL-------KSGTEAVITV----FLPDAGEFGLEIYACDPERDGSSYYAIWQYLIITEMASPIRGVPNLPLGY-LGPAARFYELGLQVVSHPDPLIKADA------AEIRIQF---------AYQPQRP-LKMMAQLIFSSNNTSE---DYSQMVLQQMRMG------QVFFIVRIP-RLGFFKLQIYALPESDRDDSLPGVYNYLI--ESTKATHRLRGQLM-PFPQQFAHWRRSGCYLDSPTEGILGI-GENGRLMNNPPPEINFSLAVPSAHAVAVVVD 755          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A068WCE8 (Transglutaminase OS=Echinococcus granulosus OX=6210 GN=EgrG_000765200 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.169e-105
Identity = 242/760 (31.84%), Postives = 390/760 (51.32%), Query Frame = 3
Query: 2616 ETPQYFKLNMAEEVSETEIPNPESI-EQSRISPSE-----KYFDPV---ALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVK-TNNDIKIELKFPNNDSTEKITFTYTFQ-TEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK----------------------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLES--SIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKED-CRLIRPMNKILTLPS---VNGDGKREEIFEVIIPQAMKVASVID 4778
            E P+ F   + +     + P P++I ++  + P +     K F  V   A+ +  ++  +F  L++QLI+   ++ +DL++ RA+F WL   +  + +FD         N    SP   L G+ TG+ TYAQ FQ+LCR+A + CKLL GYAKG D+ PGM+  G    QH+WN+V + GTW+L D HW ARRL  + ++  +     LD FYFL +P  + Y+HFP DK WQL+ +PI+LE FE L +VK AFF++ LS  +   A++  +  ++++ + +P  D+     FT      + +  + + +  L R+   E++  +     V F+IR P  G+YK++++AK                        E  L+  VCEY ++A   T     + PFPP Q  CYG TE   ++N+       +  T+ +   I E++F     +     PR+M RL+C+ + +  L   +L R++       KS   +V  V    +LPD  E+ LEIYA++PE +GSS+F IWQ+LI  +    ++ +P+L  G+ LG   RF ELGL+ +S+ DP I           ++ I+L         +    +P ++++ QL+ AS    +D  DYS ++LQQ  +G      +V F+IR+  +  F+KL IYA+      D++P    YLI+         L+G+    FPQQ + W+   C L  P   IL L +   +  +   E  F + +P A  VA V+D
Sbjct:   56 EPPKEFVPQLLDPEPAYQKPAPDAIPDRQPVYPMQEDDAFKAFQKVDEHAMAVSYQEQNSFNQLIWQLIYAR-NITSDLERVRAIFLWLCTKDLHQMNFD---------NVTPGSPEEILMGIRTGKSTYAQIFQILCRYANLHCKLLLGYAKGADYSPGMRFSGTATGQHSWNAVLVDGTWHLVDCHWAARRLIVKRASV-ENVRYILDTFYFLTNPSQLIYTHFPHDKDWQLLHHPITLEEFETLPLVKSAFFKYNLSLVSHRTAVILFSEPEVRVVIGYP-KDANNTFLFTIGLSFDDSELSEHYHNTSLMRYARQEVIARE---CCVAFYIRPPRPGAYKLLVYAKKRDGSGIDGVCGEAETFDIGRAGAEKNLYGAVCEYRLMA--RTPSNACLPPFPPCQTGCYGVTEAFKRFNVVPIGPEASGATIRARNGIAEVRFALVGGSQ-RPMPRMMGRLRCSLLPEEALDNCILHRVL-------KSGTEAVITV----FLPDAGEFGLEIYASDPERDGSSYFAIWQYLITSEVAATERGLPNLPTGY-LGPAARFYELGLQVVSHSDPFIRAEA------GELRIQL---------AYQPQRP-LKMMAQLIFAS---NNDSEDYSQMVLQQMRLG------QVYFVIRIP-RLGFFKLQIYALPESDRDDSLPGVYNYLIEASKAT--HRLRGQLM-PFPQQFAHWRRSGCYLDAPTEGILGLDASGRLMANPPAEVAFCLAVPSAHSVAVVVD 756          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: G4VI28 (TGc domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_051990 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 1.227e-105
Identity = 246/742 (33.15%), Postives = 377/742 (50.81%), Query Frame = 3
Query: 2667 EIPNPESIEQSRISPSEKY--------FDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSF-HNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGK-AVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVE----------------------DQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVN------QCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEI-FEVIIPQAMKVASVI 4775
            E P P+ I  +    S  Y         D  A+++ Q++   F  L++QLI+   ++  DL+K R +F WL   +  + +FD++         + +SP   L G+ TG+ TYAQ F  LCR+AG+ CKLL GYAKG ++ PGM   G +  QH+WN+V I   W L D HW ARRL G+  +        LD+FYFL  P  + Y+HFP D  WQL+ +P+SL+ FE LA VK AFF++ L    ++   IV ++ +++I + FP +DS   ++FT+    + +   + F+ IPL+RFG  E +  + T     F+IR P  G+YK++I+AK  +                      + LF  VCEY ++A+  + ++  + PFPP Q + YG  EL   Y I +   +  ++ +  ++ EI+F       C   PRLMA+LKC  + ++ LSK LL R I         +  +V  +    +LP+  EY LE+YAN+P  +G+SFF++WQ++I+       + +P +   + LG   RF  +GL+ALS+ DP I  N      Q   HPD                     KP +RI+ QL+  S    D   D S  +LQQ          ++ F+IR      F+K  IYA+   +  +++P    YL++       +  +      FPQQ +QWKE C L  PM+ IL  PSV+     + + F V IP A  VA V+
Sbjct:  184 EKPKPQEIPTTSDMSSTPYQSFDVFRRIDEHAVSISQQQQDNFNQLIWQLIYAR-NITDDLEKVRVIFLWLCTKDLHKMNFDHV---------KPDSPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMHFSG-RQGQHSWNAVLIDKCWRLIDCHWAARRLIGKRPSPDNVRYG-LDMFYFLASPSQLIYTHFPHDPDWQLLRHPVSLKEFENLAPVKSAFFKYNLDLVTHRNSVIVCSDPEVRIAIAFP-SDSKNDLSFTFGLSFDNQEGSEEFRGIPLTRFGRQETLIREHT---SVFYIRPPRPGAYKLLIYAKQHQPHQNGQKEGLGIVSMIPDDLSSENLFGAVCEYRLVANFGSNRS--LPPFPPCQSSSYGPNELAKNYRITAQRVDCTLRAVRGTL-EIRFGLGALPGC-PLPRLMAKLKCTLVAENALSKSLLQRSI-------NGNTEAVFAI----FLPEAGEYGLEVYANDPVKDGNSFFVVWQYIIISDCDSPVRGLPTIPPTY-LGPVSRFDSMGLKALSHTDPFIQANTGELCIQFARHPD---------------------KP-LRIMAQLIHCS---HDVSEDCSQQILQQT------RDFQIYFVIRFPHPG-FFKFQIYALPYTEPGESLPSVYNYLLEA---TQVNRGRNGHVMCFPQQFAQWKEGCYLHTPMDGIL-YPSVSNQPTADTVPFRVTIPTAHAVAVVV 857          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040397.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:312137:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000040397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 7.067e-31
Identity = 135/534 (25.28%), Postives = 221/534 (41.39%), Query Frame = 3
Query: 2682 ESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLT-NINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSF-HNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRF-GLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVE-DQLFSGVCEYYIIADISTEQTEKVKPF---PPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIY-----ANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQ 4247
            E I  +  S  + Y       L +KKI + ET+   +I+       DL++ RAV+ WL  NI      F  +  +K +  D+    I     +C+G   YA     LC   GI C+ + GY KG  ++PG K +G     HAWN+V + G W+L D+ W A    G      +  +   + FYFL  P++    H+P ++ WQL+  P++L+ FEK       F+R  L+  H +  ++   N +  I +       +E   FTYT        +  K   LS+  GL+ I K+     ++      P +GS+++ +FA+A      +S +C + +       +  K KPF   P     C+G +       ++S      +  L S  FE+  ++ +            R+ C S+   +L   L  R +A   +  K   S +         P    Y L +Y     + N   E ++ FL+  H       L +   P LS     G      E GL   S+   ++T  Q
Sbjct:  179 ELIANTDFSRVDTYVINAGKELKRKKIYSVETIAQTIIN---GTTNDLERLRAVWIWLCDNIEYDVEGFLGVT-KKLYSPDDV---IRTGKAVCSG---YAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQG---TNHAWNAVNLEGHWHLLDSCWGA----GNCDMSQRVFNKCYNEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGL-----SEPANFTYTI----SQCNGSKKTELSKSRGLLTITKSSMKLRVIP-----PTAGSFEVELFARAAGVTGSYSHLCSFLL-------KCAKPKPFEDLPENPSLCWGISPDGYARGLRSCEYGGEVIELRSGRFELVLQTARPL----------RVIC-SLSHKDLDGTLATRCVASQAEAEKLTCSVL--------CPYTGYYTLSVYVRDYESGNGNHESAASFLL--HCTSNPVNLNELFPPDLSNK--CGPGLTTTEAGLSQFSHTGAIVTAQQ 651          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032424.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:316716:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000032424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 9.181e-31
Identity = 134/517 (25.92%), Postives = 216/517 (41.78%), Query Frame = 3
Query: 2739 LNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLT-NINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNND---IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRF-GLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVE-DQLFSGVCEYYIIADISTEQTEKVKPF---PPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIY-----ANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQ 4247
            L L +KKI + ET+   +I+       DL++ RAV+ WL  NI      F  +  +K +  D+    I     +C+G   YA     LC   GI C+ + GY KG  ++PG K +G     HAWN+V + G W+L D+ W A    G      +  +   + FYFL  P++    H+P ++ WQL+  P++L+ FEK       F+R  L+  +  +  + T N    I + L  P N       FTYT        +  K   LS+  GL+ I K+     ++      P +GS+++ +FA+A      +S +C + +       +  K KPF   P     C+G +       ++S      +  L S  FE+  ++ +            R+ C S+   +L   L  R +A   +  K   S +         P    Y L +Y     + N   E ++ FL+  H       L +   P LS     G      E GL   S+   ++T  Q
Sbjct:   37 LLLKRKKIYSVETIAQTIIN---GTTNDLERLRAVWIWLCDNIEYDVEGFLGVT-KKLYSPDDV---IRTGKAVCSG---YAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQG---TNHAWNAVNLEGHWHLLDSCWGA----GNCDMSQRVFNKCYNEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPAN-------FTYTIS----QCNGSKKTELSKSRGLLTITKSSMKLRVIP-----PTAGSFEVELFARAAGVTGSYSHLCSFLL-------KCAKPKPFEDLPENPSLCWGISPDGYARGLRSCEYGGEVIELRSGRFELVLQTARPL----------RVIC-SLSHKDLDGTLATRCVASQAEAEKLTCSVL--------CPYTGYYTLSVYVRDYESGNGNHESAASFLL--HCTSNPVNLNELFPPDLSNK--CGPGLTTTEAGLSQFSHTGAIVTAQQ 490          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 117.472 bits (293), Expect = 4.893e-26
Identity = 142/643 (22.08%), Postives = 253/643 (39.35%), Query Frame = 3
Query: 2820 DLDKARAVFTWLT-NINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFE-AIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRF----PESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIK--SSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKA--ILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQ--CPI---HPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNN---SLKEVEFMIRLTDKS-KFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILT 4691
            +L+K RA++ WL  NI      +  ++     K    E  I    G+C+G   ++     +CR  G++C+ + GY+KG    PG KL   ++  H+WN V +   W L D  W A    G  + + K    + D FYFL  P +   SHFP ++ WQL+  PISLE FE   +   AF+   L+     +  I   + +  + +      S+  +TF Y  +         +D+     G  E+  +    S+ R  +      P+ G Y++ +FA+A  D   SG   +    ++      + +P P      +G         +K  S  N E ++  E    E+   + +       P ++     +++ D  L+K+ L   IA             E +      P    Y L ++  +      +   +   L+ CK+  + L+Q  P    G   G   R    GL   S+P  L+ V Q  C I       ++ I   L    +  S     PG  +  +     + +   DN  + L  +  +        +L + +  + ++  S   Y+L +Y   +  + +  PL   Y+++         +  K+   FP   S W + C L+ P + +L 
Sbjct:  228 ELEKLRAIWVWLCHNIEYDLEGYLGLSP----KLCTPEEVIKQGRGVCSG---FSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRS-DHSWNVVWVKDRWGLLDACWGA----GTVNMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVT-----SSRPLTFAYELRQ--------RDVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGD---SGALRWVCSLELECPAVRQSQPLPANPYMSWGSGARAGALGVKGCSLPNEEPLEVGEGGECEVILHTAR-------PLMVVCELAHALLDPALAKRCLALQIA------------AERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLLHCKSQGVNLNQLYPP-DLGPWCGPGMRTDAAGLSQFSHPGALVNVPQGRCNITFHRTSPELQIHAVLSTEMSQKSQVKSGPGQGLNSETSHKDKASSKQDNSTTELHREALFPLSRYILLTLTDSKVTVSVSASSPGVYRLGLYGR-MPPQQEFSPLC-DYVLR--------SMCEKRGDPFPCVYSAWGKGCVLLEPRSGLLA 812          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 117.472 bits (293), Expect = 4.893e-26
Identity = 142/643 (22.08%), Postives = 253/643 (39.35%), Query Frame = 3
Query: 2820 DLDKARAVFTWLT-NINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFE-AIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRF----PESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIK--SSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKA--ILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQ--CPI---HPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNN---SLKEVEFMIRLTDKS-KFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILT 4691
            +L+K RA++ WL  NI      +  ++     K    E  I    G+C+G   ++     +CR  G++C+ + GY+KG    PG KL   ++  H+WN V +   W L D  W A    G  + + K    + D FYFL  P +   SHFP ++ WQL+  PISLE FE   +   AF+   L+     +  I   + +  + +      S+  +TF Y  +         +D+     G  E+  +    S+ R  +      P+ G Y++ +FA+A  D   SG   +    ++      + +P P      +G         +K  S  N E ++  E    E+   + +       P ++     +++ D  L+K+ L   IA             E +      P    Y L ++  +      +   +   L+ CK+  + L+Q  P    G   G   R    GL   S+P  L+ V Q  C I       ++ I   L    +  S     PG  +  +     + +   DN  + L  +  +        +L + +  + ++  S   Y+L +Y   +  + +  PL   Y+++         +  K+   FP   S W + C L+ P + +L 
Sbjct:  228 ELEKLRAIWVWLCHNIEYDLEGYLGLSP----KLCTPEEVIKQGRGVCSG---FSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRS-DHSWNVVWVKDRWGLLDACWGA----GTVNMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVT-----SSRPLTFAYELRQ--------RDVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGD---SGALRWVCSLELECPAVRQSQPLPANPYMSWGSGARAGALGVKGCSLPNEEPLEVGEGGECEVILHTAR-------PLMVVCELAHALLDPALAKRCLALQIA------------AERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLLHCKSQGVNLNQLYPP-DLGPWCGPGMRTDAAGLSQFSHPGALVNVPQGRCNITFHRTSPELQIHAVLSTEMSQKSQVKSGPGQGLNSETSHKDKASSKQDNSTTELHREALFPLSRYILLTLTDSKVTVSVSASSPGVYRLGLYGR-MPPQQEFSPLC-DYVLR--------SMCEKRGDPFPCVYSAWGKGCVLLEPRSGLLA 812          
BLAST of TGc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009155.1 (pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-1 gene:ENSPMAG00000008280.1 transcript:ENSPMAT00000009155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 4.580e-19
Identity = 53/180 (29.44%), Postives = 88/180 (48.89%), Query Frame = 3
Query: 2814 KTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFF 3353
            +T+L+K R+++ W+ +    +  + +  ++ ++K ++  S       +C G   YA     +CR  G+ C+ + GY K     P  ++E      HAWN+V I G WYL D  W A    G  SN+ +  + + + FYFL  P     SH+P    WQL+ + +S E FE   +    FF
Sbjct:   11 QTELEKLRSIWIWVCHNIEYDVKYWFGKDKSNYKKEDVLSSRT---AICAG---YAGLVNEMCRHVGVECEEVVGYGKTLGHVP-FQIED---PNHAWNAVRIGGRWYLLDACWGA----GAVSNETQSFNRRYNEFYFLADPKKFVESHWPKISKWQLMEHLVSREDFEYRVLKDFRFF 176          
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Match: EDO40037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B7])

HSP 1 Score: 102.834 bits (255), Expect = 8.577e-22
Identity = 84/295 (28.47%), Postives = 130/295 (44.07%), Query Frame = 3
Query: 2805 PSVKTDLDKARAVFTWLT-NIN-ATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNND-IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSI-VRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYI 3677
            P  ++   +A A++ W+T N++  +E +F     R + K   AES +V    +  G   +A  FQ LC  A I+ + + G+AKG  +  G +++G K A H WN +     W +CD  W +  L             Q +  YF++ P+     HFP D  WQL+   IS E FE L +  PA F   L   +      +  +D I I L+ P  +    +    + QT G         P +   +      +  F I V+    FPE G Y++ I   + E QL  GV EY +
Sbjct:  206 PFEESQRSRAFALYRWITLNVSFDSEGYFG----RAEKKECRAESVLVTRSAVSQG---FANLFQALCMEADIQARSVDGFAKGYGYCAGDEIQGSKFA-HTWNILRTRVGWTICDVTWGSGFLG-----DDLMFHRQPNAHYFMVTPELAISDHFPLDTKWQLLDAVISKEEFENLIVPSPAIFSSGLRLESHKNCFYQEESDSIVITLRAPKRNMIRGVLKDSSGQTIG---------PRNMIDVTSGKLKEADFLIPVKVTTHFPEPGEYRVQICLVSAEGQLVPGV-EYRV 477          
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Match: EDO32609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUI9])

HSP 1 Score: 94.7449 bits (234), Expect = 1.869e-19
Identity = 124/507 (24.46%), Postives = 197/507 (38.86%), Query Frame = 3
Query: 2817 TDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDST-----EKITFTYTFQT-EGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSK--YNIKS-SWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVH------IRGYL--------------------------PDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRAL 4214
            TD +KA A++ WLT   A +   D    R + K+  AE  +     +C G   YA  +  L   AG+    + GYAKG   K G + EG     HAWN +++  TWY+ D  W A    G +    K  +T    + FL  PD+  + H P ++ WQ +   I   +FE+ A  KP+    E+         ++++ D   E      D T      K+      +T  G+A++  + + L   GL +I              +FP +G+YK+ ++    E+    GV  Y + A  S         +P      Y     L K   NI++     E +    S+ F        R D    P +  R             +  +++++P E+ Y +D  +V E+       + GYL                          P+  EY L I+A     E ++F L +    +  A     P P    GF +     F+ELGLR L
Sbjct:  226 TDREKAFAIYRWLTFNVAYDV--DGFFGRSEKKSTSAEDVLSSRTSVCAG---YASLYTALGEAAGLEIHNVSGYAKGYGHKLGQRFEG---VNHAWNVLKVDNTWYVSDATWGA-GFVGDDMLFTKNPNT----YRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSA--KPSCEMLEMGIE------LESHKDYAYETPTDTIDMTFYCPGRKMLLMGKVKTSSGQALEGRERVRLRFKGLHQI----------EMRAQFPNAGTYKVEVYVVKGENSWNHGV-SYEVTA--SQGCGWNCGGYPKVSNALYDHGFTLEKPLENIQTDDGRAEVVFQCTSTNFSHLISRMTREDGGRFPYVHPRF-----------FEWGVKLVSPCENIYSTDGKAVVELELPGVSSVSGYLKRREETLHSCTMVTGDGERKLIQVHTPEKGEYELNIFAKRTGEEKNTFLLRY----IIHATQGTGPNP----GFPV-LSNAFRELGLRLL 678          
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 113.235 bits (282), Expect = 9.716e-25
Identity = 115/512 (22.46%), Postives = 209/512 (40.82%), Query Frame = 3
Query: 2736 ALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFE-AIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSF----KDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQL-FSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAIL--LDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQ 4247
             L L ++ +   +T+V  +  E+   + +LD+ RA++ WL + N       Y+   +  K    E  I    G+C    +Y+     +CR  GI C+ + G++KG  ++ G  L    +  H WN+V + G W+L D  W A    GR   + +    + D FYFL  P++   SHFP ++ WQL+  PI LE FEK      AFF   L   N     IV  + +  + + F     +   TFTY        +       K+   S FG++ +        ++      P +GSY   +FA+  +       VC + +  +    +  +V P  P     +G   + +   +     +  +  ++  +F++  K+++       P ++     +   ++ L+K+ L   I P           +   H+    P    Y L ++  + E     F      L+ CK  +  +D+  P  + G   G   R  + GL   S+   +++  Q
Sbjct:  186 GLELKERHVYDVKTIVHSITRES---RNELDRLRAIWVWLCH-NIEYDVSGYLGRSE--KLSSLEEVIAAGRGVCC---SYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNS-DHLWNAVLLGGQWFLLDACWGA----GRVDMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGF-----SSPTTFTYEITQHRDLLHCGALEQKESSSSSFGILTVSHRSMNLQLLP-----PATGSYDCKVFARHEKASTPLVWVCSFTV--ECLAPRAMEVIPENPYLS--WGMQPVAASLGVADCSQSREVAEVDKGVFDLVLKTSR-------PLMVLCELVHPQMEAALAKRCLATQIQP----------DILLCHVLCPFPGF--YRLSVFVRDYEKSELKFQNAANFLLHCKGKVFHVDELFPP-NLGSACGPGTRTAQAGLSKFSHNASVVSTQQ 649          
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 112.464 bits (280), Expect = 1.672e-24
Identity = 83/304 (27.30%), Postives = 135/304 (44.41%), Query Frame = 3
Query: 2736 ALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFE-AIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSF----KDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK 3632
             L L ++ +   +T+V  +  E+   + +LD+ RA++ WL + N       Y+   +  K    E  I    G+C    +Y+     +CR  GI C+ + G++KG  ++ G  L    +  H WN+V + G W+L D  W A    GR   + +    + D FYFL  P++   SHFP ++ WQL+  PI LE FEK      AFF   L   N     IV  + +  + + F     +   TFTY        +       K+   S FG++ +        ++      P +GSY   +FA+
Sbjct:  186 GLELKERHVYDVKTIVHSITRES---RNELDRLRAIWVWLCH-NIEYDVSGYLGRSE--KLSSLEEVIAAGRGVCC---SYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNS-DHLWNAVLLGGQWFLLDACWGA----GRVDMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGF-----SSPTTFTYEITQHRDLLHCGALEQKESSSSSFGILTVSHRSMNLQLLP-----PATGSYDCKVFAR 465          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 1605.5 bits (4156), Expect = 0.000e+0
Identity = 802/802 (100.00%), Postives = 802/802 (100.00%), Query Frame = 3
Query: 2535 DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDXXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXXTIFANFNSRYNSYIPLLEYLIQ 4940
            DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEEWFQFSESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEYLIQ
Sbjct:  683 DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEEWFQFSESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEYLIQ 1484          

HSP 2 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 365/365 (100.00%), Postives = 365/365 (100.00%), Query Frame = 1
Query:  373 KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNELKNNTNKEDNLMLETMNVDFAPRKAFKQKYNITRIRYRKVDSHSVLKEQDQTNKPNEENLDVDNETIKIESRNSKNDEEISSNILLERKLDDLICSDSLNHDNSNCEEILNQLDCDLIPDPIQCLGHEIIDKTDNKILNFTDFDDVKDERIIDNFKISPEXXXXXXXXXXXXXXVYNESSKINIDDDLISNTNSKSECLQESLLECPQETNLECLQETHLECPQETHFECPQETHFECPQETHXXXXXXXXXXXXPDKSINNIITETSSKDSNLIENSTNIPNHNEEKIQKEILKTIEKNLNNITERNFKLNFKKEKK 1467
            KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNELKNNTNKEDNLMLETMNVDFAPRKAFKQKYNITRIRYRKVDSHSVLKEQDQTNKPNEENLDVDNETIKIESRNSKNDEEISSNILLERKLDDLICSDSLNHDNSNCEEILNQLDCDLIPDPIQCLGHEIIDKTDNKILNFTDFDDVKDERIIDNFKISPEDSNSNKSDKSDIDNVYNESSKINIDDDLISNTNSKSECLQESLLECPQETNLECLQETHLECPQETHFECPQETHFECPQETHLECLQESLLELEPDKSINNIITETSSKDSNLIENSTNIPNHNEEKIQKEILKTIEKNLNNITERNFKLNFKKEKK
Sbjct:   10 KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNELKNNTNKEDNLMLETMNVDFAPRKAFKQKYNITRIRYRKVDSHSVLKEQDQTNKPNEENLDVDNETIKIESRNSKNDEEISSNILLERKLDDLICSDSLNHDNSNCEEILNQLDCDLIPDPIQCLGHEIIDKTDNKILNFTDFDDVKDERIIDNFKISPEDSNSNKSDKSDIDNVYNESSKINIDDDLISNTNSKSECLQESLLECPQETNLECLQETHLECPQETHFECPQETHFECPQETHLECLQESLLELEPDKSINNIITETSSKDSNLIENSTNIPNHNEEKIQKEILKTIEKNLNNITERNFKLNFKKEKK 374          

HSP 3 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 311/314 (99.04%), Postives = 313/314 (99.68%), Query Frame = 2
Query: 1451 LKRKKKSTIDYKVNEISNSNSNCHKPYKPNILHSQFSDDVISELKQKLELDKIKSPSEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRRVTLDCNLTARKPINDNLKKCFEISEPSSNFSQQKANFFYTNKNKMDSQQKELSKNNFTHSPNIQKTPQNPQIPIVNCSKEILQALPNSQRNNQSVIIAKSIEILENQTGTHQTKITQNPKSSCNVEKSFSQIFKSQNFYSKSENSMKTKSILPVCDPKCEIVKTPAGNVSIKVTDKLTRKRSVSKNNMPWTLDKEEENLVKRQPYLLKRLNRANKCPVNN 2392
             K++KKSTIDYKVNEISNSNSNCHKPYKPNILHSQFSDDVISELKQKLELDKIKSPSEVKQNLENTNLKNNQNSLLNNKTSKTTFTFNNSVKRRVTLDCNLTARKPINDNLKKCFEISEPSSNFSQQKANFFYTNKNKMDSQQKELSKNNFTHSPNIQKTPQNPQIPIVNCSKEILQALPNSQRNNQSVIIAKSIEILENQTGTHQTKITQNPKSSCNVEKSFSQIFKSQNFYSKSENSMKTKSILPVCDPKCEIVKTPAGNVSIKVTDKLTRKRSVSKNNMPWTLDKEEENLVKRQPYLLKRLNRANKCPVNN
Sbjct:  369 FKKEKKSTIDYKVNEISNSNSNCHKPYKPNILHSQFSDDVISELKQKLELDKIKSPSEVKQNLENTNLKNNQNSLLNNKTSKTTFTFNNSVKRRVTLDCNLTARKPINDNLKKCFEISEPSSNFSQQKANFFYTNKNKMDSQQKELSKNNFTHSPNIQKTPQNPQIPIVNCSKEILQALPNSQRNNQSVIIAKSIEILENQTGTHQTKITQNPKSSCNVEKSFSQIFKSQNFYSKSENSMKTKSILPVCDPKCEIVKTPAGNVSIKVTDKLTRKRSVSKNNMPWTLDKEEENLVKRQPYLLKRLNRANKCPVNN 682          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 1593.94 bits (4126), Expect = 0.000e+0
Identity = 802/802 (100.00%), Postives = 802/802 (100.00%), Query Frame = 3
Query: 2535 DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDXXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXXTIFANFNSRYNSYIPLLEYLIQ 4940
            DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEEWFQFSESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEYLIQ
Sbjct:   57 DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEEWFQFSESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEYLIQ 858          

HSP 2 Score: 97.4413 bits (241), Expect = 5.114e-20
Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 1
Query:  373 KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNE 513
            KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNE
Sbjct:   10 KHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHPTESVNE 56          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000080370.1 (SMESG000080370.1)

HSP 1 Score: 487.649 bits (1254), Expect = 3.888e-152
Identity = 281/749 (37.52%), Postives = 423/749 (56.48%), Query Frame = 3
Query: 2586 DRSAKSITFAETPQYFKLNMAEEVSETEIPNPESI-EQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIH-ENPSVK-TDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQT----------EKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVC-KAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVN---QCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLK--GKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVI 4775
            + +   + + + P+ FK ++ E+V +  IP    I  +   +  EK  D +A+ + +    +F  L++ LI+     +K  +  K  A+FTWLT  N  E  F       D       SP   L G+ TG+  YAQ FQ+LCR+ G++CKL+RGYAKG D+KPGMKL GGK AQHAWN+V++   WYL D HW ARRL G+  N  +     LDLFYF+ +P  ++Y+HFPF++ WQL    I+LE FE L +VKP FF++ L  ++  +A+++  + + + +K P  +  EKI  T+T   EG   + ++   L+R+G+ E   T++   I     RFP+SGSYK++++A+   DQ+F G+CEY + A +  ++T          EKV P+PPTQQ+ YGKTE+  +YN+  S  N +I+          FK  K  D  + PRLM RLK +  +DS+L  +LL R      + Y+ ++  +++  I  +LPD  EYALEIYANNPE EGSSFFLIWQ  I   K   L   +P ++ G  +G+Q +F+E GL  LS+PDP IT++   +       D+++ +GLP+             I++LGQL+D S T  +++ DYS+ LLQQ  + +   L  V F IR+     FYKL+IY      E +T+P+  +YLI     +    +   G   G +P Q SQWK+ CRL +P+N+ +    +N D +    F + IP A  VA V+
Sbjct:   48 EETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRTDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASD-------SPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRI-KYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLP-IELVEKICLTFTLTLEGLG-EIYEGSNLTRYGIQE---TNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKEND--NFPRLMGRLKSSFHEDSKLVSRLLQR------NTYEKNI--IDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNC----------IKVLGQLVDVSST--EEETDYSDYLLQQNILSE-KELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVPYYGSGEGPYPYQLSQWKDKCRLYKPINRKI---KINKDSETIIQFSLQIPDAYHVAVVV 757          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000061907.1 (SMESG000061907.1)

HSP 1 Score: 337.035 bits (863), Expect = 2.116e-93
Identity = 235/760 (30.92%), Postives = 390/760 (51.32%), Query Frame = 3
Query: 2535 DHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNN-DIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV----------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARL-KCNSIDDSELSKK-LLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEI-FEVIIPQAMKVASV 4772
            + T + ++G   K P  +  AK I   E  + +K  +  +   +E+P   +I     S   +  D  A+ +  ++   F  L++QLI+   ++  +L+K R +F WL   +  + +FD I +         +SP   L G+ TG+ TYAQ F  LCR+AG+ CKL+ GYAKG D+ PGMK + G+  +H+WN+V I G W L D HW ARRL G+  ++ +    +LD+FYFL +P  + Y+HFP D  WQL+ + I++E FE LA VK  FF++ L       A+++TN  + ++ + FP     E++ FT+T  +     + + ++ L R+G  E+   D   +   F IR P  GSYK++I+AK +            ++F  +CEY I ++   +Q   + PFPP Q + YG  E+  +Y I+S  N ++   +++   E++F   K+ D     R+MA+L  CN  +  +L+++ +L R+I              +E  I  +LP+  EY LE+YAN+ +  G+SF+ +WQ+ IV     +   +P L  G++   + +F + GL   S+ DP I  N        D+ I+L          ++  KP IRI+ QL+  S        + S +   Q      +S+  V F+IRL  +  F+K  I+A+   +  +++P    YLI+ + +  Y+         FPQQ  QWKE C L  P N +L       +GK ++I F + + +A  +A V
Sbjct: 1088 ESTANWASGPMQKEPPKNFEAKPIELEE--EIYKPEI--QALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYAR-NITDELEKVRVIFLWLCTKDLHKMNFDNIKQ---------DSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQ-GRQGEHSWNAVLIEGVWRLIDCHWAARRLIGK-EHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKG-IEERLLFTFTL-SFNDGSEKYNEVSLLRYGRQEL---DFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQA--LPPFPPCQSSTYGPNEMYKQYPIESE-NVQSSFYIDNGTVEVKFL-IKKPDI----RVMAKLFSCNVKNSDQLTEQCVLQRLIG------------NDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANT------GDICIQL---------KTTRDKP-IRIMAQLIHCSH-------NVSEMCSDQFLQLGRDSV--VYFLIRLPHQG-FFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNV-------GFPQQFGQWKEGCYLYEPTNGVLGF-----NGKPDKITFRMDVMRAKSLAVV 1768          

HSP 2 Score: 188.348 bits (477), Expect = 1.488e-47
Identity = 148/487 (30.39%), Postives = 230/487 (47.23%), Query Frame = 3
Query: 2727 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL-AGRNSNQGKQNST--QLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNND-IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV--------EDQLFSGVCEYYIIADISTEQTEKVKPFPPT-QQTCYGKT-ELLSKY-----------NIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLI 4112
            D  A+ + Q    TF+ L++ L        +DL+KAR +F W+T  +           + DF N     P   L  L   + +YA  F+ +C +AG+ C  + G+AKG D+KPG   +  +   H WN + +  +W L D HW  R L +G+N+    Q+S   Q D FYF++ P    YSHFP    WQL+  P++L  FE L + K  FF+  + F +Q   +V + +  +K+ L F   DS     FTY  QT+ +  D F+ + L  + L E V        + F+ RFP +G + + IFA+ +        ++  F   CEY II+D +        P+P T     +G +  L+S Y           +I S  N   +KT      EI F    R D +    L+ +L+ N +DD ++  + +   IA   +K    +S          LP+  EY LEIYAN P +EG ++  I Q+L+
Sbjct:   42 DGHAIRVSQNSYPTFKDLLWDLAFR--YQLSDLEKARVIFRWMTACDMN---------KLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEF-NHTWNVIHLQNSWQLIDAHWATRYLTSGKNT----QDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS-----FTYKLQTD-ENKDQFEGVSLRYYVLQETVNNQ-----INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHS---PYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKT------EIVFDKL-REDVS----LLCKLRKNGVDDEDILDQYI--EIAEKPNKTSFSIS----------LPEPGEYGLEIYANEP-SEGDTYTHICQYLL 474          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000060198.1 (SMESG000060198.1)

HSP 1 Score: 130.183 bits (326), Expect = 9.188e-30
Identity = 76/260 (29.23%), Postives = 125/260 (48.08%), Query Frame = 3
Query: 2703 ISP-SEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGR--------------NSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKT-NNDIKIELKFP 3434
            ISP S  + D + + +   +  TF  LV  L  +      D++K RA+F W+T  +    +FD         ND     +  L  +  GQ +  + F  +CR+AGI C+ + GY+KG  ++PGM ++  +  ++ W +V ++G W   + +W AR L  R              + +Q  +N  + D FYFL       + HFP  K WQL+  PI+L+ F  L IVK  FF   LSF   +  +++T    + +++  P
Sbjct: 1017 ISPESLIHVDNMVIEVMLLEPTTFTELVLYLTKD---CSKDVEKVRAIFRWITTYDIKSVNFD-----PAAPNDTL---VGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRLQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMP 1265          
The following BLAST results are available for this feature:
BLAST of TGc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
KY2.081e-2424.46kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY2.343e-2424.46kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY4.219e-1331.30kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ltd-18.152e-3726.25Lim and Transglutaminase Domain [Source:UniProtKB... [more]
ltd-11.332e-3526.25Lim and Transglutaminase Domain [Source:UniProtKB... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hil1.020e-4027.64gene:FBgn0050147 transcript:FBtr0086255[more]
Hil1.020e-4027.64gene:FBgn0050147 transcript:FBtr0086256[more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky2.032e-2225.00kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
ky4.227e-2125.98kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnpy12.560e-2027.18canopy FGF signaling regulator 1 [Source:Xenbase;A... [more]
lmbr14.875e-1932.47limb development membrane protein 1 [Source:Xenbas... [more]
ENSXETT00000026111.13.999e-924.87kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
ENSXETT00000026106.16.270e-930.25kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ky4.390e-2624.95kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q0E908|HIL_DROME1.022e-3927.64Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil... [more]
sp|Q8C8H8|KY_MOUSE3.097e-2524.95Kyphoscoliosis peptidase OS=Mus musculus OX=10090 ... [more]
sp|Q8NBH2|KY_HUMAN3.060e-2328.76Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of TGc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F1I31.272e-10733.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EYU75.706e-10733.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564YNS03.029e-10631.80TGc domain-containing protein OS=Hymenolepis dimin... [more]
A0A068WCE81.169e-10531.84Transglutaminase OS=Echinococcus granulosus OX=621... [more]
G4VI281.227e-10533.15TGc domain-containing protein OS=Schistosoma manso... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000040397.17.067e-3125.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032424.19.181e-3125.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ky4.893e-2622.08uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ky4.893e-2622.08uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009155.14.580e-1929.44pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400378.577e-2228.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326091.869e-1924.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky9.716e-2522.46kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
ky1.672e-2427.30kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of TGc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073008.10.000e+0100.00SMESG000073008.1[more]
SMESG000073008.15.114e-20100.00SMESG000073008.1[more]
SMESG000080370.13.888e-15237.52SMESG000080370.1[more]
SMESG000061907.12.116e-9330.92SMESG000061907.1[more]
SMESG000060198.19.188e-3029.23SMESG000060198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018684 ID=SMED30018684|Name=TGc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5127bp
AAAACTGAATGAGTTTATCAACAAGGGCACTTTGAATTGAATTCCGGAAA
AAGGAAAGTCTAAGAAGTGATGCGAGAATTATTCAACTAAAAATTAATCA
ACTATTTCTTACCAACTGCCGAGATTGTTTATGTGAATTTTTTCCTAAAG
TATTTGACCACTTGCCGTGTTGCACATTCACAGTTACGCACACGATTTGA
TAAAATTGCAGCTTTTTCTTGTTTAGAATTTATTTCTTATTTTTCCAAAA
TTTGATCTATATCACTGTAACAATAATAATTGAGGATTTATCAACACTTT
CTACTGGGGAAATTTTTCAATTCGGAAATTACATTATCATCATCTATGGG
AAATCTTTGTTCATCATTGTCAAAGCATGACCGTAATTCTGTGTCGAAAG
AACTAAACGAATGCGAAGAGAACTCAATGGATCGAATGAATAGTAAAAAT
GATTTTGAAAAACTCGAAACATCAACAAACTCTAATCCTCACCCAACTGA
ATCCGTAAATGAGTTAAAAAATAACACGAATAAAGAAGATAATTTAATGC
TTGAAACTATGAATGTTGATTTTGCTCCTAGAAAAGCTTTCAAACAAAAA
TATAATATTACTCGAATTAGATATCGAAAAGTTGACTCTCATTCAGTTTT
AAAAGAACAAGATCAAACCAACAAACCCAACGAAGAAAATTTAGACGTAG
ATAATGAGACTATAAAAATTGAGAGTCGCAACTCTAAAAACGATGAAGAG
ATTTCAAGCAATATCTTATTGGAGCGCAAATTAGATGACTTAATTTGTTC
GGATTCATTGAACCATGACAACTCAAATTGTGAGGAGATTTTAAATCAAC
TCGACTGTGATTTAATTCCGGATCCAATTCAATGTCTTGGACATGAAATA
ATTGATAAAACTGATAATAAAATATTAAATTTTACCGATTTTGATGACGT
CAAAGATGAAAGAATTATCGATAATTTCAAAATTTCACCAGAAGATTCAA
ATTCAAACAAAAGTGATAAATCTGATATTGATAACGTTTATAATGAAAGC
AGTAAGATAAATATTGATGATGATCTGATTTCTAATACCAATTCGAAATC
TGAATGTCTACAAGAATCTCTATTGGAATGTCCACAAGAAACCAATTTGG
AATGTCTACAAGAAACTCATTTGGAATGTCCACAAGAAACCCATTTCGAA
TGTCCACAAGAAACCCATTTTGAATGTCCACAAGAAACTCATTTGGAATG
TCTACAAGAATCTCTACTGGAATTGGAACCTGATAAATCAATAAATAATA
TTATCACAGAAACATCAAGTAAAGATTCGAATTTAATCGAAAATTCAACA
AACATTCCAAATCATAACGAAGAAAAAATTCAGAAAGAGATTTTAAAAAC
TATAGAAAAGAATTTAAACAATATCACTGAAAGGAATTTTAAATTAAATT
TTAAAAAGGAAAAAAAAATCTACAATTGACTATAAAGTGAATGAAATCTC
TAATAGCAATTCCAATTGCCATAAACCTTACAAACCCAATATCCTTCATT
CCCAATTTTCGGACGATGTGATCAGTGAGTTAAAACAAAAATTAGAATTG
GATAAAATAAAATCACCTTCAGAAGTTAAACAAAACCTAGAGAATACGAA
TTTAAAAAATAATCAAAATTCATTGTTAAATAATAAAACAAGCAAAACTA
CATTCACATTTAACAACAGCGTGAAAAGACGCGTCACACTTGATTGCAAT
TTGACGGCTCGCAAACCAATCAATGACAACTTAAAAAAATGTTTCGAAAT
ATCCGAACCTAGTTCAAATTTCAGTCAACAGAAAGCCAATTTTTTTTATA
CTAATAAAAATAAAATGGATTCCCAACAAAAAGAGTTGTCTAAAAATAAT
TTTACTCATTCGCCTAATATCCAAAAAACCCCTCAAAACCCTCAAATTCC
AATCGTAAATTGTTCAAAGGAAATTCTTCAAGCTCTTCCCAACAGTCAAA
GAAATAATCAGTCGGTAATTATTGCCAAGTCAATAGAAATATTAGAAAAT
CAAACTGGAACCCATCAAACAAAAATTACTCAAAACCCAAAATCCAGTTG
CAATGTTGAGAAAAGCTTTTCTCAAATCTTTAAGTCTCAAAATTTCTATA
GCAAATCAGAAAACTCTATGAAAACGAAATCGATTCTGCCAGTCTGTGAT
CCGAAATGTGAAATCGTGAAAACTCCAGCTGGGAATGTGTCAATCAAAGT
TACAGACAAGTTGACGAGAAAGAGAAGCGTTAGTAAAAACAACATGCCCT
GGACTCTAGACAAGGAAGAAGAAAATCTCGTCAAGAGGCAGCCGTATCTT
TTAAAGCGATTAAATAGAGCGAATAAATGTCCGGTTAATAATGTAAGATT
GAATGGCCTTTTATTATTTCTGCAGGATTTATCGCTGCCATTTGCTTTGC
TGAACACTCATATCGCACTAAATAATAAATTAATGTATCTTATCCTCATT
TATTTTATTTATAATTTTTGTTTTAATTATTTAGGATCACACAGATTCCC
TCTCGAATGGAATTACAAATAAAATACCAGCTTGCGATCGGTCTGCAAAG
AGTATTACTTTCGCTGAGACTCCCCAATATTTTAAGCTCAACATGGCCGA
GGAAGTCTCGGAAACCGAAATTCCAAACCCAGAATCAATTGAGCAAAGCC
GGATAAGTCCGAGTGAAAAATATTTCGATCCAGTGGCACTGAATCTTTGT
CAGAAAAAAATCGTCACATTTGAAACTTTGGTTTTCCAGTTAATTCACGA
GAATCCGAGCGTAAAAACCGACTTGGACAAGGCTCGAGCAGTCTTTACTT
GGCTTACCAATATCAATGCAACCGAAGCGCATTTCGATTATATCAATGAA
AGAAAAGACTTCAAAAACGATGAAGCTGAGTCCCCTATAGTTTATTTGCA
TGGACTGTGTACTGGCCAATATACGTACGCTCAATTTTTCCAATTGCTTT
GTAGATTTGCCGGTATTCGTTGTAAGTTATTGCGCGGATATGCAAAAGGC
AACGATTTTAAGCCGGGAATGAAATTAGAGGGCGGAAAAGCTGCTCAACA
TGCCTGGAATTCGGTAGAGATCAGTGGAACTTGGTATCTTTGTGACACTC
ACTGGACAGCCAGACGATTGGCCGGAAGGAATTCTAATCAAGGAAAACAG
AATTCCACTCAATTGGATTTATTCTATTTTCTCATCCACCCAGATGACAT
GAAATATTCCCATTTTCCATTCGATAAATCATGGCAACTTGTCCCTAATC
CCATTTCACTTGAGACATTTGAAAAGTTGGCTATTGTCAAACCAGCATTT
TTTAGATTCGAACTCTCTTTTCACAACCAATTTGAAGCCATTGTTAAAAC
AAATAATGACATCAAAATTGAACTGAAATTTCCTAATAATGACTCTACCG
AAAAAATAACATTTACTTACACTTTTCAAACGGAAGGCAAAGCTGTAGAT
TCATTTAAAGACATTCCTCTAAGCAGATTTGGACTCGTAGAAATTGTTAA
AACGGATGAAACTTTTTCTATTGTCAGATTTTGGATTCGTTTCCCGGAGA
GCGGCTCGTATAAAATAATGATATTTGCAAAAGCAGTGGAAGATCAGCTA
TTCAGTGGAGTTTGTGAATATTACATAATAGCCGACATTTCAACCGAACA
AACCGAGAAAGTCAAGCCTTTTCCACCGACTCAACAAACCTGTTATGGGA
AAACGGAATTATTATCTAAATACAACATCAAAAGTTCTTGGAATAATGAA
GCGATCAAAACTTTGGAATCAAGTATTTTTGAAATACAATTCAAGTCGAC
TAAAAGGACTGACTGTACGAGTTGTCCAAGGCTCATGGCTCGGCTGAAAT
GTAACTCAATTGATGATTCTGAGCTATCGAAAAAGCTTTTAATTCGAATA
ATTGCTCCAACTGAAGATAAATACAAATCAGATGTTTCGTCAGTTGAAGA
AGTCCACATTCGGGGATATCTTCCGGACATTAATGAATACGCATTGGAGA
TTTATGCAAACAACCCAGAAACTGAAGGCTCTTCCTTTTTCTTAATCTGG
CAACATCTAATTGTATGTAAAGCCATACTTTTAGATCAGCCCATTCCACA
CTTGAGTCAAGGTTTTATTCTGGGAGCTCAAGAAAGGTTTAAAGAGCTCG
GATTAAGAGCTTTGTCATATCCTGATCCCCTTATTACTGTCAATCAATGC
CCCATTCATCCTGATGCTGATGTTAGTATCAAATTGGGTCTTCCAATTGT
TAAAGCTCTTAATTCATCAAGTAATCACAAACCCGGAATACGAATTCTTG
GCCAGTTGTTGGATGCAAGTAGAACCAATCAGGACGATGACAATGACTAT
TCCAACCTTCTTCTTCAACAAGCATATGTTGGAGATAATAATTCATTAAA
GGAAGTCGAATTCATGATAAGACTGACTGACAAATCTAAATTCTACAAGC
TCTATATTTATGCCATGTCATTAGATAAAGAATTGGATACGGTTCCGTTA
GCAATGACATATCTGATCCAATTAGACACAAACATAGATTATGACCACCT
GAAAGGAAAAAAGTATGGAGAATTTCCCCAGCAAACCAGTCAATGGAAAG
AAGATTGTAGACTAATCCGACCAATGAATAAGATATTAACTCTGCCTTCA
GTAAATGGAGATGGCAAACGGGAAGAAATATTTGAAGTTATTATACCGCA
GGCAATGAAAGTAGCCAGTGTCATCGATGAGGAGTGGTTCCAGTTCAGTG
AAAGCAAAGAGGAAGAAAGTAAATGGATCGGATCAATGAGTTTAAATTCA
TCTATGAAATCGGGGAGTTTATTAACAATATTTGCAAATTTCAATTCTAG
ATATAACAGCTATATTCCACTATTGGAATATCTCATCCAGTGATAAACAT
GAGCTTATTGTAACAGATTCTTAATAAAAAAAATTGTAGATTATTCATTC
TTAACTCAATTGGTTTTGTATGTTCCGTAATAGATACTTAAATACTGAAA
AAAAAAAAATTGTAGATTATTCATTCTTAACTCAATTGGTTTTGTATGTT
CCGTAATAGATACTTAAATACTGAAAA
back to top

protein sequence of SMED30018684-orf-1

>SMED30018684-orf-1 ID=SMED30018684-orf-1|Name=SMED30018684-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=767bp
MAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQL
IHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIV
YLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKA
AQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHP
DDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAI
VKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVE
IVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADIS
TEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQF
KSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSS
VEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQP
IPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGL
PIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNN
SLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDY
DHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVI
IPQAMKVASVIDEEWFQFSESKEEESKWIGSMSLNSSMKSGSLLTIFANF
NSRYNSYIPLLEYLIQ*
back to top

protein sequence of SMED30018684-orf-2

>SMED30018684-orf-2 ID=SMED30018684-orf-2|Name=SMED30018684-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MDSQQKELSKNNFTHSPNIQKTPQNPQIPIVNCSKEILQALPNSQRNNQS
VIIAKSIEILENQTGTHQTKITQNPKSSCNVEKSFSQIFKSQNFYSKSEN
SMKTKSILPVCDPKCEIVKTPAGNVSIKVTDKLTRKRSVSKNNMPWTLDK
EEENLVKRQPYLLKRLNRANKCPVNNVRLNGLLLFLQDLSLPFALLNTHI
ALNNKLMYLILIYFIYNFCFNYLGSHRFPLEWNYK*
back to top

protein sequence of SMED30018684-orf-3

>SMED30018684-orf-3 ID=SMED30018684-orf-3|Name=SMED30018684-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=378bp
MGNLCSSLSKHDRNSVSKELNECEENSMDRMNSKNDFEKLETSTNSNPHP
TESVNELKNNTNKEDNLMLETMNVDFAPRKAFKQKYNITRIRYRKVDSHS
VLKEQDQTNKPNEENLDVDNETIKIESRNSKNDEEISSNILLERKLDDLI
CSDSLNHDNSNCEEILNQLDCDLIPDPIQCLGHEIIDKTDNKILNFTDFD
DVKDERIIDNFKISPEDSNSNKSDKSDIDNVYNESSKINIDDDLISNTNS
KSECLQESLLECPQETNLECLQETHLECPQETHFECPQETHFECPQETHL
ECLQESLLELEPDKSINNIITETSSKDSNLIENSTNIPNHNEEKIQKEIL
KTIEKNLNNITERNFKLNFKKEKKIYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR002931Transglutaminase-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0030018Z disc
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007517muscle organ development
GO:0007528neuromuscular junction development
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.620.30coord: 12..186
e-value: 9.1E-10
score: 40.1
NoneNo IPR availablePANTHERPTHR47020FAMILY NOT NAMEDcoord: 7..762
IPR002931Transglutaminase-likePFAMPF01841Transglut_corecoord: 56..168
e-value: 5.6E-7
score: 30.0
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 48..226