PiggyBac transposable element-derived protein 4

Overview
NamePiggyBac transposable element-derived protein 4
Smed IDSMED30018657
Length (bp)1702
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PiggyBac transposable element-derived protein 4 (SMED30018657) t-SNE clustered cells

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30018657) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PiggyBac transposable element-derived protein 4 (SMED30018657) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30018657) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018657

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018657SMESG000023253.1 Contig2156newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018657SMESG000023253.1 Contig2156uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 76.2554 bits (186), Expect = 3.594e-16
Identity = 42/111 (37.84%), Postives = 70/111 (63.06%), Query Frame = 1
Query:  370 TFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKG-----TIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSL 684
            T +   ++I +D+ LML+KG L   QY+P KR RF +KL++LCES++ + ++ +++TG G     +  G+K      +S+IV++L+  LL QGYC+  DN+   P L + L
Sbjct:  239 TVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLK------SSRIVLTLVNDLLGQGYCVFLDNFNISPMLFREL 343          

HSP 2 Score: 29.261 bits (64), Expect = 3.594e-16
Identity = 12/45 (26.67%), Postives = 24/45 (53.33%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSEKASTNKMDKDGDVKSKLIQKFN 935
            ++M +KW D +++ +LST HN      N  +     + ++I  +N
Sbjct:  381 ELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYN 425          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 63.1586 bits (152), Expect = 5.850e-10
Identity = 40/112 (35.71%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTII---GVKYKYMPVTSQIVVSLLEP-LLNQGYCLTTDNYYT*PQLAKSL 684
            CK+ +  +K I ID+R++  K ++   QY+  K  ++ +KLF+L +S N + S F IYTGK       G+ Y        +V +L++P  L +GY L  DN+YT P+L + L
Sbjct:  257 CKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKSRFTSSQGLPY-------DVVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDL 361          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 53.9138 bits (128), Expect = 5.732e-8
Identity = 35/111 (31.53%), Postives = 62/111 (55.86%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGK--GTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            C+ F+   ++I ID+R++  K + G  QY+  K +++  KLF+L +S+  + S F +Y GK   +  G+ Y+       ++  + E  L  GY L  DN+YT P+L + L+
Sbjct:  350 CRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSYE------SVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLL 454          

HSP 2 Score: 23.0978 bits (48), Expect = 5.732e-8
Identity = 9/37 (24.32%), Postives = 20/37 (54.05%), Query Frame = 3
Query:  798 EKVMVMKWQDKRDIWLLSTVHNSEKAS-TNKMDKDGD 905
            + ++ ++W+D R++ + ST H +       +  KD D
Sbjct:  494 DDLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDND 530          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 48.9062 bits (115), Expect = 2.148e-7
Identity = 36/112 (32.14%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGK---GTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            CK  F   ++I ID+R++  K + G +QYI  + +++  KLF+L +S   + + F IY GK       G+ Y        ++  + E +L  GY L  DN+YT P L + L+
Sbjct:  283 CKASFHPHQNISIDERMVASKARHGLIQYIS-EPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISY------DSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLL 387          

HSP 2 Score: 26.1794 bits (56), Expect = 2.148e-7
Identity = 8/23 (34.78%), Postives = 17/23 (73.91%), Query Frame = 3
Query:  798 EKVMVMKWQDKRDIWLLSTVHNS 866
            + ++ ++W+DKRD+ + ST H +
Sbjct:  420 DGLLFVEWKDKRDVLMCSTFHKA 442          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 48.9062 bits (115), Expect = 2.254e-7
Identity = 34/109 (31.19%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            CK  F   ++I ID+R++  K + G +QYI  + +++  KLF+L +S   + + F IY GK   +  + +       ++  + E +L  GY L  DN+YT P L + L+
Sbjct:  283 CKASFHPHQNISIDERMVASKARHGLIQYIS-EPTKWGYKLFVLADSLCAYTWDFFIYEGK---VKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLL 387          

HSP 2 Score: 26.1794 bits (56), Expect = 2.254e-7
Identity = 8/23 (34.78%), Postives = 17/23 (73.91%), Query Frame = 3
Query:  798 EKVMVMKWQDKRDIWLLSTVHNS 866
            + ++ ++W+DKRD+ + ST H +
Sbjct:  420 DGLLFVEWKDKRDVLMCSTFHKA 442          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: dlgap5 (discs large homolog associated protein 5 [Source:Xenbase;Acc:XB-GENE-481549])

HSP 1 Score: 76.2554 bits (186), Expect = 2.438e-14
Identity = 46/115 (40.00%), Postives = 69/115 (60.00%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTII---GVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT 660
            R L+ +L     C   +   ++I ID+ L+L+KG++ + QYIP KR+R+ IK + LCES   + S F+IY GK + +   G     + V+ +IV  L+ PLL QGY L  DN+YT
Sbjct:  235 RPLINSLSER--CGEVYTPSQNICIDESLLLFKGRIAFRQYIPSKRARYGIKFYKLCESITGYTSYFMIYEGKDSKLDPPGCPLD-LTVSGKIVWELISPLLGQGYHLYVDNFYT 346          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000039631.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:68190968:68192372:-1 gene:ENSXETG00000012484.1 transcript:ENSXETT00000039631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 3.999e-14
Identity = 43/114 (37.72%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTIIGVKYKYMPVTS--QIVVSLLEPLLNQGYCLTTDNYYT 660
            R L+ +L   F     +   ++I +D+ L+L+KG+L + QYIP KR+R+ IK + LCES + + S F+IY GK + +      + +T+  +IV  L+ PLL +GY L  DN+Y+
Sbjct:  233 RPLINSLSERF--AEMYTPSQNISVDESLLLFKGRLKFRQYIPSKRARYGIKFYKLCESSSGYTSHFLIYEGKDSQLDPPGCPIDLTASGKIVWELISPLLGRGYHLYVDNFYS 344          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: cldn5 (claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) [Source:Xenbase;Acc:XB-GENE-976044])

HSP 1 Score: 74.3294 bits (181), Expect = 1.460e-13
Identity = 44/114 (38.60%), Postives = 69/114 (60.53%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTIIGVK--YKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT 660
            R L+ +L   F     +   ++I ID+ L+L+KG+L + QYIP KR+R+ IK + LCES + + S F+IY GK + +        + V+ +IV  L+ PLL QG+ L  DN+Y+
Sbjct:  236 RPLIDSLSERF--AAVYTPCQNICIDESLLLFKGRLQFRQYIPSKRARYGIKFYKLCESSSGYTSYFLIYEGKDSKLDPPGCPPDLTVSGKIVWELISPLLGQGFHLYVDNFYS 347          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: fibcd1 (fibrinogen C domain containing 1 [Source:Xenbase;Acc:XB-GENE-483361])

HSP 1 Score: 73.559 bits (179), Expect = 2.113e-13
Identity = 43/114 (37.72%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTIIGVK--YKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT 660
            R L+ +L   F     +   +++ +D+ L+L+KG+L + QYIP KRSR+ IK + LCES   + S F++Y GK T +        +  + +IV  L+ PLL +GY L  DN+YT
Sbjct:  242 RPLIDSLSQRF--AEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYT 353          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000042392.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:114519840:114521279:-1 gene:ENSXETG00000018812.1 transcript:ENSXETT00000042392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.559e-13
Identity = 43/114 (37.72%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFS-FIIYTGKGTIIGVK--YKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT 660
            R L+ +L   F     +   +++ +D+ L+L+KG+L + QYIP KRSR+ IK + LCES   + S F++Y GK T +        +  + +IV  L+ PLL +GY L  DN+YT
Sbjct:  242 RPLIDSLSQRF--AEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYT 353          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.584e-15
Identity = 42/111 (37.84%), Postives = 70/111 (63.06%), Query Frame = 1
Query:  370 TFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKG-----TIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSL 684
            T +   ++I +D+ LML+KG L   QY+P KR RF +KL++LCES++ + ++ +++TG G     +  G+K      +S+IV++L+  LL QGYC+  DN+   P L + L
Sbjct:  239 TVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLK------SSRIVLTLVNDLLGQGYCVFLDNFNISPMLFREL 343          

HSP 2 Score: 29.261 bits (64), Expect = 1.584e-15
Identity = 12/45 (26.67%), Postives = 24/45 (53.33%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSEKASTNKMDKDGDVKSKLIQKFN 935
            ++M +KW D +++ +LST HN      N  +     + ++I  +N
Sbjct:  381 ELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKRPRVIVDYN 425          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2LN75 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_103 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.712e-32
Identity = 57/102 (55.88%), Postives = 82/102 (80.39%), Query Frame = 1
Query:  385 QKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            ++D+ ID+ LML+KG+LGW Q+IPLKR+RF +K F+LCES + + +S IIYTGK TI+  +Y  +  +SQIV++++EPLL++GYCLT DNYY+ P+LA  LV
Sbjct:  221 ERDVTIDESLMLFKGRLGWKQFIPLKRARFGVKCFMLCESISGYVWSIIIYTGKDTILKPEYSKLCFSSQIVLTMMEPLLHKGYCLTIDNYYSSPELADKLV 322          

HSP 2 Score: 36.1946 bits (82), Expect = 8.712e-32
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSE 869
            KV VMKW DK+ + LLST+HN+E
Sbjct:  360 KVTVMKWMDKKKVSLLSTIHNTE 382          

HSP 3 Score: 28.4906 bits (62), Expect = 8.712e-32
Identity = 16/36 (44.44%), Postives = 24/36 (66.67%), Query Frame = 2
Query:  695 RTNTYRIVRKNRKDIPTFIQTKKIE*AEIVAAQLGK 802
            RT+TY  +   RK++P  +Q KK++  EI+A Q GK
Sbjct:  325 RTDTYSTLNLKRKEVPKEMQKKKLKKGEIIAFQRGK 360          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2LQG6 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_418 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.689e-32
Identity = 57/102 (55.88%), Postives = 82/102 (80.39%), Query Frame = 1
Query:  385 QKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            ++D+ ID+ LML+KG+LGW Q+IPLKR+RF +K F+LCES + + +S IIYTGK TI+  +Y  +  +SQIV++++EPLL++GYCLT DNYY+ P+LA  LV
Sbjct:  221 ERDVTIDESLMLFKGRLGWKQFIPLKRARFGVKCFMLCESISGYVWSIIIYTGKDTILKPEYSKLCFSSQIVLTMMEPLLHKGYCLTIDNYYSSPELADKLV 322          

HSP 2 Score: 36.1946 bits (82), Expect = 9.689e-32
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSE 869
            KV VMKW DK+ + LLST+HN+E
Sbjct:  360 KVTVMKWMDKKKVSLLSTIHNTE 382          

HSP 3 Score: 28.4906 bits (62), Expect = 9.689e-32
Identity = 16/36 (44.44%), Postives = 24/36 (66.67%), Query Frame = 2
Query:  695 RTNTYRIVRKNRKDIPTFIQTKKIE*AEIVAAQLGK 802
            RT+TY  +   RK++P  +Q KK++  EI+A Q GK
Sbjct:  325 RTDTYSTLNLKRKEVPKEMQKKKLKKGEIIAFQRGK 360          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2MDI8 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_69 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 6.107e-30
Identity = 60/103 (58.25%), Postives = 82/103 (79.61%), Query Frame = 1
Query:  385 QKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLVK 690
            ++D+ ID+ LMLYKG+L W QYIPLKRSRF IK F+LCESK+ + +  IIYTGK T+    Y+++  +SQ+V++L++PLLN+GYCLTTDNYYT P+LA  L+ 
Sbjct:  227 ERDVTIDESLMLYKGRLHWKQYIPLKRSRFDIKSFILCESKSGYVYQLIIYTGKDTLFDDNYQHLCKSSQVVMTLMQPLLNKGYCLTTDNYYTSPELADILIN 329          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2H4G4 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_581 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.790e-30
Identity = 60/103 (58.25%), Postives = 82/103 (79.61%), Query Frame = 1
Query:  385 QKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLVK 690
            ++D+ ID+ LMLYKG+L W QYIPLKRSRF IK F+LCESK+ + +  IIYTGK T+    Y+++  +SQ+V++L++PLLN+GYCLTTDNYYT P+LA  L+ 
Sbjct:  227 ERDVTIDESLMLYKGRLHWKQYIPLKRSRFGIKSFILCESKSGYVYQLIIYTGKDTLFDDNYQHLCKSSQVVMTLMQPLLNKGYCLTTDNYYTSPELADILIN 329          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2SEM1 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_409 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.104e-29
Identity = 53/108 (49.07%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  367 KTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            K+ ++ ++DI +D+ L+ YKG+LGW QYIP KR+RF +KLF LCES++ + ++  IYTGKGT+    Y ++ V+++ V+++L  L  +GYCLTTDNYYT P+LA+ L+
Sbjct:   46 KSVYVPKQDISVDESLIAYKGRLGWKQYIPNKRARFGLKLFQLCESESGYIWNSCIYTGKGTVFRNDYNHLGVSTKSVITVLHDLKGKGYCLTTDNYYTSPELAELLI 153          

HSP 2 Score: 35.8094 bits (81), Expect = 1.104e-29
Identity = 18/51 (35.29%), Postives = 31/51 (60.78%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSE--KASTNKMDKDGDVKSKLIQKFNSETN 947
            K+ VMKW+DK+ + +LST HN++  +  + K +    VK K +  +N+ T 
Sbjct:  191 KMCVMKWKDKKPLHMLSTFHNADMMEVKSKKENSAVKVKPKAVMLYNAATG 241          

HSP 3 Score: 29.261 bits (64), Expect = 1.104e-29
Identity = 12/36 (33.33%), Postives = 22/36 (61.11%), Query Frame = 2
Query:  695 RTNTYRIVRKNRKDIPTFIQTKKIE*AEIVAAQLGK 802
            +T+    +R NRK +P  +++  ++  EI+A Q GK
Sbjct:  156 KTDICGTLRPNRKGLPALLKSSSVKKGEIIAFQKGK 191          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.998e-11
Identity = 40/124 (32.26%), Postives = 73/124 (58.87%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTII---GVKYKYMPVTSQIVVSLLEP-LLNQGYCLTTDNYYT*PQLAKSL 684
            + L++T+ +   CK F+   K++ +D+R++  K + G  QY+  K +++  KLF+L +S+N +   F +YTGK  I    G+ Y        +V+SL++P  L  GY +  DN+Y+ P+L ++L
Sbjct:  306 KPLMETIKNA--CKAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSY-------DVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRAL 420          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000043919.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002039.1:240413:244210:1 gene:ENSAMXG00000040755.1 transcript:ENSAMXT00000043919.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 6.518e-11
Identity = 35/111 (31.53%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLE-PLLNQGYCLTTDNYYT*PQLAKSLVK 690
            C +FF  ++++ ID+R++  K + G  QY+  K +++  KLF+L +S + + ++F +Y GK      K     ++   V +LL+  LL  GY +  DN+YT P L   L++
Sbjct:  306 CHSFFQPRRELSIDERMVASKARTGLKQYMKAKPTKWGFKLFILADSASGYTWNFFVYEGKSPFASGKG----LSYDTVKTLLDYSLLGHGYMVYMDNFYTSPTLLSDLLQ 412          

HSP 2 Score: 28.4906 bits (62), Expect = 6.518e-11
Identity = 11/29 (37.93%), Postives = 19/29 (65.52%), Query Frame = 3
Query:  801 KVMVMKWQDKRDIWLLSTVHNSEKASTNK 887
            K++ +KW D R++ + ST+H + K  T K
Sbjct:  452 KLLYVKWMDTREVTMCSTMHKAYKGDTVK 480          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 4.417e-9
Identity = 37/112 (33.04%), Postives = 65/112 (58.04%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTII---GVKYKYMPVTSQIVVSLLEP-LLNQGYCLTTDNYYT*PQLAKSL 684
            CK+F+   K++ +D+R++  K +    QY+  K  ++  KLF+L +S+N +   F +YTGK  I    G+ Y        +V+SL++P  L  GY +  DN+Y+ P+L ++L
Sbjct:  208 CKSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSY-------DVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRAL 312          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000057483.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:107197084])

HSP 1 Score: 50.0618 bits (118), Expect = 5.551e-6
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  364 CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFF-SFIIYTGKGTIIGVKYKYMPVTSQIVVSLLE-PLLNQGYCLTTDNYYT 660
            C+ ++   +++ ID+R++  K ++G  QY+  K +++   LF+L +S + +  +F +Y GK      K     ++   VVSLL  P L  GY +  DN+YT
Sbjct:  284 CRAYYQPHQNLSIDERMVATKARIGMKQYMKNKPTKWGYMLFVLADSSSGYTCNFSVYEGKARKPSGKG----LSFDAVVSLLHVPSLGTGYTVYVDNFYT 380          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 6.201e-8
Identity = 28/120 (23.33%), Postives = 68/120 (56.67%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSL 684
            R++V+ + + F     +  ++++ +D+ ++ +KG+L + Q++P K +++ +K++ LCE++  +  +F IYTG+            +  ++V+SL     ++ + L  D Y++ P L + L
Sbjct:   81 RNVVEEVRANF--SRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSSPALLEDL 198          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 8.181e-8
Identity = 36/120 (30.00%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  328 RSLVKTLXSTF*CKTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSL 684
            R++++   S F  K  +   +++ +D+  + +KG+L +  Y P K  ++ IK ++L E++  + F+F IY G    I            IV  L+ PLL++GY L  DNYY   +L + L
Sbjct:  132 RTVMEYFQSKF--KALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKSI----------RNIVFGLMGPLLDKGYQLYMDNYYNSVKLTEEL 239          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 50.447 bits (119), Expect = 3.564e-6
Identity = 30/100 (30.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:  394 IKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXF-FSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLVK 690
            + +D+RL+ ++G+  + QY+P K +++ IK++  C++K+ + +   +YTGK +  G   K   +  ++V+ + E L  QG+ +T DN++T  +L + L K
Sbjct:  251 VTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGK-SPGGAPEKNQGM--RVVLEMSEGL--QGHNITCDNFFTSYRLGEELQK 345          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 8.253e-6
Identity = 31/100 (31.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  394 IKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESK-NXFFSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLVK 690
            + +D+RL+ ++G+  + QY+P K +++ IK++  C++K N  +   +YTGK    G   K   +  ++V+ + E L  QG+ +T DN++T  +L + L K
Sbjct:   54 VTVDERLVPFRGRCPFQQYMPNKPAKYGIKIWAACDAKSNYAWKMQVYTGK-LPGGAPEKNQGM--RVVLEMSEGL--QGHNITCDNFFTSYRLGEELQK 148          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000067117.1 (SMESG000067117.1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.525e-13
Identity = 42/103 (40.78%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  367 KTFFIYQKDIKIDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCE-SKNXFFSFIIYTGKGTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQL 672
            K   I  + I ID+ LML+KG+L + QYIPLKR RF IKLF + + +     +FIIYTGK T     ++ + ++  IV+ L+   L++G+ L  +N+Y+ P L
Sbjct:  191 KNVIIPDRLICIDESLMLWKGRLSFKQYIPLKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRF-HELLGISGSIVMELMNMHLDKGHVLYVENWYSSPPL 292          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000020543.1 (SMESG000020543.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.319e-10
Identity = 36/100 (36.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  400 IDKRLMLYKGQLGWMQYIPLKRSRFIIKLFLLCESKNXFFSFIIYTGK----GTIIGVKYKYMPVTSQIVVSLLEPLLNQGYCLTTDNYYT*PQLAKSLV 687
            +D+ LM ++G++ + QYI  KR R++IK+F L       +SF IYT K      I G K      +++IV++L + +L +G+ + TDN+YT   LA+ L+
Sbjct:   80 VDESLMPFRGRIVFRQYIKQKRHRYVIKVFKLYIGPGYTYSFRIYTCKDENTNEISGNK------STEIVMALCQDILGKGHTICTDNWYTSVDLAERLI 173          

HSP 2 Score: 25.409 bits (54), Expect = 2.319e-10
Identity = 14/46 (30.43%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  798 EKVMVMKWQDKRDIWLLSTVHNSEKASTNKMDKDGDVKSKLIQKFN 935
            ++V+  K + KRD+ +LST H++E     K++   + K K++ ++N
Sbjct:  192 KEVVAQKLKHKRDVLMLSTKHSTEMTIIQKINFSKE-KPKMVFEYN 236          
The following BLAST results are available for this feature:
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PGBD43.594e-1637.84piggyBac transposable element derived 4 [Source:HG... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-19f4.25.850e-1035.71si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
CABZ01069162.15.732e-831.53pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
pgbd42.148e-732.14piggyBac transposable element derived 4 [Source:ZF... [more]
pgbd42.254e-731.19piggyBac transposable element derived 4 [Source:ZF... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlgap52.438e-1440.00discs large homolog associated protein 5 [Source:X... [more]
ENSXETT00000039631.13.999e-1437.72pep primary_assembly:Xenopus_tropicalis_v9.1:1:681... [more]
cldn51.460e-1338.60claudin 5 (transmembrane protein deleted in veloca... [more]
fibcd12.113e-1337.72fibrinogen C domain containing 1 [Source:Xenbase;A... [more]
ENSXETT00000042392.12.559e-1337.72pep primary_assembly:Xenopus_tropicalis_v9.1:4:114... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN1.584e-1537.84PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2LN758.712e-3255.88PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2LQG69.689e-3255.88PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2MDI86.107e-3058.25PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2H4G49.790e-3058.25PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2SEM11.104e-2949.07PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000030524.13.998e-1132.26pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
ENSAMXT00000043919.16.518e-1131.53pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000025849.24.417e-933.04pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000057483.15.551e-630.69piggyBac transposable element-derived protein 4-li... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007705.16.201e-823.33pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000002004.18.181e-830.00pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000037833.13.564e-630.00piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000027888.18.253e-631.00pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067117.14.525e-1340.78SMESG000067117.1[more]
SMESG000020543.12.319e-1036.00SMESG000020543.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018657 ID=SMED30018657|Name=PiggyBac transposable element-derived protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1702bp
AACAATCAAGAAACTACAATCGCGCACACAGACTTGAGAAGCGAAATTGA
CTANTGTNTGNTATNATCATANTTTTNATTGTAACATCACAATAGTTACA
TNATCGAATCATGATGTCATTTAAGCTGTGTTATGTCATGTGAACAATTA
TACCTGGCGTGTCATGGTTCCANTTTTGAAAAAGAACCATTTCCGGTGGT
TAACTTATAAGTTAACTANTCACGCATACATCCAATAATATACTCACACT
GTATATATTTCTATGTTATAGGCTCTATGATTAGTTGTATGTTTACTTAT
AAATGAATTTTGTAGAGGCNTTTAGAGAGAAGCCTTGTAAAGACACTANA
ATCNACTTTTTAATGCAAAACGTTTTTTATTTACCAGAAAGACATAAAAA
TTGATAAAAGACTAATGCTTTATAAAGGTCAATTAGGATGGATGCAATAT
ATTCCACTAAAAAGATCGAGGTTTATAATAAAATTATTTTTATTGTGCGA
ATCTAAAAATGNCTTTTTTTCATTTATTATATATACAGGAAAAGGCACAA
TAATAGGTGTAAAATATAAATACATGCCGGTTACTTCCCAAATTGTTGTC
TCGTTACTTGAACCTCTTTTGAACCAAGGTTACTGTCTGACCACTGATAA
TTATTATACATAACCACAATTGGCAAAATCTTTAGTAAAACCATAGAACG
AACACATACAGGATTGTTAGAAAAAATAGAAAAGATATTCCAACATTTAT
TCAAACAAAAAAAATTGAATAGGCCGAGATAGTAGCTGCTCAACTTGGAA
AAGGTAATGGTAATGAAGTGGCAAGACAAAAGAGACATTTGGTTGTTATC
CACAGTCCATAACTCAGAGAAAGCATCAACAAACAAAATGGATAAAGATG
GTGACGTTAAATCTAAACTAATTCAAAAATTTAATAGCGAAACAAATATT
AGAAAAATAGGTAGACCAAAATCTTCTGGGATTTTACGACTAACGGAATG
TCATTTTCCAAATTTTGTTCCACTGAAACTCTTAGAAAGAATCTCTTTAA
AGATATTGTGCTGTGTGTTNAGTCAAACGAGACAGTAGAGGAAAAAGGAA
AAGAAAAGAAAGTCTCTATATGTGCAACACTTAGCCATTATCAGGGCAGC
ATGATTGATTGCTATGTGGAAAACGATTACCATAAGAAAAGCGGATAAGG
TNATTAAATATATTGTTATACGATGACATCATGAAAAAAAGCAATAGAAG
GAGGATTGTCAAACAGAAGCGATTTGGGTTGAAGATTATTAATCAAATGG
ATTATAATAATATATAAGGCTAGTCGAAATTAAAAACCATAGGCATNNGA
ATAATTAAAACATGTTGGAAGTAATAAAAATTAAAAGTTAAGAAAAATTC
GCAGTAGTTAGAGTCAAACAAACATCAGATTATTGAAAGTGGTTATTGTG
ATAAAGTGCACAAAGTCAAACAATCGCAGAGACTCATTGAGTGGTCATAA
CGAACATTGTTTNTTTCCGTAATAATTTGGGCGTGTAATGTGATAAATAA
CTGTAAATACAAATATACATTCGTATTATTGTGTTTTACTTTAAAGAGCA
TGTTGAGACTATTATTATTTAATTTACTAAAGCCCAATACATTTTTTCAG
CGAATCAGAATTAACTTTTGCAGATGGCTAATTTCTTANNATNNGAAGAG
CG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process