Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30018665
Length (bp)950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30018665) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30018665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30018665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30018665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30018665SMESG000073695.1 SmedASXL_068049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018665SMESG000073695.1 Contig37877newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018665SMESG000073695.1 Contig37877uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30018665SMESG000073695.1 Contig37877newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30018665SMESG000073695.1 Contig37877uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30018665SMESG000073695.1 dd_Smed_v4_12033_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: CD82 (CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210])

HSP 1 Score: 70.8626 bits (172), Expect = 1.668e-13
Identity = 39/139 (28.06%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSC---CESDIESELRSCFNEQK--------------YYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +NS+   +L++A DY+Q   +CCG  ++ NW ++   ++R +  +  P SC    E D    +R  F E                 Y+ GC ++++ +L+  + II+GV +G+A+ E+L +V ++CLC +  +  +S V
Sbjct:  128 YNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPE--VTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKV 264          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD82 (CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210])

HSP 1 Score: 70.4774 bits (171), Expect = 1.790e-13
Identity = 39/139 (28.06%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSC---CESDIESELRSCFNEQK--------------YYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +NS+   +L++A DY+Q   +CCG  ++ NW ++   ++R +  +  P SC    E D    +R  F E                 Y+ GC ++++ +L+  + II+GV +G+A+ E+L +V ++CLC +  +  +S V
Sbjct:  103 YNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPE--VTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKV 239          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 68.1662 bits (165), Expect = 2.781e-13
Identity = 37/114 (32.46%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            NYP  N T++      +D +Q  F+CCG   Y +WE     +S+N      P SCC  ++       FNE+  +K GC +++  +L+  + ++    +GIA  E+L +VFA CL
Sbjct:   43 NYPKNNHTAS-----ILDRMQADFKCCGAANYTDWEKIP-SMSKN----RVPDSCC-INVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCL 145          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 68.1662 bits (165), Expect = 2.781e-13
Identity = 37/114 (32.46%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            NYP  N T++      +D +Q  F+CCG   Y +WE     +S+N      P SCC  ++       FNE+  +K GC +++  +L+  + ++    +GIA  E+L +VFA CL
Sbjct:   43 NYPKNNHTAS-----ILDRMQADFKCCGAANYTDWEKIP-SMSKN----RVPDSCC-INVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCL 145          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 67.781 bits (164), Expect = 2.805e-13
Identity = 37/114 (32.46%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            NYP  N T++      +D +Q  F+CCG   Y +WE     +S+N      P SCC  ++       FNE+  +K GC +++  +L+  + ++    +GIA  E+L +VFA CL
Sbjct:   32 NYPKNNHTAS-----ILDRMQADFKCCGAANYTDWE-KIPSMSKN----RVPDSCC-INVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCL 134          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-15 (Tetraspanin-15 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVM9])

HSP 1 Score: 48.9062 bits (115), Expect = 1.505e-6
Identity = 31/112 (27.68%), Postives = 53/112 (47.32%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKN---WENSTWYISRNDSFMETPSSCCESDIESELRSC----FNEQK---YYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEIL 775
            + +   + +  + D +Q  F+CCGV    N   W+ S WY+ +    +  P SCC   I SE+  C    F++     YY   C + L+N L + M +   + I  A+ +I+
Sbjct:  136 YGTHDMKGITESWDALQSNFKCCGVNGTDNAQIWKTSKWYMHQRAPKLLIPESCC---IPSEIERCRSNPFDQDAPPPYYTSTCYEPLQNDLLHVMNVASWLCITNAIVQII 244          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp39D (gene:FBgn0032943 transcript:FBtr0273404)

HSP 1 Score: 57.3806 bits (137), Expect = 2.671e-9
Identity = 37/116 (31.90%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDY------IQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            FNST  Q+ K   DY      +Q    CCG+    +WE     + RN +    P++CC     SE + C N     + GC  +L   L  K  I+  V++G+A  ++L ++FA CL
Sbjct:  118 FNSTM-QHYKERADYRDAWTLLQTELDCCGINGPNDWET----VYRNSTL---PAACCSVINLSEAKECTNTHAT-QHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCL 224          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp47F (gene:FBgn0033629 transcript:FBtr0088151)

HSP 1 Score: 55.0694 bits (131), Expect = 1.593e-8
Identity = 87/252 (34.52%), Postives = 134/252 (53.17%), Query Frame = 2
Query:   80 CGAKFSKYTVFLFNILFWITGLIFIVLGSIYLT-TGGFKSFEE--VITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESD-IESELRSCF-----NEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNN 808
            CG    KY +F FN+LF I+GL  ++ G++ L     F  F E  V+ P           +I  G I+F++   GC GAI+ES  LL T+ VLL +I IVE++ GI A+V +K++   ++ SL++SI          SN     A D IQ+   CCGV +  +W      +S N +    P SCC+   I+S +  C       + KY+++GC  +L++ ++    I++GV IGIA  +IL +V A  L N+
Sbjct:    4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPP--------IVLIVTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESI--------KRSNSEDTMAWDNIQQKLMCCGVDSPADWRT----LSANKTL---PGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANS 232          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 52.373 bits (124), Expect = 1.478e-7
Identity = 71/262 (27.10%), Postives = 124/262 (47.33%), Query Frame = 2
Query:   98 KYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTW-----------YISRNDSFMETPSSCCESDI---ESELRSCFN-----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQH 826
            KY + L NILFW+ GL  IV+ S+++ T    +F   +T N  ++   +Y  + +G ++ +  F GCCG  RES+ LL ++  ++L++M+ +I+ G +A   + ++   +  +++ S+ + Y     +S        D +QK  +CCG     +W  S +            +S  + F   P SCC+ ++   E EL              Y+ GC D+L   +      I  V   + L E+L + FA+ LC    N QH
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTD--PTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR---TVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRN-QH 265          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0084912)

HSP 1 Score: 52.373 bits (124), Expect = 1.478e-7
Identity = 71/262 (27.10%), Postives = 124/262 (47.33%), Query Frame = 2
Query:   98 KYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTW-----------YISRNDSFMETPSSCCESDI---ESELRSCFN-----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQH 826
            KY + L NILFW+ GL  IV+ S+++ T    +F   +T N  ++   +Y  + +G ++ +  F GCCG  RES+ LL ++  ++L++M+ +I+ G +A   + ++   +  +++ S+ + Y     +S        D +QK  +CCG     +W  S +            +S  + F   P SCC+ ++   E EL              Y+ GC D+L   +      I  V   + L E+L + FA+ LC    N QH
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTD--PTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR---TVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRN-QH 265          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 51.9878 bits (123), Expect = 2.037e-7
Identity = 72/262 (27.48%), Postives = 123/262 (46.95%), Query Frame = 2
Query:   98 KYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTW-----------YISRNDSFMETPSSCCES---DIESELRSCFN-----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQH 826
            KY + L NILFW+ GL  IV+ S+++ T    +F   +T N  ++   +Y  + +G ++ +  F GCCG  RES+ LL ++  ++L++M+ +I+ G +A   + ++   +  +++ S+ + Y     +S        D +QK  +CCG     +W  S +            +S  + F   P SCC+    D E EL              Y+ GC D+L   +      I  V   + L E+L + FA+ LC    N QH
Sbjct:   11 KYLMVLINILFWLIGLT-IVVTSVWMLTD--PTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR---TVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRN-QH 265          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 65.4698 bits (158), Expect = 7.414e-12
Identity = 32/112 (28.57%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            +N +  +++  A+D +Q+ F+CCG  +  +W +S W  S        P SCC+S +        +    YK+  GC  +L N++   + II  V +G+A  +I+ + F  CL
Sbjct:  134 YNQSEQEHVTKAVDKLQQEFKCCGSNSSSDWVDSAWIRSSEADGRLVPDSCCKSPVRKFCGRRDHPSNIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCCL 245          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 62.7734 bits (151), Expect = 5.325e-11
Identity = 35/133 (26.32%), Postives = 71/133 (53.38%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESEL-------RSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            NYP  N T+ Q    A DY+Q+T +CCG     +W+ +  +I +N++    P SC    I++ +       ++  ++   Y+ GC + + ++L     II+G+ +G+A+ E+L ++ ++ LC +     ++ V
Sbjct:  127 NYPGQNKTAEQ----AWDYLQRTMQCCGWNGRMDWDEN--HIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQEDYTKV 253          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 62.7734 bits (151), Expect = 5.325e-11
Identity = 35/133 (26.32%), Postives = 71/133 (53.38%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESEL-------RSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            NYP  N T+ Q    A DY+Q+T +CCG     +W+ +  +I +N++    P SC    I++ +       ++  ++   Y+ GC + + ++L     II+G+ +G+A+ E+L ++ ++ LC +     ++ V
Sbjct:  127 NYPGQNKTAEQ----AWDYLQRTMQCCGWNGRMDWDEN--HIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQEDYTKV 253          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 62.7734 bits (151), Expect = 5.325e-11
Identity = 35/133 (26.32%), Postives = 71/133 (53.38%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESEL-------RSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            NYP  N T+ Q    A DY+Q+T +CCG     +W+ +  +I +N++    P SC    I++ +       ++  ++   Y+ GC + + ++L     II+G+ +G+A+ E+L ++ ++ LC +     ++ V
Sbjct:  127 NYPGQNKTAEQ----AWDYLQRTMQCCGWNGRMDWDEN--HIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQEDYTKV 253          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 62.003 bits (149), Expect = 1.145e-10
Identity = 34/119 (28.57%), Postives = 60/119 (50.42%), Query Frame = 2
Query:  461 YPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYI-SRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFA-VCLCNNT 811
            Y  +N T+      AIDY+Q+   CCG+  + +W N+ W+  S+N+S    P SCC+ ++ +   S  +    Y  GC + +   LK  M  ++   +  A  ++L ++ A V LC  +
Sbjct:  123 YNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNS---VPLSCCKPNVSNCTGSLLHPGDLYPEGCEELVVKKLKEIMMYVIWAALTFAAIQMLGMLCACVVLCRRS 238          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: sertad4 (SERTA domain containing 4 [Source:Xenbase;Acc:XB-GENE-943347])

HSP 1 Score: 68.1662 bits (165), Expect = 1.004e-12
Identity = 35/124 (28.23%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRN--DSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +N+T +     A+D IQ+T +CCGV +Y  W  + +Y +     S    P +C E+D++   ++     K +K GC   +   ++ +M ++ G+  GIA F+++ +  A CL     N Q+  V
Sbjct:  133 YNATGDPR-SQAVDTIQRTLQCCGVNSYNEWGQTQYYKTHGIPQSCCRVPGNCSEADMKDLGKA---GGKVFKQGCISLVTTVMESRMGVVAGISFGIACFQLVGMFLACCLSRYITNNQYEMV 252          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan7 (tetraspanin 7 [Source:NCBI gene;Acc:394976])

HSP 1 Score: 65.0846 bits (157), Expect = 1.040e-11
Identity = 37/113 (32.74%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  473 NSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIE---SELRS-CFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            N   N     A+D +Q++ RCCGV+ Y NW  S ++   +  F   PSSCC +  +    +LR+   N  K  + GC + + ++++  M II GV  GIA  +++ ++ A CL
Sbjct:  116 NYNGNDERSQAVDDVQRSLRCCGVQYYTNWTTSLYW--HDHGF---PSSCCANTSDCNPQDLRNMTINFTKVNQRGCYELVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCL 223          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan7 (tetraspanin 7 [Source:NCBI gene;Acc:394976])

HSP 1 Score: 65.4698 bits (158), Expect = 1.047e-11
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  473 NSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIE---SELRS-CFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            N   N     A+D +Q++ RCCGV+ Y NW  S ++   +  F   PSSCC +  +    +LR+   N  K  + GC + + ++++  M II GV  GIA  +++ ++ A CL       Q+  V
Sbjct:  130 NYNGNDERSQAVDDVQRSLRCCGVQYYTNWTTSLYW--HDHGF---PSSCCANTSDCNPQDLRNMTINFTKVNQRGCYELVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV 249          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 65.0846 bits (157), Expect = 1.566e-11
Identity = 35/125 (28.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN---EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +    N + +   DYIQ   RCCG   Y+NW  +T      +S  + P SC ++         +N   E   Y+ GC   + ++L+  + II+GV +G+A+ E+L ++ ++CLC +  +  ++ V
Sbjct:  144 YEDGKNTSAETTWDYIQTNLRCCGWTNYQNWTANT---VVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSEDYTKV 265          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 64.6994 bits (156), Expect = 1.875e-11
Identity = 35/125 (28.00%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN---EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +    N + +   DYIQ   RCCG   Y+NW  +T      +S  + P SC ++         +N   E   Y+ GC   + ++L+  + II+GV +G+A+ E+L ++ ++CLC +  +  ++ V
Sbjct:  131 YEDGKNTSAETTWDYIQTNLRCCGWTNYQNWTANT---VVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSEDYTKV 252          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan7 (tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407])

HSP 1 Score: 67.3958 bits (163), Expect = 1.553e-12
Identity = 33/113 (29.20%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  473 NSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            N   N     A+D++Q++  CCGV+ Y NW +S +++         P SCC ++ +       N      K  + GC D + ++++  M II GV  GIA  +++ ++ A CL
Sbjct:  130 NYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHG-----IPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCL 237          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan7 (tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407])

HSP 1 Score: 63.929 bits (154), Expect = 1.608e-11
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 2
Query:  473 NSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEIL 775
            N   N     A+D++Q++  CCGV+ Y NW +S +++         P SCC ++ +       N      K  + GC D + ++++  M II GV  GIA  ++L
Sbjct:  130 NYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHG-----IPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQVL 229          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 62.7734 bits (151), Expect = 6.364e-11
Identity = 29/112 (25.89%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            ++ + ++ + +A+D +Q+ F CCG    ++W++S W  S        P SCC++ +    +   +    YK+  GC  +L  +++  + +I  V IGIA  ++  ++F  CL
Sbjct:  134 YHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKR-DHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCL 244          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 62.7734 bits (151), Expect = 6.364e-11
Identity = 29/112 (25.89%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            ++ + ++ + +A+D +Q+ F CCG    ++W++S W  S        P SCC++ +    +   +    YK+  GC  +L  +++  + +I  V IGIA  ++  ++F  CL
Sbjct:  134 YHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKR-DHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCL 244          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd151 (CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360])

HSP 1 Score: 62.7734 bits (151), Expect = 6.364e-11
Identity = 29/112 (25.89%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            ++ + ++ + +A+D +Q+ F CCG    ++W++S W  S        P SCC++ +    +   +    YK+  GC  +L  +++  + +I  V IGIA  ++  ++F  CL
Sbjct:  134 YHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKR-DHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCL 244          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P27701|CD82_HUMAN (CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.011e-13
Identity = 39/139 (28.06%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSC---CESDIESELRSCFNEQK--------------YYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            +NS+   +L++A DY+Q   +CCG  ++ NW ++   ++R +  +  P SC    E D    +R  F E                 Y+ GC ++++ +L+  + II+GV +G+A+ E+L +V ++CLC +  +  +S V
Sbjct:  128 YNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPE--VTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKV 264          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P08962|CD63_HUMAN (CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 5.447e-12
Identity = 37/114 (32.46%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            NYP  N T++      +D +Q  F+CCG   Y +WE     +S+N      P SCC  ++       FNE+  +K GC +++  +L+  + ++    +GIA  E+L +VFA CL
Sbjct:  125 NYPKNNHTAS-----ILDRMQADFKCCGAANYTDWEKIP-SMSKN----RVPDSCC-INVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCL 227          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q7YQL0|TSN7_PANTR (Tetraspanin-7 OS=Pan troglodytes OX=9598 GN=TSPAN7 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.825e-12
Identity = 32/110 (29.09%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  482 SNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
             N     A+D++Q++  CCGV+ Y NW  S +++         P SCC ++ +   +   N      K  + GC D + ++++  M II GV  GIA  +++ ++ A CL
Sbjct:  128 GNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHG-----IPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCL 232          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P41732|TSN7_HUMAN (Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 1.025e-11
Identity = 32/110 (29.09%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  482 SNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
             N     A+D++Q++  CCGV+ Y NW  S +++         P SCC ++ +   +   N      K  + GC D + ++++  M II GV  GIA  +++ ++ A CL
Sbjct:  133 GNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHG-----IPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCL 237          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q62283|TSN7_MOUSE (Tetraspanin-7 OS=Mus musculus OX=10090 GN=Tspan7 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 1.086e-11
Identity = 33/113 (29.20%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  473 NSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFN----EQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            N   N     A+D++Q++  CCGV+ Y NW +S +++         P SCC ++ +       N      K  + GC D + ++++  M II GV  GIA  +++ ++ A CL
Sbjct:  130 NYNGNDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLDHG-----IPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCL 237          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A3M6V1C7 (Tetraspanin OS=Pocillopora damicornis OX=46731 GN=pdam_00012072 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.856e-16
Identity = 40/116 (34.48%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  467 PFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTG 814
             +     +    AID  Q+   CCGV +  +W+NS WY  ++D     P SCC+   +   +   N    Y+ GCS  L++++K KM ++ G+ +GIA+ +IL VVFA+CL  + G
Sbjct:  128 DYGQEDKKRFTEAIDKAQQELMCCGVSSGADWKNSAWY-KKSDKSESVPESCCKKMTDGCSKG--NSSNIYQEGCSQALQDFVKSKMAVVGGIGVGIAILQILGVVFAICLFRSIG 240          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A3S1CDQ5 (Tetraspanin OS=Elysia chlorotica OX=188477 GN=EGW08_002351 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.764e-15
Identity = 85/260 (32.69%), Postives = 140/260 (53.85%), Query Frame = 2
Query:   74 IGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVI---TPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCC---ESDIESELRSCFNEQKYY-KMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHST 832
            +GC +  ++  +  FN +FW++G   + +G   +     + ++EVI   T +D++     Y +IG G  VF+VGFCGCCGAIR S+ L+G YI+ L+L+   E++ GIY  +   +   K++  L KSI +NY      S   + +A D +QK   CCG   Y +++NSTW  S+ D  +  P SCC     +I      C   + YY   GC +++ ++L     I++GV  GIA  +I+  + AVC C +    ++ +
Sbjct:    1 MGCCSGLARMLLITFNFIFWLSGAAILAVGIWIIVDPEIEDYQEVISDATNDDQFLNTAAYILIGFGAFVFLVGFCGCCGAIRSSKCLIGLYIMFLVLVFAGELAAGIYVAIYSNDASDKLDDGLTKSIQENYK-----SGSKVASAWDVVQKELECCGGNGYGDYDNSTWMASQTDGQL-MPLSCCVLGTDNIPKNATLCQMAKDYYWTDGCREQIEDWLDEHSRILIGVACGIAALQIIGFICAVCFCRHMDKEKYQS 254          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A2B4S9Q7 (Tetraspanin OS=Stylophora pistillata OX=50429 GN=CD151 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.866e-15
Identity = 41/115 (35.65%), Postives = 63/115 (54.78%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTG 814
            +     Q L  AID  Q+   CCGV +  +W+ S W+ S +D     P SCC+       +   N    Y+ GCS  L++++K KM ++ G+ +GIA+ +IL VVFA+CL  + G
Sbjct:  129 YGEKDKQKLTEAIDKAQQELMCCGVSSGADWKTSQWFNS-SDKSESVPESCCKKMAAGCSKG--NSPSIYQEGCSQALQDFVKSKMAVVGGIGVGIAILQILGVVFAICLFRSIG 240          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A091VU43 (Tetraspanin (Fragment) OS=Nipponia nippon OX=128390 GN=Y956_15834 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.076e-13
Identity = 45/139 (32.37%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCES--DIESELRSC-----------FNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            NY P+N+  ++NL++A DY+Q    CCG    K+WEN+   I  N S    P SC  S  DI++E R C           + +   ++ GC D +  +LK  + +I+GV  G+A+ E+L ++ ++ LC N  +  ++ V
Sbjct:  110 NYDPWNN-DDRNLQDAWDYVQTQISCCGWTGAKDWENNKILI--NQSMTLYPCSCSNSSKDIQAESRFCNLDVPVNGTATYADWPVHEQGCMDGVEKWLKDNLGVILGVCTGVAVIELLGMILSISLCKNIHSEDYTKV 245          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A091W6R2 (Tetraspanin (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_15158 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.286e-13
Identity = 43/139 (30.94%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSC-------------CESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            NY P N    +NL++A DY+Q    CCG    K+WEN+   I+R  S    P SC             C+ D+     + + +   ++ GC D + N+LK  + II+GV  G+A+ E+L ++ ++ LC N  +  ++ V
Sbjct:  115 NYDPLND-DKRNLQDAWDYVQTQIACCGWSGAKDWENNEILINR--SMTAYPCSCSNISKGFQVDSGFCDLDVPVNGTATYADWPVHEQGCMDGVENWLKDNLGIILGVCTGVAVVELLGMILSISLCKNIHSEDYTKV 250          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82b (CD82 antigen-like [Source:NCBI gene;Acc:107197274])

HSP 1 Score: 68.5514 bits (166), Expect = 4.517e-13
Identity = 40/124 (32.26%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  485 NQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDI------ESEL-RSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            N+  ++A DY+QKT +CCG     NW  + W   +N S +  P SC    I      ES L +S   E   Y  GC   + ++L     +I+GV +G+A+ E+L ++ ++CLC +     +S V
Sbjct:  132 NKTTEHAWDYLQKTIQCCGWTGPSNWTENVWI--KNSSQILYPCSCRNESIPGSEVQESGLCQSLVPEWPVYTKGCMSSVEDWLLSNCGVILGVCVGVAVLELLGMMLSMCLCKSVQQEDYSKV 253          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 65.855 bits (159), Expect = 3.786e-12
Identity = 77/236 (32.63%), Postives = 121/236 (51.27%), Query Frame = 2
Query:   98 KYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            KY +F+FN LFW+ G + + +G   L   G    E +       F    Y +I  G +V V GF GCC  IRE R LL TY   LLLI ++E+  G+ A V  + +  ++++ L K++ +NY   +    + +  A+D +Q+ F+CCG     +W++S +  S        P SCC++ I  E     +    YK+  GC  +L ++L   + II  V IG+A  +I  +VF  CL
Sbjct:   18 KYLLFVFNFLFWMGGGVVMAVGIWTLIDKG----EYLSLLASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTENY---DQLGKEGITRAVDRLQQDFKCCGSNNSSDWKHSVYVQSPEAQGRVVPDSCCKT-ITPECGRRDHPSNIYKVEGGCITKLEHFLADHLLIIGAVGIGVACLQICGMVFTCCL 245          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd151 (CD151 antigen-like [Source:NCBI gene;Acc:103041246])

HSP 1 Score: 64.3142 bits (155), Expect = 1.381e-11
Identity = 74/243 (30.45%), Postives = 127/243 (52.26%), Query Frame = 2
Query:   80 CGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIES-ELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            CG    KY +F FN+LFW++G   + +G   L        + +   +   ++   Y +I  G IV + G  GCC  I+ESR LL  + VLLLLI ++EI+ G+ A V  +E+  ++   L++++++ Y         ++  A+D +Q+  +CCG  +  +W+  TW  +  D  +  P SCC++  +   LR   +    YK+  GC  +L  ++   + I+  V IGIA  +IL ++F  CL
Sbjct:   10 CGTICLKYLLFTFNLLFWLSGGAVMAVGLWTLV----DKSDYISLLSSSTYSLAAYILIAAGAIVMLTGVLGCCATIKESRALLIVFFVLLLLIFLLEITAGVLAYVYYQELNEELRADLKETMVQKY---QQPGEDHVTRAVDKLQQDLKCCGSNSSADWQQGTWIHTFADGRL-VPDSCCKTPTDHCGLRD--HPSNIYKVEGGCISKLEEFILQHLQILGAVGIGIAFLQILGMLFTCCL 242          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 61.6178 bits (148), Expect = 9.145e-11
Identity = 36/116 (31.03%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  461 YPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWY-ISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFA-VCLC 802
            Y  +N T++     AIDY+Q+   CCG+  Y +W N++W+  SRN+S    P SCC+ ++ +   S       Y  GC   +   LK  M  ++   +  A  ++L ++ A V LC
Sbjct:   99 YNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESRNNS---VPLSCCKPNVSNCTGSLSRPGDLYPEGCEALVVKKLKEIMMYVIWAALTFAAIQMLGMLCACVVLC 211          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 62.003 bits (149), Expect = 1.059e-10
Identity = 74/235 (31.49%), Postives = 118/235 (50.21%), Query Frame = 2
Query:   98 KYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM--GCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVC 796
            KY +F+FN LFW+ G + + +G   L   G    E +       F    Y +I  G +V V GF GCC  IRE R LL TY   LLLI ++E+  G+ A V  + +  ++++ L K++ +NY   +    + +  A+D +Q+ F+CCG     +W++S +  S        P SCC++ I  E     +    YK+  GC  +L ++L   + II  V IG+A  ++   V   C
Sbjct:   18 KYLLFVFNFLFWMGGGVVMAVGIWTLIDKG----EYLSLLASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTENY---DQLGKEGITRAVDRLQQDFKCCGSNNSSDWKHSVYVQSPEAQGRVVPDSCCKT-ITPECGRRDHPSNIYKVEGGCITKLEHFLADHLLIIGAVGIGVACLQLAGAVLTAC 244          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005284.1 (pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 gene:ENSPMAG00000004798.1 transcript:ENSPMAT00000005284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.466e-15
Identity = 85/261 (32.57%), Postives = 138/261 (52.87%), Query Frame = 2
Query:   68 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSI-YLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENST-WYISRNDSFMETPSSCCESDI----ESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHST 832
            MA+  G    KY V LFN+LFW++GL  I++G++  +  G F     V+T N    +   Y II +G ++FVV   GCCGA +ES  ++ T+ V L LI + E++ GI A    K+ +R + ++  K +I +YP  N       K+ +D +QK  +CCGV  Y++W NST W  S  ++    P SCC +      + ++R        Y  GC ++L   +K  + ++ GV IGI   +++ ++ A CL     N+  + 
Sbjct:    9 MALEGGMACIKYLVLLFNLLFWLSGLGLIIVGAMAQMHIGAF----SVVTGN---LSGAPYVIIAVGVVIFVVAAFGCCGAHKESYFMVATFSVFLFLIFVAELAAGIGA-YIFKDQLRDVVETKAKVVINDYPTKN-------KDPVDNMQKELQCCGVVHYQDWFNSTNWVTSDPNNPNSVPDSCCLNVTSGCGQDDIRFKNATAIIYTKGCVEKLEATMKENIVLVGGVAIGIGFAQLIGIILACCLMRGIKNSYQAV 254          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 63.5438 bits (153), Expect = 1.474e-12
Identity = 32/111 (28.83%), Postives = 57/111 (51.35%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKY-YKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            +     + + +A+D +Q+ F+CCG K Y++W +S +  S   +    P SCC++   S  +       Y  + GC  +L  +L   + II  V IG+A  ++L ++F  CL
Sbjct:   42 YQQDQQERVTSAVDKLQQEFKCCGSKNYQDWASSRYIRSAASNDRLVPDSCCKTRTPSCGKRTHPSNIYNVEGGCITKLEKFLSDHLLIIGAVGIGVACLQVLGMIFTCCL 152          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 61.6178 bits (148), Expect = 2.448e-11
Identity = 68/241 (28.22%), Postives = 118/241 (48.96%), Query Frame = 2
Query:   80 CGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCES-DIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            CG    KY + +FN +FW+TG   + +G   L   G   +  ++  +   F    Y +I  G +V + G  GCC  +RE R  L  Y  LLLLI ++E+  GI A +  +++  +++  + K+I+++Y        Q + +A+D +Q+ F+CCG   + +W+ S W           P SCC+S       R   +     + GC  +L   L+  + +I  V IG+A  ++L ++   CL
Sbjct:   12 CGTVCLKYVLLVFNFIFWLTGAGVMAVGVWTLVEKG--DYLSLLASST--FAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESY---GQPDQQRVTDAMDKLQQEFKCCGSHDWNDWQRSDWVKVAAAEGRLVPDSCCKSPTTRCGRRDHPSNINRVEGGCITKLEVILQEHLLLIGAVGIGVACLQVLGMILTCCL 245          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.149e-10
Identity = 27/97 (27.84%), Postives = 50/97 (51.55%), Query Frame = 2
Query:  500 NAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFA 790
             A+DY+QK  +CCG   Y +W  + W  +R   +   P SCC+   ++         K Y+ GC  +L + ++  +  ++GV +G A  +++ +V A
Sbjct:  136 RAVDYMQKELQCCGFANYSDWNTTEW--ARRHKYNSVPLSCCKRSAKNCTGLLSLPAKLYQQGCLLKLGDEVQQILTYLIGVAVGFAFLQVMGLVAA 230          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan17 (tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-3673])

HSP 1 Score: 56.6102 bits (135), Expect = 1.454e-9
Identity = 33/122 (27.05%), Postives = 59/122 (48.36%), Query Frame = 2
Query:  491 NLKNAIDYIQKTFRCCGVKTYKNWENSTWY----ISRNDSFMETPSSCCESDIESE-----------LRSCFNEQKY-YKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNN 808
            +L+N ID+ Q  ++CCG     +W+ + ++     +R+      P SCC  D   +           L++  ++Q Y Y  GC  +   +L+  + ++ G+ IGIAL +I    F +CL  N
Sbjct:  124 DLQNLIDFAQDYWQCCGAHGPLDWDENIYFNCSIKNRSREKCGVPFSCCVKDPAEDVVNTQCGYDVRLKTELDQQSYIYTKGCVTQFEKWLQNNLILVAGIFIGIALVQI----FGICLAQN 241          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 66.2402 bits (160), Expect = 9.649e-13
Identity = 33/113 (29.20%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQ--KYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLC 802
            ++ + +  +  AID I + F+CCG   Y++W  + W  +  D     P SCC+   +S+     ++   K Y+ GC   ++ YL   + +I G  I IA+ +++ ++FA CLC
Sbjct:  119 YHLSGHDAVTRAIDEIHRDFKCCGNAQYRDWFETKWAKTHPDM---VPRSCCKDPSDSKCNENISKDPTKIYRRGCYMFVKKYLSNNLHVISGFGIWIAVIQLMGIIFATCLC 228          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 63.929 bits (154), Expect = 7.225e-12
Identity = 79/241 (32.78%), Postives = 132/241 (54.77%), Query Frame = 2
Query:   80 CGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGV-KTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            CG +  KY +F FN +FWI G+  + +G I+       + E         FT     +I  G +V  +GF GCCGA++E++  L  Y  LLL+I ++EI+ GI A  K  +V+  +EK+L +SI  +Y   N    +    A+D  Q  F+CCG  +  K+W N+ W  +++++    P SCC+        +  +   YY+ GCS  L++++K  M  + G+ +GIA+ +IL ++F++CL
Sbjct:    4 CGMQCMKYLLFAFNFVFWIAGIAVMSVG-IWTRV---SANEYASLMGQSGFTAAANIMIAAGALVMFIGFVGCCGAVKENKCFLLLYFFLLLVIFVLEIASGILAYTKRDKVISSVEKALNQSISLDYGQSN---KEKATKAVDRAQSIFKCCGATQGPKDWANTAW--AKSNTNQTVPESCCKKKAAGCNGAPADSDTYYQKGCSQGLQDFIKSHMKTLGGIGLGIAIIQILGMIFSLCL 235          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN5])

HSP 1 Score: 60.4622 bits (145), Expect = 9.632e-11
Identity = 36/126 (28.57%), Postives = 62/126 (49.21%), Query Frame = 2
Query:  458 NYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYY------KMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGN 817
            +YP       Q  K+A + +QK  +CCG + Y +W    W    N      P SCC+   +++++SC  E   +      + GC      Y + K+ II GV +G+A+F+++ + F+ CL +   N
Sbjct:  128 DYP------EQGFKDAWNDMQKNLKCCGSRNYTDWFMVAW-AGPNTKNGSVPESCCK---DTKVKSCNLEVLSHPETINSEQGCYGAAVKYFEDKLVIIGGVALGLAVFQLIGIAFSCCLASTLHN 243          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE8])

HSP 1 Score: 59.6918 bits (143), Expect = 1.909e-10
Identity = 38/116 (32.76%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  467 PFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTG 814
             +     + + +A D IQK  +CCG+  +K+W+ S +Y   N S +  P SCC++ +       F E   Y  GC D ++  LK  + II G+ IG+A+ +IL ++FA+ L    G
Sbjct:  125 SYGEKGKEGITDAYDAIQKKEKCCGINGFKDWQRS-YYTKGNHSIV--PDSCCKT-VSKGCGINFKENDIYTKGCFDTVKTLLKDNLIIIGGIGIGVAVIQILAMIFAMVLVCKIG 236          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO38288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC9])

HSP 1 Score: 59.3066 bits (142), Expect = 2.854e-10
Identity = 33/115 (28.70%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  482 SNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWY--ISRNDSFMETPSSCCESDI----------ESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFA 790
             N +L+N ID +Q+ F+CCG K   +W+ + ++   S        P SCC  D           +S   +    +  +  GC + ++++ K  M II G  +GIAL +I+ + FA
Sbjct:  130 DNADLQNLIDGVQQEFKCCGAKGINDWDKNIYFNCSSPGSEACGVPYSCCIKDTINRQCGYGIRKSGTPTSDQSKIIFIGGCVNAVKDWFKSNMIIIGGAAVGIALLQIMGICFA 244          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan7b (tetraspanin 7 [Source:NCBI gene;Acc:101163366])

HSP 1 Score: 69.3218 bits (168), Expect = 2.452e-13
Identity = 41/126 (32.54%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  470 FNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCC--ESDIES-ELR-SCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
             N  +      A+DY+Q   RCCGV  Y +W  S +Y ++       P SCC   SD  S +LR +     K Y  GC D + ++++  M II GV  GIA  +++ ++ A CL       Q+  V
Sbjct:  124 LNYNTQDEASRAVDYLQNKLRCCGVYNYTSWFASVYYPAKG-----IPPSCCFNSSDCSSDDLRNATVAPSKVYHQGCFDLVTSFMETNMAIIAGVTFGIAFSQLIGMLLACCLSRIITANQYEMV 244          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 67.0106 bits (162), Expect = 1.505e-12
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  482 SNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCES------DIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
               +L  A+D IQ+T RCCGVK Y +W+ + ++IS+       P SCC+       +I  +L     E   +  GC   +   ++  + +I G+  GIA F++  +  A CL     N Q+  V
Sbjct:  135 GTNSLSVALDTIQRTLRCCGVKNYTDWKEAPYFISKG-----IPLSCCKDNGNCTVEIMKDLDKAGKE--VFTTGCFALVTTVMESNLGVIAGISFGIAFFQVFGIFLACCLSRYITNNQYEMV 251          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd151 (CD151 antigen [Source:NCBI gene;Acc:101157772])

HSP 1 Score: 64.3142 bits (155), Expect = 1.314e-11
Identity = 69/241 (28.63%), Postives = 127/241 (52.70%), Query Frame = 2
Query:   80 CGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKY-YKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCL 799
            CG    KY +FLFNILFW+ G   + +G   L     +  + V   N   ++   Y +I  G +V + G  GCC  ++E R LL  Y+VLLL I ++E+  G+ A +  +++  ++ ++L+ ++++ Y        +++  A+D +Q+ F+CCG   + +W  S W  +  +  +  P SCC++  E   R       Y  + GC  +L +++  ++ I+  V IGIA  +++ ++F  CL
Sbjct:   14 CGTICLKYLLFLFNILFWLAGGTVLAVGVWTLV----EKSDYVSLLNSNLYSASAYTLIAAGAVVVMSGIVGCCATLKEMRSLLIVYLVLLLCIFLLEVIAGVMAYINYQDLDEELRQNLKGTMVQKY---KQPGEESITQAVDRLQQEFKCCGSFNFSDWRESVWIQAGKEQLV--PDSCCKTPTEFCGRRDHPSNIYKVEGGCIIKLEDFILNQLYILGAVGIGIAFLQLVGMMFTCCL 245          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan7 (tetraspanin 6 [Source:NCBI gene;Acc:101163337])

HSP 1 Score: 62.3882 bits (150), Expect = 6.118e-11
Identity = 33/110 (30.00%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  482 SNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCES------DIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAV 793
               +L  A+D IQ+T RCCGVK Y +W+ + ++IS+       P SCC+       +I  +L     E   +  GC   +   ++  + +I G+  GIA F++ L +F +
Sbjct:  135 GTNSLSVALDTIQRTLRCCGVKNYTDWKEAPYFISKG-----IPLSCCKDNGNCTVEIMKDLDKAGKE--VFTTGCFALVTTVMESNLGVIAGISFGIAFFQVRLTLFTM 237          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000000775.2 (CD82 antigen [Source:NCBI gene;Acc:101156312])

HSP 1 Score: 61.6178 bits (148), Expect = 1.060e-10
Identity = 38/120 (31.67%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  497 KNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRS--CFNEQK-----YYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQHSTV 835
            + A D IQK  +CCG    ++W N+   +  N S +  P SC    +  + RS   F E +      Y +GCS  + N+L   + +++G+ + +AL E+L ++ ++CLC N G T +S V
Sbjct:  135 EQAWDLIQKKMQCCGWMGQEDWNNNA--VILNSSQLLFPCSCQNLTLTVQNRSDSGFCEAQTPDWPVYNVGCSASVENWLITNIGVVLGICLTVALIELLGMILSICLCRNVG-TDYSKV 251          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000073695.1 (SMESG000073695.1)

HSP 1 Score: 288.886 bits (738), Expect = 2.947e-98
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 2
Query:   68 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM 685
            MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYCIIGLGCIVFVVGFCGCCGAIRESRLLLGTYIVLLLLIMIVEISCGIYATVKEKEVVRKIEKSLEKSIIKNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM
Sbjct:    1 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYCIIGLGCIVFVVGFCGCCGAIRESRLLLGTYIVLLLLIMIVEISCGIYATVKEKEVVRKIEKSLEKSIIKNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKM 206          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021627.1 (SMESG000021627.1)

HSP 1 Score: 123.25 bits (308), Expect = 2.938e-33
Identity = 102/254 (40.16%), Postives = 160/254 (62.99%), Query Frame = 2
Query:   68 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTR-LMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNE---QKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGN 817
            MAIGCG K +K  + +FN++FW++GLI IV+ SIYL+    K  E++    D++ +R L   ++ LG I+FV+ FCGCCGA+RES+LLLG YIV L+LI+ ++++ GI+A   ++++ + + K+L+ +I + Y       +++     D IQ+   CCG++  ++WE S WYI + +     P SCC  + E     C+N+      +  GC  RLR YL+   PI +GV++GIA FEI +V+ A CLC NTG+
Sbjct:    1 MAIGCGPKLAKCLLIIFNVVFWLSGLILIVIPSIYLSNEKTKIVEKL----DKFNSRGLFIGVLVLGIIIFVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELY-----GYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAE-----CYNKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLCRNTGS 240          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021642.1 (SMESG000021642.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.325e-29
Identity = 91/253 (35.97%), Postives = 144/253 (56.92%), Query Frame = 2
Query:   68 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQH 826
            MAIGCG K +K  + +FNI FW TG+I IV+ SIYL  G  K  +++I  N      ++  ++ +G ++F++GF GCCGA++ESR+LL  YI+L+  I+I E+  GI+A VK + +   I+     +    Y      ++  +  AID +Q+   CCG     +W  S WY+++ D     P SCC+  + ++     N    +  GC  ++ +Y K   P+I+GV +GIA FEI +V+ A C+C   G+T H
Sbjct:    1 MAIGCGPKIAKILLIIFNIAFWATGVILIVVASIYLANGTMKYVDDII--NASTNRNILIGLLVIGIVIFIIGFSGCCGAVKESRMLLAIYIILVCAIIIAEVGFGIFAIVKRQPLEDAIKNDFTNTFQNRY-----GNDTTITVAIDNLQQIIPCCGATKQLDWTQSNWYLNKLDKVQTAPKSCCK--LPTDYCWLTNNGTMFPDGCIPKMEDYAKKFFPVIIGVALGIACFEIFVVICAFCVCR--GSTTH 242          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021637.1 (SMESG000021637.1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.447e-17
Identity = 77/253 (30.43%), Postives = 125/253 (49.41%), Query Frame = 2
Query:   68 MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITPNDRYFTRLMYXXXXXXXXXXXXXXXXXXXAIRESRXXXXXXXXXXXXXXXXXXSCGIYATXXXXXXXXXXXXXXXXXXXXNYPPFNSTSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNEQKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGNTQH 826
            M I CG+  +K  +FLFNI+F  +GLI I++ SI L         + I         +++ I   GC            A++ESR LL  Y+V L++I++ E++ G +  +K      K++    K ++ +Y         +    ++ IQ+ F CCGV    +W+ S WY S N +    P+SCC S+ +  L    N++K  K+GC  +L  YL     I++ V+ GI LFEI +V+ A C+  +  N   
Sbjct:    1 MGIDCGSSLAKIFLFLFNIVFCFSGLILIIMSSILLKDKSIALVNQYIVVFILVLGIIIFLIAFCGCCG----------AVKESRFLLRIYVVSLVVIILSELAIGTFLFIKWNPAAEKLKAEFIKMVMVDYGV-----KMDKTEIVNEIQQGFGCCGVYNDTDWKESYWYKSINKA-QVVPNSCCPSNNKCWLD---NKEKVMKIGCLKKLMQYLNKIFLIVIFVVFGIILFEIFVVMCAFCVYRHKNNIMR 234          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000044356.1 (SMESG000044356.1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.803e-9
Identity = 32/116 (27.59%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  479 TSNQNLKNAIDYIQKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCES----DIESELRSCFNEQKY--YKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNN 808
            ++  +L+  IDYIQ T +CCGV+ Y +WE        N+S    P SCC +     + S  ++  +   Y  Y +GCS+ +   +++K   I+ +LI +   +++ +V + C+  +
Sbjct:  125 STEVSLRKEIDYIQSTLQCCGVQNYTDWE------MYNNSI---PDSCCRNMKCKPVLSSTQTTISPDAYEPYIIGCSETVEKLIQHKFVYIILILISVIALQVISLVASCCIIRH 231          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD821.668e-1328.06CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210][more]
CD821.790e-1328.06CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210][more]
CD632.781e-1332.46CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
CD632.781e-1332.46CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
CD632.805e-1332.46CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsp-151.505e-627.68Tetraspanin-15 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp39D2.671e-931.90gene:FBgn0032943 transcript:FBtr0273404[more]
Tsp47F1.593e-834.52gene:FBgn0033629 transcript:FBtr0088151[more]
Tsp96F1.478e-727.10gene:FBgn0027865 transcript:FBtr0330164[more]
Tsp96F1.478e-727.10gene:FBgn0027865 transcript:FBtr0084912[more]
Tsp96F2.037e-727.48gene:FBgn0027865 transcript:FBtr0330163[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd151l7.414e-1228.57CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
cd82a5.325e-1126.32CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82a5.325e-1126.32CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82a5.325e-1126.32CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
tspan3a1.145e-1028.57tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sertad41.004e-1228.23SERTA domain containing 4 [Source:Xenbase;Acc:XB-G... [more]
tspan71.040e-1132.74tetraspanin 7 [Source:NCBI gene;Acc:394976][more]
tspan71.047e-1131.20tetraspanin 7 [Source:NCBI gene;Acc:394976][more]
cd821.566e-1128.00CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd821.875e-1128.00CD82 molecule [Source:NCBI gene;Acc:394799][more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspan71.553e-1229.20tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407][more]
Tspan71.608e-1129.52tetraspanin 7 [Source:MGI Symbol;Acc:MGI:1298407][more]
Cd1516.364e-1125.89CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
Cd1516.364e-1125.89CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
Cd1516.364e-1125.89CD151 antigen [Source:MGI Symbol;Acc:MGI:1096360][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27701|CD82_HUMAN8.011e-1328.06CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 ... [more]
sp|P08962|CD63_HUMAN5.447e-1232.46CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 ... [more]
sp|Q7YQL0|TSN7_PANTR9.825e-1229.09Tetraspanin-7 OS=Pan troglodytes OX=9598 GN=TSPAN7... [more]
sp|P41732|TSN7_HUMAN1.025e-1129.09Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE... [more]
sp|Q62283|TSN7_MOUSE1.086e-1129.20Tetraspanin-7 OS=Mus musculus OX=10090 GN=Tspan7 P... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6V1C75.856e-1634.48Tetraspanin OS=Pocillopora damicornis OX=46731 GN=... [more]
A0A3S1CDQ51.764e-1532.69Tetraspanin OS=Elysia chlorotica OX=188477 GN=EGW0... [more]
A0A2B4S9Q73.866e-1535.65Tetraspanin OS=Stylophora pistillata OX=50429 GN=C... [more]
A0A091VU431.076e-1332.37Tetraspanin (Fragment) OS=Nipponia nippon OX=12839... [more]
A0A091W6R21.286e-1330.94Tetraspanin (Fragment) OS=Opisthocomus hoazin OX=3... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd82b4.517e-1332.26CD82 antigen-like [Source:NCBI gene;Acc:107197274][more]
tspan113.786e-1232.63tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
cd1511.381e-1130.45CD151 antigen-like [Source:NCBI gene;Acc:103041246... [more]
tspan3a9.145e-1131.03tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
tspan111.059e-1031.49tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005284.11.466e-1532.57pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 ... [more]
CD1511.474e-1228.83CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD1512.448e-1128.22CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
ENSPMAT00000009492.11.149e-1027.84pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
tspan171.454e-927.05tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-36... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468879.649e-1329.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359177.225e-1232.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308379.632e-1128.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475921.909e-1032.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382882.854e-1028.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan7b2.452e-1332.54tetraspanin 7 [Source:NCBI gene;Acc:101163366][more]
tspan71.505e-1229.84tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
cd1511.314e-1128.63CD151 antigen [Source:NCBI gene;Acc:101157772][more]
tspan76.118e-1130.00tetraspanin 6 [Source:NCBI gene;Acc:101163337][more]
ENSORLT00000000775.21.060e-1031.67CD82 antigen [Source:NCBI gene;Acc:101156312][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073695.12.947e-98100.00SMESG000073695.1[more]
SMESG000021627.12.938e-3340.16SMESG000021627.1[more]
SMESG000021642.11.325e-2935.97SMESG000021642.1[more]
SMESG000021637.15.447e-1730.43SMESG000021637.1[more]
SMESG000044356.11.803e-927.59SMESG000044356.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018665 ID=SMED30018665|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=950bp
AACAGACATTTTTAAAATAATATTTTAGCTAAAAATAAATTGTGATTTGG
ATAAAATAATTATTAATATGGCTATAGGATGTGGAGCAAAATTTTCCAAA
TATACTGTTTTTTTATTTAATATTTTATTTTGGATTACCGGTTTGATATT
CATTGTTCTCGGCTCAATATATTTAACCACTGGTGGTTTCAAAAGTTTTG
AAGAAGTTATCACACCAAATGATCGATATTTTACAAGACTTATGTATTGT
ATTATCGGATTGGGATGCATTGTTTTTGTCGTAGGTTTTTGTGGATGCTG
TGGTGCTATTCGAGAAAGCAGATTATTACTTGGAACGTATATCGTGTTGC
TATTACTCATTATGATTGTCGAAATCAGTTGTGGGATCTATGCAACAGTG
AAAGAGAAAGAGGTAGTAAGAAAAATTGAAAAAAGTCTTGAAAAATCAAT
TATTAAGAATTATCCTCCTTTCAATTCTACTTCTAACCAGAATTTGAAGA
ATGCAATTGACTATATACAGAAAACATTTAGATGTTGTGGAGTAAAGACC
TATAAAAACTGGGAAAATTCGACATGGTATATATCAAGAAATGATTCTTT
TATGGAAACACCATCTTCATGTTGTGAGTCTGATATTGAAAGTGAATTAA
GAAGTTGTTTCAATGAACAAAAATATTATAAAATGGGCTGCAGTGATCGA
CTAAGGAATTATTTAAAATATAAAATGCCTATAATAGTCGGGGTTCTAAT
AGGAATTGCATTATTTGAGATTTTATTAGTGGTTTTTGCCGTTTGCCTTT
GTAATAATACTGGAAATACGCAACATTCAACTGTTTGATCTTGTTGAAGC
AATTATATTTTAAAATGGTTAATTGATTTTAACATAATTTTTGACTTTAT
AATTTATATATATATATACCATATATTATTTTATATTCATGTGTTATAAC
back to top

protein sequence of SMED30018665-orf-1

>SMED30018665-orf-1 ID=SMED30018665-orf-1|Name=SMED30018665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=257bp
MAIGCGAKFSKYTVFLFNILFWITGLIFIVLGSIYLTTGGFKSFEEVITP
NDRYFTRLMYCIIGLGCIVFVVGFCGCCGAIRESRLLLGTYIVLLLLIMI
VEISCGIYATVKEKEVVRKIEKSLEKSIIKNYPPFNSTSNQNLKNAIDYI
QKTFRCCGVKTYKNWENSTWYISRNDSFMETPSSCCESDIESELRSCFNE
QKYYKMGCSDRLRNYLKYKMPIIVGVLIGIALFEILLVVFAVCLCNNTGN
TQHSTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 55..81
score: 37.27
coord: 82..110
score: 34.48
coord: 12..35
score: 30.32
coord: 222..248
score: 31.99
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..256
e-value: 3.4E-54
score: 181.2
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 110..219
e-value: 1.2E-8
score: 36.6
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 119..219
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 11..246
e-value: 2.5E-51
score: 174.6
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 4..247
NoneNo IPR availablePANTHERPTHR19282:SF273TETRASPANINcoord: 4..247
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 88..110
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 12..34