SMED30018671

Overview
NameSMED30018671
Smed IDSMED30018671
Length (bp)2442
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018671 (SMED30018671) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018671 (SMED30018671) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018671 (SMED30018671) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018671 (SMED30018671) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018671

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30018671h1SMcG0007811 dd_Smed_v4_8772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018671h1SMcG0007811 dd_Smed_v4_8772_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30018671 vs. Ensembl Human
Match: SNX19 (sorting nexin 19 [Source:HGNC Symbol;Acc:HGNC:21532])

HSP 1 Score: 61.2326 bits (147), Expect = 7.761e-9
Identity = 57/198 (28.79%), Postives = 87/198 (43.94%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIES 1522
            I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L +  D     K +KGP  L   + L N    R+  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++     E  P  E 
Sbjct:  530 IQNLRITGTITAREHSGTGFHPYTLYTVKYETALDGENSSGLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPLGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVS------RIDKMVVSAIVDTLKTAFPRS--EPQSPTEELSEAETESKPQTEG 717          
BLAST of SMED30018671 vs. Ensembl Human
Match: SNX19 (sorting nexin 19 [Source:HGNC Symbol;Acc:HGNC:21532])

HSP 1 Score: 60.8474 bits (146), Expect = 8.955e-9
Identity = 57/198 (28.79%), Postives = 87/198 (43.94%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIES 1522
            I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L +  D     K +KGP  L   + L N    R+  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++     E  P  E 
Sbjct:  530 IQNLRITGTITAREHSGTGFHPYTLYTVKYETALDGENSSGLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPLGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVS------RIDKMVVSAIVDTLKTAFPRS--EPQSPTEELSEAETESKPQTEG 717          
BLAST of SMED30018671 vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:Xenbase;Acc:XB-GENE-5853231])

HSP 1 Score: 59.3066 bits (142), Expect = 2.727e-8
Identity = 51/178 (28.65%), Postives = 79/178 (44.38%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTMATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSD----YKGIKGPST-LDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKK-KWNLLMDKISDKFPDSAKELHSDK 1474
            I NL I  T+  +       H YT Y IK T      L  ++  T      YREF+NL   L + +D     K IKGP   L ++   N    ++  RK  LE +L+ +   P + N+E V  FL +   +     ++PF +S      +I K   N ++D +   FP S  +  +D+
Sbjct:  386 IQNLRITGTITAKEHSGTGSHPYTLYTIKVTIQSLGSLQPMAYHTVNRR--YREFLNLQTRLEERADLRKFVKHIKGPKKFLPELPFGNMDSDKVEARKSLLETFLRQLCAVPEVANSEEVQEFLALNTDARIAFVKKPFFVS------RIDKIVVNAIVDTLKTAFPRSEPQSPTDE 555          
BLAST of SMED30018671 vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:Xenbase;Acc:XB-GENE-5853231])

HSP 1 Score: 56.6102 bits (135), Expect = 1.710e-7
Identity = 52/179 (29.05%), Postives = 81/179 (45.25%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM-ATPLHQLX-XXXXXXXXXYREFVNLHHTLSDLSD----YKGIKGPST-LDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDK 1474
            I NL I  T+  +       H YT Y IK+   + +  L  L      T +RRYREF+NL   L + +D     K IKGP   L ++   N    ++  RK  LE +L+ +   P + N+E V  FL +   +     ++PF +S        K   N ++D +   FP S  +  +D+
Sbjct:  482 IQNLRITGTITAKEHSGTGSHPYTLYTIKYDTVLDSQSLGSLQPMAYHTVNRRYREFLNLQTRLEERADLRKFVKHIKGPKKFLPELPFGNMDSDKVEARKSLLETFLRQLCAVPEVANSEEVQEFLALNTDARIAFVKKPFFVSRID-----KIVVNAIVDTLKTAFPRSEPQSPTDE 655          
BLAST of SMED30018671 vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:Xenbase;Acc:XB-GENE-5853231])

HSP 1 Score: 56.6102 bits (135), Expect = 1.753e-7
Identity = 52/179 (29.05%), Postives = 81/179 (45.25%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM-ATPLHQLX-XXXXXXXXXYREFVNLHHTLSDLSD----YKGIKGPST-LDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDK 1474
            I NL I  T+  +       H YT Y IK+   + +  L  L      T +RRYREF+NL   L + +D     K IKGP   L ++   N    ++  RK  LE +L+ +   P + N+E V  FL +   +     ++PF +S        K   N ++D +   FP S  +  +D+
Sbjct:  479 IQNLRITGTITAKEHSGTGSHPYTLYTIKYDTVLDSQSLGSLQPMAYHTVNRRYREFLNLQTRLEERADLRKFVKHIKGPKKFLPELPFGNMDSDKVEARKSLLETFLRQLCAVPEVANSEEVQEFLALNTDARIAFVKKPFFVSRID-----KIVVNAIVDTLKTAFPRSEPQSPTDE 652          
BLAST of SMED30018671 vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:Xenbase;Acc:XB-GENE-5853231])

HSP 1 Score: 56.6102 bits (135), Expect = 1.827e-7
Identity = 52/179 (29.05%), Postives = 81/179 (45.25%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM-ATPLHQLX-XXXXXXXXXYREFVNLHHTLSDLSD----YKGIKGPST-LDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDK 1474
            I NL I  T+  +       H YT Y IK+   + +  L  L      T +RRYREF+NL   L + +D     K IKGP   L ++   N    ++  RK  LE +L+ +   P + N+E V  FL +   +     ++PF +S        K   N ++D +   FP S  +  +D+
Sbjct:  476 IQNLRITGTITAKEHSGTGSHPYTLYTIKYDTVLDSQSLGSLQPMAYHTVNRRYREFLNLQTRLEERADLRKFVKHIKGPKKFLPELPFGNMDSDKVEARKSLLETFLRQLCAVPEVANSEEVQEFLALNTDARIAFVKKPFFVSRID-----KIVVNAIVDTLKTAFPRSEPQSPTDE 649          
BLAST of SMED30018671 vs. Ensembl Mouse
Match: Snx19 (sorting nexin 19 [Source:MGI Symbol;Acc:MGI:1921581])

HSP 1 Score: 59.3066 bits (142), Expect = 1.868e-8
Identity = 59/217 (27.19%), Postives = 94/217 (43.32%), Query Frame = 2
Query:  923 SFKNKDQSESPKIDLLHSISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIESN 1525
            SF++    + P +     I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L +  D     K +KGP  L   +   N    R+  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++    +E  P  E  
Sbjct:  522 SFESLSSPDGPVV-----IQNLRITGTITAREHSGTGFHPYTLYTVKYETVLNGENSSGLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPFGNMDSDRVEARKSLLESFLKQLCAIPEIGNSEEVQEFLALNTDARIAFVKKPFMVS------RIDKMVVSAIVDTLKTAFPRS--EPQSPTEELSEAENESKPQTEGK 723          
BLAST of SMED30018671 vs. UniProt/SwissProt
Match: sp|Q92543|SNX19_HUMAN (Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 3.727e-8
Identity = 57/198 (28.79%), Postives = 87/198 (43.94%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIES 1522
            I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L +  D     K +KGP  L   + L N    R+  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++     E  P  E 
Sbjct:  530 IQNLRITGTITAREHSGTGFHPYTLYTVKYETALDGENSSGLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPLGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVS------RIDKMVVSAIVDTLKTAFPRS--EPQSPTEELSEAETESKPQTEG 717          
BLAST of SMED30018671 vs. UniProt/SwissProt
Match: sp|Q6P4T1|SNX19_MOUSE (Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.307e-7
Identity = 59/217 (27.19%), Postives = 94/217 (43.32%), Query Frame = 2
Query:  923 SFKNKDQSESPKIDLLHSISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIESN 1525
            SF++    + P +     I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L +  D     K +KGP  L   +   N    R+  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++    +E  P  E  
Sbjct:  522 SFESLSSPDGPVV-----IQNLRITGTITAREHSGTGFHPYTLYTVKYETVLNGENSSGLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPFGNMDSDRVEARKSLLESFLKQLCAIPEIGNSEEVQEFLALNTDARIAFVKKPFMVS------RIDKMVVSAIVDTLKTAFPRS--EPQSPTEELSEAENESKPQTEGK 723          
BLAST of SMED30018671 vs. TrEMBL
Match: A0A3B4A731 (Sorting nexin 19b OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.126e-6
Identity = 58/210 (27.62%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  887 SSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKS--GHQYTAYIIKFTCTMATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKK-KWNLLMDKISDKFPDSAKELHSDKDD 1480
            S   +T  L++ SF+     E P I     I NL I  T+   + +    H YT Y IK      T + Q++         Y EF+NL   L + +D     KG+KGP  +   M   N    +I  RK  LE +LK +   P + N+E +  FL +   +     ++PF      + ++I K   N ++D +   FP S  +  +D  D
Sbjct:  468 SPSQMTSPLALFSFEPLSSPEGPVI-----IQNLRITGTITAKEHRGTGSHPYTLYTIKAGSENPTAVQQIAYHMVNRR--YSEFLNLQTRLEERADLRKLIKGVKGPKKIFPDMPFGNMDSDKIEARKGLLETFLKQLCAIPEIANSEEMQEFLALNTDARIAFVKKPF------ITSRIDKIVVNAIVDTLKTAFPRSEPQSPTDDTD 664          
BLAST of SMED30018671 vs. TrEMBL
Match: U3JSJ7 (Sorting nexin 19 OS=Ficedula albicollis OX=59894 GN=SNX19 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.856e-6
Identity = 66/226 (29.20%), Postives = 97/226 (42.92%), Query Frame = 2
Query:  890 SVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKK-KWNLLMDKISDKFPDS-----AKELHSDKDDIVSDRDEK 1504
            S S T S+S  SF+     E P +     I NL I  T+  R       H YT Y +K+   +    A  L Q++  T      YREF+NL   L +  +     K IKGP  L   +   N    ++  RK  LE++LK +   P + N+E V  FL +   +     ++PF +S      +I K   N ++D +   FP S      +EL   + D  S  D K
Sbjct:  444 SSSPTASMSTFSFEPLSSPEGPVV-----IQNLRITGTITAREHSGTGFHPYTLYTVKYETVLESEAAGSLQQVAYHTVNRR--YREFLNLQTRLEEKPELRKFLKNIKGPKKLFPDLPFGNMDSDKVEARKSLLESFLKQLCAVPEIANSEEVQEFLALNTDARIAFVKKPFVVS------RIDKIVVNAIVDTLKTAFPRSEPQSPTEELSESEVDGKSQTDGK 656          
BLAST of SMED30018671 vs. TrEMBL
Match: S7P625 (Sorting nexin-19 OS=Myotis brandtii OX=109478 GN=D623_10007758 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.984e-6
Identity = 57/199 (28.64%), Postives = 87/199 (43.72%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFTCTM----ATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIESN 1525
            I NL I  T+  R       H YT Y +K+   +    ++ L QL+  T      YREF+NL   L + SD     K +KGP  L   +   N    R+  RK  LE++LK +   P + N+E +  FL +   +     ++PF +S      +I K   N ++D +   FP S  E  S  +++     E  P  E  
Sbjct:  542 IQNLRITGTITAREHSGTGSHPYTLYTVKYETALDSENSSNLQQLAYHTVNRR--YREFLNLQTRLEEKSDLRKFIKNVKGPKKLFPDLPFGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEMQEFLALNTDARIAFVKKPFMVS------RIDKMVVNAIVDTLKTAFPRS--EPQSPTEELSEAETESKPQTEGK 730          
BLAST of SMED30018671 vs. TrEMBL
Match: A0A250Y690 (Sorting nexin-19 OS=Castor canadensis OX=51338 GN=SNX19 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.583e-6
Identity = 56/198 (28.28%), Postives = 89/198 (44.95%), Query Frame = 2
Query:  977 ISNLSIINTVRNTDVKSG--HQYTAYIIKFTCTMA----TPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKKK-WNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIES 1522
            I NL I  T+   +   G  H YT Y +K+  +++    + L QL+  T      YREF+NL   L +  D     K +KGP  L   +   N    R+  RK  LE++LK +   P + N+E +  FL +   +     ++PF +S      +I K   N ++D +   FP S  E  S  +++    +E  P  E 
Sbjct:  528 IQNLRITGTITAREHSGGGSHPYTLYTVKYETSLSGENSSSLQQLAYHTVNRR--YREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPFGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEMQEFLALNTDARIAFVKKPFMVS------RIDKMVVNAIVDTLKTAFPRS--EPQSPTEELSEAENESKPQTEG 715          
BLAST of SMED30018671 vs. TrEMBL
Match: A0A340XC88 (sorting nexin-19 OS=Lipotes vexillifer OX=118797 GN=SNX19 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.894e-6
Identity = 58/199 (29.15%), Postives = 88/199 (44.22%), Query Frame = 2
Query:  977 ISNLSIINTV--RNTDVKSGHQYTAYIIKFT----CTMATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSS----AERPFEISSTPLNAKIKK-KWNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIESN 1525
            I NL I  T+  R       H YT Y +K+     C  ++ L QL+  T      YREF+NL   L + SD     K +KGP  L   +   N    R+  RK  LE++LK +   P + N+E +  FL +   +     ++PF +S      +I K   + ++D +   FP S  E  S  +++     E  P  ES 
Sbjct:  543 IQNLRITGTITSREHSGTGFHLYTLYTVKYETALDCESSSGLQQLAYHTVNRR--YREFLNLQARLEEKSDLRKFIKNVKGPKKLFPDLPFGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEMQEFLALNTDARIAFVKKPFMVS------RIDKVVVSAIVDTLKTAFPRS--EPQSPTEELSEAETESKPQPESK 731          
BLAST of SMED30018671 vs. Ensembl Cavefish
Match: snx19b (sorting nexin-19 [Source:NCBI gene;Acc:103036172])

HSP 1 Score: 53.9138 bits (128), Expect = 7.608e-7
Identity = 65/249 (26.10%), Postives = 103/249 (41.37%), Query Frame = 2
Query:  824 TKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINS------------FKNKDQSESPKIDLLHSISNLSIINTVRNTDVKS--GHQYTAYIIKFTCTMAT--PLHQLXXXXXXXXXXYREFVNLHHTLSDLSDY----KGIKGPSTL-DQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKI 1507
            TK DT ++E    D +       + LT+SL   S            F+     E P +     I NL I  T+   + +    H YT Y +K+   M +  P         T SRRY EF+NL   L +  +     K +KGP  +   +   N    ++  RK  LE +LK +   P   N+E +  FL +  + A   F      ++   K   N+++D +   FP S  E  S  D++ ++ D K+
Sbjct:  473 TKMDTELMEA---DQSGALNPCELPLTDSLQATSPSAGAMPLSPFAFEPLSSPEGPVV-----IQNLRITGTITAKEHRGTGSHPYTLYTVKYETAMDSENPGTLQPVAYHTVSRRYSEFLNLQTRLEEKPELRKILKHVKGPKKIFPDLPFGNMDSDKVEARKSLLETFLKQLCAIPETANSEEMQEFLAL-NTDARIAFVKKPCIVSRIDKMVVNVIVDTLKTAFPRS--EPQSPTDEVDTEPDGKL 710          
BLAST of SMED30018671 vs. Planmine SMEST
Match: SMESG000074458.1 (SMESG000074458.1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 480/482 (99.59%), Postives = 481/482 (99.79%), Query Frame = 2
Query:   29 MKEWLIFSKYISYIICGLLIVAYYLDCFPVIHTFFVXXXXXXXXXXXXXXXXXVKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPKLLDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDK 1474
            MKEWLIFSKYISYIICGLLIVAYYLDCFPVIHTFFVLSFMTFIFSLTTIFTLIVKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPK+LDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLSSITRTTSRRYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHS K
Sbjct:    1 MKEWLIFSKYISYIICGLLIVAYYLDCFPVIHTFFVLSFMTFIFSLTTIFTLIVKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPKILDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLSSITRTTSRRYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSIK 482          

HSP 2 Score: 53.9138 bits (128), Expect = 3.733e-7
Identity = 26/27 (96.30%), Postives = 26/27 (96.30%), Query Frame = 3
Query: 1470 IKMISCQIGMRKFQLSNRMILRMKLIK 1550
            IKMISCQIGMRKFQL NRMILRMKLIK
Sbjct:  481 IKMISCQIGMRKFQLPNRMILRMKLIK 507          
BLAST of SMED30018671 vs. Planmine SMEST
Match: SMESG000074458.1 (SMESG000074458.1)

HSP 1 Score: 835.869 bits (2158), Expect = 0.000e+0
Identity = 427/429 (99.53%), Postives = 428/429 (99.77%), Query Frame = 2
Query:  188 VKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPKLLDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLXXXXXXXXXXYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSDK 1474
            VKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPK+LDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLSSITRTTSRRYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHS K
Sbjct:   15 VKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSKRLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLNYSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPKILDEEDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQEYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSFKNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMATPLHQLSSITRTTSRRYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFSPARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISSTPLNAKIKKKWNLLMDKISDKFPDSAKELHSIK 443          

HSP 2 Score: 54.299 bits (129), Expect = 3.087e-7
Identity = 26/27 (96.30%), Postives = 26/27 (96.30%), Query Frame = 3
Query: 1470 IKMISCQIGMRKFQLSNRMILRMKLIK 1550
            IKMISCQIGMRKFQL NRMILRMKLIK
Sbjct:  442 IKMISCQIGMRKFQLPNRMILRMKLIK 468          
BLAST of SMED30018671 vs. Planmine SMEST
Match: SMESG000074460.1 (SMESG000074460.1)

HSP 1 Score: 399.053 bits (1024), Expect = 9.094e-135
Identity = 215/228 (94.30%), Postives = 215/228 (94.30%), Query Frame = 2
Query: 1673 MLMSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGPVLTRTGGFLAQWEKVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRXXXXXXXXXXXXXXXXRDVFNSTK 2356
            MLMSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGP             KVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRLFLFQLIQIIIEEHLFRDVFNSTK
Sbjct:    1 MLMSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGP-------------KVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRLFLFQLIQIIIEEHLFRDVFNSTK 215          
BLAST of SMED30018671 vs. Planmine SMEST
Match: SMESG000074460.1 (SMESG000074460.1)

HSP 1 Score: 394.43 bits (1012), Expect = 5.823e-133
Identity = 213/226 (94.25%), Postives = 213/226 (94.25%), Query Frame = 2
Query: 1679 MSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGPVLTRTGGFLAQWEKVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRXXXXXXXXXXXXXXXXRDVFNSTK 2356
            MSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGP             KVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRLFLFQLIQIIIEEHLFRDVFNSTK
Sbjct:    1 MSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPIEYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGP-------------KVFWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAFAMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQSNRLFLFQLIQIIIEEHLFRDVFNSTK 213          
The following BLAST results are available for this feature:
BLAST of SMED30018671 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SNX197.761e-928.79sorting nexin 19 [Source:HGNC Symbol;Acc:HGNC:2153... [more]
SNX198.955e-928.79sorting nexin 19 [Source:HGNC Symbol;Acc:HGNC:2153... [more]
back to top
BLAST of SMED30018671 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gtpbp102.727e-828.65GTP-binding protein 10 (putative) [Source:Xenbase;... [more]
gtpbp101.710e-729.05GTP-binding protein 10 (putative) [Source:Xenbase;... [more]
gtpbp101.753e-729.05GTP-binding protein 10 (putative) [Source:Xenbase;... [more]
gtpbp101.827e-729.05GTP-binding protein 10 (putative) [Source:Xenbase;... [more]
back to top
BLAST of SMED30018671 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Snx191.868e-827.19sorting nexin 19 [Source:MGI Symbol;Acc:MGI:192158... [more]
back to top
BLAST of SMED30018671 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q92543|SNX19_HUMAN3.727e-828.79Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 ... [more]
sp|Q6P4T1|SNX19_MOUSE1.307e-727.19Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19... [more]
back to top
BLAST of SMED30018671 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4A7311.126e-627.62Sorting nexin 19b OS=Periophthalmus magnuspinnatus... [more]
U3JSJ72.856e-629.20Sorting nexin 19 OS=Ficedula albicollis OX=59894 G... [more]
S7P6252.984e-628.64Sorting nexin-19 OS=Myotis brandtii OX=109478 GN=D... [more]
A0A250Y6903.583e-628.28Sorting nexin-19 OS=Castor canadensis OX=51338 GN=... [more]
A0A340XC884.894e-629.15sorting nexin-19 OS=Lipotes vexillifer OX=118797 G... [more]
back to top
BLAST of SMED30018671 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snx19b7.608e-726.10sorting nexin-19 [Source:NCBI gene;Acc:103036172][more]
back to top
BLAST of SMED30018671 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018671 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000074458.13.733e-799.59SMESG000074458.1[more]
SMESG000074458.13.087e-799.53SMESG000074458.1[more]
SMESG000074460.19.094e-13594.30SMESG000074460.1[more]
SMESG000074460.15.823e-13394.25SMESG000074460.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018671 ID=SMED30018671|Name=SMED30018671|organism=Schmidtea mediterranea sexual|type=transcript|length=2442bp
AATCTATATAAATCTTATATGACTGCTAATGAAGGAATGGTTGATATTTT
CCAAATATATATCATATATTATCTGTGGACTTTTAATAGTTGCATATTAT
TTAGATTGTTTTCCGGTTATTCATACATTTTTTGTCCTTAGCTTTATGAC
ATTTATATTTTCTCTTACAACAATCTTTACATTAATCGTCAAGAAAAATG
GATTAATATTTATAATAAGTAATTTGTACATTGATGCTAGACGTTTTGCA
ATTAAAACTGCCAGCAATATTTATAACCAAAGTCTACCTAATTCGATTAT
TAAAGATGGAGAAATTAAAATGTCAAAAAGACTGCGTAAAATTCGCGAAT
GCATAATATTTAACTATATATCATCTTGGTGGAATTATATATCACCAAAT
AATAATTTTGAAATACTATGCCGTTATAAAATATCAAAAGTTCTCGAAGT
TTTAGCAGAAAAATTTAAATTACTAAATTACAGTAACTTGATTCTTACTG
TAATTCGACTGAAAGTTGGAATGGCGAGAAATAGAAACAGTAGTCTAATG
AAAAAAATATCTGAAGTCGATCAAGAGAAATATTTTTCATCTGCAATTTT
CGAAATTCTACCGAAATTACTTGATGAAGAAGACGTAAATCTAACTGAAT
TGCGTGAATTTCTCTCTGAAATGCTCTCGATCTCTGTATTTGTGCCTCTA
TTAGATCTCATCCAATCGCCAACTATTATATTCAACAGTGTCATTGCACT
TCTTGTCAGAGACCAAGACGACATTCAGGAATATGTGACAAAAGTCCACG
AATTGCGTCTATCGAAACAAATGACGAAGAAGGATACACCGATTATTGAA
ATGCTGTTCCTCGACGATACGACTAAAAGCGGAAATTCCAGCGTTTCATT
GACGGAAAGTCTGTCGATTAACAGTTTTAAAAATAAAGACCAATCAGAAT
CTCCAAAAATAGATTTGCTGCACTCCATTTCAAATCTGAGTATCATAAAT
ACCGTACGCAATACCGATGTTAAATCAGGCCACCAATATACAGCATATAT
TATAAAGTTTACCTGTACTATGGCAACACCTCTCCATCAGCTGTCATCTA
TCACTCGTACAACATCACGGAGATATCGCGAATTTGTAAACCTCCACCAC
ACCTTATCAGATCTATCCGATTATAAAGGAATCAAAGGTCCAAGCACATT
AGATCAAATGTTATTGCACAATTTTTCACCGGCCAGAATTAATGTGAGAA
AAGAATTTTTAGAGAATTATCTGAAAACAATTGTCATTAAACCTGGACTA
TTGAACAATGAAAACGTTCATAGGTTCTTGGGAATATTTCAGTCCTCAGC
AGAAAGACCTTTTGAAATATCGAGTACACCGCTAAATGCAAAAATCAAGA
AAAAGTGGAATTTATTAATGGACAAAATCAGTGACAAGTTTCCAGATTCT
GCCAAAGAACTCCATTCCGATAAAGATGATATCGTGTCAGATAGGGATGA
GAAAATTCCAACTATCGAATCGAATGATCCTCAGGATGAAATTAATAAAA
TAATTTCGTCCCTCTCTAAATTATCCTGCCATCAGAATCCTGCATTTCCT
TCTCGAATTCCAGAATTTGAGTATCAACATTCCCTAATTCAAGCCAACTA
CCGATATTTGACAGATAATTATATGCTGATGAGCCAATGTCGTCCTACTG
CTGCCGTTTATAATTGTACAAAACCACATCAGAATTCTAACATTGCTACT
CCCTCGTCCATATCAGTCCATAATCCATCTGCTTCGCTTACTCACAGATT
TCCAATCTCATATAAAAGCGGGCCAATAGAATATGGTCCTAATGATCCAG
TGCCATTTTTGTTGGGTTTTCGGCTACTTGCCATGCAATATCGTGACAGT
ACTTGTCGAAACTGGTCGCCAAATGAAGGACCGGTTTTAACCCGTACTGG
GGGTTTTCTTGCCCAATGGGAGAAAGTATTTTGGAAAATCCTCGGTTGTC
CAGCTGATGCAATTATTCAGTGGTCATTTGAAGACCTGTTACGAGCCAGT
TATGTTGCTGACTATTTGGAATTGTTCCAAGAGTTATTATGGCCATCAGG
TAAAAGTAGCAAAAGTCTGGCTGCATTTGCAATGAAAGCAGATCCTGTAC
TCTTGCAACAAGCCGCAACACAGTCAATTGTCGACGCTATACCAAATGTC
GCTTATTTATTTGTAAAAAAAGATGATTTGATAGACTTAATTGATGCAGT
TTTGTCAGACTTTCAAGATCCTCAATCTAATAGATTATTTTTGTTCCAAT
TGATTCAAATCATCATTGAAGAACACTTGTTTCGTGATGTATTTAATTCA
ACTAAATAATAAAACTATTCACCAAAATAACAAAACTGTTTTTTTTATTT
TGTGAGAAAATATCGCTTGTTCGTTTTCGTACGATAAATACT
back to top

protein sequence of SMED30018671-orf-1

>SMED30018671-orf-1 ID=SMED30018671-orf-1|Name=SMED30018671-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=777bp
MKEWLIFSKYISYIICGLLIVAYYLDCFPVIHTFFVLSFMTFIFSLTTIF
TLIVKKNGLIFIISNLYIDARRFAIKTASNIYNQSLPNSIIKDGEIKMSK
RLRKIRECIIFNYISSWWNYISPNNNFEILCRYKISKVLEVLAEKFKLLN
YSNLILTVIRLKVGMARNRNSSLMKKISEVDQEKYFSSAIFEILPKLLDE
EDVNLTELREFLSEMLSISVFVPLLDLIQSPTIIFNSVIALLVRDQDDIQ
EYVTKVHELRLSKQMTKKDTPIIEMLFLDDTTKSGNSSVSLTESLSINSF
KNKDQSESPKIDLLHSISNLSIINTVRNTDVKSGHQYTAYIIKFTCTMAT
PLHQLSSITRTTSRRYREFVNLHHTLSDLSDYKGIKGPSTLDQMLLHNFS
PARINVRKEFLENYLKTIVIKPGLLNNENVHRFLGIFQSSAERPFEISST
PLNAKIKKKWNLLMDKISDKFPDSAKELHSDKDDIVSDRDEKIPTIESND
PQDEINKIISSLSKLSCHQNPAFPSRIPEFEYQHSLIQANYRYLTDNYML
MSQCRPTAAVYNCTKPHQNSNIATPSSISVHNPSASLTHRFPISYKSGPI
EYGPNDPVPFLLGFRLLAMQYRDSTCRNWSPNEGPVLTRTGGFLAQWEKV
FWKILGCPADAIIQWSFEDLLRASYVADYLELFQELLWPSGKSSKSLAAF
AMKADPVLLQQAATQSIVDAIPNVAYLFVKKDDLIDLIDAVLSDFQDPQS
NRLFLFQLIQIIIEEHLFRDVFNSTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001683Phox
IPR003114Phox_assoc
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding