Collagen type IV alpha-3-binding protein

Overview
NameCollagen type IV alpha-3-binding protein
Smed IDSMED30018655
Length (bp)2829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen type IV alpha-3-binding protein (SMED30018655) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen type IV alpha-3-binding protein (SMED30018655) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen type IV alpha-3-binding protein (SMED30018655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen type IV alpha-3-binding protein (SMED30018655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018655SMESG000032017.1 SMESG000017536.1 SMESG000032019.1 dd_Smed_v4_5076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018655SMESG000032017.1 SMESG000017536.1 SMESG000032019.1 dd_Smed_v4_5076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018655SMESG000032017.1 SMESG000017536.1 SMESG000032019.1 dd_Smed_v4_5076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018655SMESG000032017.1 SMESG000017536.1 SMESG000032019.1 dd_Smed_v4_5076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018655SMESG000032017.1 SMESG000017536.1 SMESG000032019.1 dd_Smed_v4_5076_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Match: CERT1 (ceramide transporter 1 [Source:HGNC Symbol;Acc:HGNC:2205])

HSP 1 Score: 271.937 bits (694), Expect = 1.402e-79
Identity = 158/424 (37.26%), Postives = 236/424 (55.66%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSV----QVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+ E  + LH   S+           H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSEKVR-LHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 591          

HSP 2 Score: 190.274 bits (482), Expect = 1.169e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Match: CERT1 (ceramide transporter 1 [Source:HGNC Symbol;Acc:HGNC:2205])

HSP 1 Score: 271.937 bits (694), Expect = 1.402e-79
Identity = 158/424 (37.26%), Postives = 236/424 (55.66%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSV----QVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+ E  + LH   S+           H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSEKVR-LHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 591          

HSP 2 Score: 190.274 bits (482), Expect = 1.169e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Match: CERT1 (ceramide transporter 1 [Source:HGNC Symbol;Acc:HGNC:2205])

HSP 1 Score: 271.937 bits (694), Expect = 1.595e-79
Identity = 158/432 (36.57%), Postives = 237/432 (54.86%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVE------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 190.66 bits (483), Expect = 1.130e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Match: CERT1 (ceramide transporter 1 [Source:HGNC Symbol;Acc:HGNC:2205])

HSP 1 Score: 271.937 bits (694), Expect = 1.595e-79
Identity = 158/432 (36.57%), Postives = 237/432 (54.86%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVE------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 190.66 bits (483), Expect = 1.130e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Match: CERT1 (ceramide transporter 1 [Source:HGNC Symbol;Acc:HGNC:2205])

HSP 1 Score: 271.937 bits (694), Expect = 1.595e-79
Identity = 158/432 (36.57%), Postives = 237/432 (54.86%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVE------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 190.66 bits (483), Expect = 1.130e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Match: F25H2.6 (pep chromosome:WBcel235:I:10554366:10557838:1 gene:WBGene00009120.1 transcript:F25H2.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F25H2.6)

HSP 1 Score: 174.866 bits (442), Expect = 6.806e-46
Identity = 105/333 (31.53%), Postives = 183/333 (54.95%), Query Frame = 3
Query: 1455 MIGSPDMQEGPNCAIGEDEFFDAVDAQLD----------QMELEDER---LEAFKYLHQSQSVQVEM-PV-----------EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYV 2378
            +I  PD+    +C    DEFFDA +  +D          Q E+ED++   +   +   +  S ++E  PV           EH LY  +  +  + L Y    A++    + W + AE+G MR+Y +++E++ G+ +DPL+ IH V GVTA E  HYF+D +++M+W+ T+ E  +V+E+   D+VVLHQ +K VWP   R+S++ SHIR +D  +             +  +++++V N     +A     ++  +R+ L V +IC+T ++D +       ID   + R+ +KC ++Y S V+PGGW P + LR V ++EYP+F++ F+++V
Sbjct:  260 IIARPDIDVTSDC----DEFFDADEFDVDSKNGDTVEKRQEEVEDKKNGNIVVPEEEKKKTSFRIEGNPVTGHYDDLLVSQEHSLYTTIDKLALEQLKYALAGAED----NVWSLFAEDGPMRMYTRQIEDEGGVPVDPLKAIHAVDGVTALEFMHYFYDARYKMQWDHTL-EAMSVVEHISPDSVVLHQKHKTVWPAAPRESLFVSHIRRVDEHK------------RDGAHDLYIVCNRDIQ-RADVPLGSSSSVRVGLTVSMICETTVKDPH-------ID-RKLTRDDVKCNIIYVSQVHPGGWVPTAALRHVYKKEYPKFLRTFTEFV 562          

HSP 2 Score: 84.7297 bits (208), Expect = 1.328e-16
Identity = 44/161 (27.33%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  132 GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSA 611
            G + KWTN ++GWQ+R+F + +G L YY SK +  +GCRGSI L++A +  HE D+  F I +G++ +WYL+  +   +  W+ ++ +  +      S  + +  +   S++S  + +   +   +       KL+E+E ++ +   Q+ S++   +   A
Sbjct:   11 GVMKKWTNYVNGWQDRYFEITEGNLVYYLSKAEKSHGCRGSIFLKSAIIAAHEFDENEFSISMGENVVWYLKAENSQSKLLWMRSVVRETVQNDSDYSSTSTKSHSRNPSVSSVLATNNQKSDDNESTKLFATKLSELEAYRTMCKDQMTSIERLLEQGGA 171          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Match: F25H2.6 (pep chromosome:WBcel235:I:10554366:10557838:1 gene:WBGene00009120.1 transcript:F25H2.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F25H2.6)

HSP 1 Score: 174.866 bits (442), Expect = 6.806e-46
Identity = 105/333 (31.53%), Postives = 183/333 (54.95%), Query Frame = 3
Query: 1455 MIGSPDMQEGPNCAIGEDEFFDAVDAQLD----------QMELEDER---LEAFKYLHQSQSVQVEM-PV-----------EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYV 2378
            +I  PD+    +C    DEFFDA +  +D          Q E+ED++   +   +   +  S ++E  PV           EH LY  +  +  + L Y    A++    + W + AE+G MR+Y +++E++ G+ +DPL+ IH V GVTA E  HYF+D +++M+W+ T+ E  +V+E+   D+VVLHQ +K VWP   R+S++ SHIR +D  +             +  +++++V N     +A     ++  +R+ L V +IC+T ++D +       ID   + R+ +KC ++Y S V+PGGW P + LR V ++EYP+F++ F+++V
Sbjct:  260 IIARPDIDVTSDC----DEFFDADEFDVDSKNGDTVEKRQEEVEDKKNGNIVVPEEEKKKTSFRIEGNPVTGHYDDLLVSQEHSLYTTIDKLALEQLKYALAGAED----NVWSLFAEDGPMRMYTRQIEDEGGVPVDPLKAIHAVDGVTALEFMHYFYDARYKMQWDHTL-EAMSVVEHISPDSVVLHQKHKTVWPAAPRESLFVSHIRRVDEHK------------RDGAHDLYIVCNRDIQ-RADVPLGSSSSVRVGLTVSMICETTVKDPH-------ID-RKLTRDDVKCNIIYVSQVHPGGWVPTAALRHVYKKEYPKFLRTFTEFV 562          

HSP 2 Score: 84.7297 bits (208), Expect = 1.328e-16
Identity = 44/161 (27.33%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  132 GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSA 611
            G + KWTN ++GWQ+R+F + +G L YY SK +  +GCRGSI L++A +  HE D+  F I +G++ +WYL+  +   +  W+ ++ +  +      S  + +  +   S++S  + +   +   +       KL+E+E ++ +   Q+ S++   +   A
Sbjct:   11 GVMKKWTNYVNGWQDRYFEITEGNLVYYLSKAEKSHGCRGSIFLKSAIIAAHEFDENEFSISMGENVVWYLKAENSQSKLLWMRSVVRETVQNDSDYSSTSTKSHSRNPSVSSVLATNNQKSDDNESTKLFATKLSELEAYRTMCKDQMTSIERLLEQGGA 171          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Match: obr-4 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:O01686])

HSP 1 Score: 75.0998 bits (183), Expect = 1.481e-13
Identity = 47/173 (27.17%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYG-CRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKL 641
            ++G L+KWTNM+HGWQ R+F +++  L YY S++ +  G  RG IRL  A V     ++  F I V    ++++G  + ER +W+  +E    + SGY    ++    S                      H K++  E   F + L  +V++L+       A+      D L
Sbjct:    1 MEGPLSKWTNMVHGWQYRWFKIENDTLLYYTSREKMLKGQQRGQIRLTGAVVGIDGENNSLFTITVEGKTFHMQGRDLRERNQWVRILENSIRASSGYAKNVSVGTTPS---------------------QHFKQRTEEANEFLKTLVEKVKALEQLKSGERAVDEKKTIDSL 152          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Match: obr-4 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:O01686])

HSP 1 Score: 75.0998 bits (183), Expect = 1.481e-13
Identity = 47/173 (27.17%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYG-CRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKL 641
            ++G L+KWTNM+HGWQ R+F +++  L YY S++ +  G  RG IRL  A V     ++  F I V    ++++G  + ER +W+  +E    + SGY    ++    S                      H K++  E   F + L  +V++L+       A+      D L
Sbjct:    1 MEGPLSKWTNMVHGWQYRWFKIENDTLLYYTSREKMLKGQQRGQIRLTGAVVGIDGENNSLFTITVEGKTFHMQGRDLRERNQWVRILENSIRASSGYAKNVSVGTTPS---------------------QHFKQRTEEANEFLKTLVEKVKALEQLKSGERAVDEKKTIDSL 152          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 61.2326 bits (147), Expect = 2.786e-9
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 3
Query:  132 GKLNKWTNMLHGWQERFFYL-KDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHR 398
            G LNKWTN L G+++R+F L  +  LSYY++  +V + CRGSI LQ A V   +   C   I      ++++  +  +R++W  ++E  R
Sbjct:   65 GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKTTSC-IVISGQSQTFHVKPQNEMDRQQWTNSLEYMR 153          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Match: cert (gene:FBgn0027569 transcript:FBtr0345035)

HSP 1 Score: 263.848 bits (673), Expect = 5.448e-77
Identity = 179/476 (37.61%), Postives = 265/476 (55.67%), Query Frame = 3
Query: 1065 YKDVDCSQYEPTSRFEDLKKILKQH---------GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQ--VEMPVE--------------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDG--WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDE--NGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQ 2387
            +KD+   Q E   R+ D    + ++         G  ++DFKGE+ TF+ATT+G+LT L +C+EI+ + ++SW+R+L+REI++RR+ E+ ++ L  E+  +                                   K +    PD +EGP+  + EDEFFDAV+  LD++E ED +L  FK   QSQ  Q  V +P E                    H L+ E+  V K+ L Y    A+E   +DG  WQI A+EGE+++YK+E E + G+V+DPL+  H V+GVTARE+CHYF+  + R +WE T+ E  T+LE    DT++  Q +KR+WP +QRD+ +WSH+R+I +       N+ P        +MW+V N ST+Y A Q +   + +R+ L V+L CQT + +    G P+          R  L CK+ Y S VNPGGWAPAS LR V +REYP+F+KRF+ YVIDQ
Sbjct:  183 FKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKM-----------------------------------KRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIE-EDMQLR-FKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHY----AREGVGQDGNGWQIFADEGEIKMYKREEEVN-GLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTL-EDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITD-------NLEPG-----ARDMWVVCNNSTEY-AKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLN---------RNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQ 593          

HSP 2 Score: 134.806 bits (338), Expect = 1.634e-32
Identity = 68/169 (40.24%), Postives = 109/169 (64.50%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGD-SIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSV 629
            ++G L+KWTN ++GWQ R+  LKDG LSYYKS+ +  +GCRG+I L  A ++ HE+D+ RF++ V + + W LR  +  +R  W++ ++ ++ ++SG     +LRR  S  SL S      +  S  K   +L+EK+ E+ETFK+IL  Q+E+LQ YFD CS + +++ 
Sbjct:   42 LRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYK-ADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNA 209          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Match: cert (gene:FBgn0027569 transcript:FBtr0076717)

HSP 1 Score: 263.848 bits (673), Expect = 5.448e-77
Identity = 179/476 (37.61%), Postives = 265/476 (55.67%), Query Frame = 3
Query: 1065 YKDVDCSQYEPTSRFEDLKKILKQH---------GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQ--VEMPVE--------------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDG--WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDE--NGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQ 2387
            +KD+   Q E   R+ D    + ++         G  ++DFKGE+ TF+ATT+G+LT L +C+EI+ + ++SW+R+L+REI++RR+ E+ ++ L  E+  +                                   K +    PD +EGP+  + EDEFFDAV+  LD++E ED +L  FK   QSQ  Q  V +P E                    H L+ E+  V K+ L Y    A+E   +DG  WQI A+EGE+++YK+E E + G+V+DPL+  H V+GVTARE+CHYF+  + R +WE T+ E  T+LE    DT++  Q +KR+WP +QRD+ +WSH+R+I +       N+ P        +MW+V N ST+Y A Q +   + +R+ L V+L CQT + +    G P+          R  L CK+ Y S VNPGGWAPAS LR V +REYP+F+KRF+ YVIDQ
Sbjct:  183 FKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKM-----------------------------------KRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIE-EDMQLR-FKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHY----AREGVGQDGNGWQIFADEGEIKMYKREEEVN-GLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTL-EDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITD-------NLEPG-----ARDMWVVCNNSTEY-AKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLN---------RNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQ 593          

HSP 2 Score: 134.806 bits (338), Expect = 1.634e-32
Identity = 68/169 (40.24%), Postives = 109/169 (64.50%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGD-SIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSV 629
            ++G L+KWTN ++GWQ R+  LKDG LSYYKS+ +  +GCRG+I L  A ++ HE+D+ RF++ V + + W LR  +  +R  W++ ++ ++ ++SG     +LRR  S  SL S      +  S  K   +L+EK+ E+ETFK+IL  Q+E+LQ YFD CS + +++ 
Sbjct:   42 LRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYK-ADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNA 209          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Match: cert (gene:FBgn0027569 transcript:FBtr0332136)

HSP 1 Score: 229.565 bits (584), Expect = 1.557e-67
Identity = 140/334 (41.92%), Postives = 198/334 (59.28%), Query Frame = 3
Query: 1473 MQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQ--VEMPVE--------------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDG--WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDE--NGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            ++EGP+  + EDEFFDAV+  LD++E ED +L  FK   QSQ  Q  V +P E                    H L+ E+  V K+ L Y    A+E   +DG  WQI A+EGE+++YK+E E + G+V+DPL+  H V+GVTARE+CHYF+  + R +WE T+ E  T+LE    DT++  Q +KR+WP +QRD+ +WSH+R+I +       N+ P        +MW+V N ST+Y A Q +   + +R+ L V+L CQT + +    G P+          R  L CK+ Y S VNPGGWAPAS LR V +REYP+F+KRF+ YVIDQ  +
Sbjct:   21 IKEGPHSTLPEDEFFDAVETGLDKIE-EDMQLR-FKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHY----AREGVGQDGNGWQIFADEGEIKMYKREEEVN-GLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTL-EDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITD-------NLEPG-----ARDMWVVCNNSTEY-AKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLN---------RNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQCKD 324          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Match: Osbp (gene:FBgn0020626 transcript:FBtr0084801)

HSP 1 Score: 80.8777 bits (198), Expect = 3.299e-15
Identity = 37/95 (38.95%), Postives = 61/95 (64.21%), Query Frame = 3
Query:  108 EERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIE 389
            E+ LP ++G L KWTN + G+Q R+F L  GVLSYY+++ ++++ CRG+I L  A +  H  D C F I  G +  ++++  +  ER+ W+ A+E
Sbjct:   11 EKGLPEMKGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTISLHGALI--HTVDSCTFVISNGGTQTFHIKAGTEVERQSWVTALE 103          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Match: CG1513 (gene:FBgn0033463 transcript:FBtr0088450)

HSP 1 Score: 70.0922 bits (170), Expect = 8.162e-12
Identity = 35/92 (38.04%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  123 VIQGKLNKWTNMLHGWQERFFYLKD--GVLSYYKSKDDVHYGC-RGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIE 389
             ++G L+KWTN++ GWQ RFF L +  G+LSYY SKD +  G  RG +RL++A +   + +D  F I V    ++ +     ER++W+  +E
Sbjct:   23 TLEGTLSKWTNVMKGWQYRFFVLDENAGLLSYYTSKDKMIKGVRRGCVRLKDALIGIDDQEDNTFTITVDHKTFHFQARHNEEREQWVRRLE 114          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Match: cert1b (ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-110125-5])

HSP 1 Score: 282.337 bits (721), Expect = 7.014e-85
Identity = 164/433 (37.88%), Postives = 245/433 (56.58%), Query Frame = 3
Query: 1110 EDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKY-LHQSQSVQ----VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTA 2393
            E L + L   G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               S +S   K    G PD +EGPN  I EDEFFDAV+A LD+ +  +E+    K  + +S SV       +   H   E+V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C YFWD   R +WE TV E   ++E   ++ ++++Q +KRVWP +QRD +Y S IR+I    +A+  N P         + WLV N+S ++   Q    N+ +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA
Sbjct:  112 EKLFQCLSHKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEM--------------------EKRRRVEEAYKSALSELKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKIEEQSHCEKSRIQRSSSVPSGDVFSIVGSHRFAEKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHCVKGVTGHEVCQYFWDTDVRNDWETTV-ENFNIVETLSDNAIIIYQTHKRVWPASQRDVLYLSAIRKI----MANNENDP---------DTWLVCNFSVEHDNAQPN--NRCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNITCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTA 479          

HSP 2 Score: 77.0258 bits (188), Expect = 4.112e-14
Identity = 44/83 (53.01%), Postives = 58/83 (69.88%), Query Frame = 3
Query:  402 SESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +ESGYGSE +LRR  S     ++ +  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:    4 AESGYGSESSLRRHGSMLSLTSATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDGCADAVNK---DELQR 83          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Match: cert1b (ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-110125-5])

HSP 1 Score: 279.641 bits (714), Expect = 1.042e-83
Identity = 166/464 (35.78%), Postives = 254/464 (54.74%), Query Frame = 3
Query: 1065 YKDVDCSQYEPTSRFED---------------LKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKY-LHQSQSVQ----VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            ++D+ C Q +   ++ D               + + L   G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               S +S   K    G PD +EGPN  I EDEFFDAV+A LD+ +  +E+    K  + +S SV       +   H   E+V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C YFWD   R +WE TV E   ++E   ++ ++++Q +KRVWP +QRD +Y S IR+I    +A+  N P         + WLV N+S ++   Q    N+ +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:   96 FRDILCRQVDTLQKYFDGCADAVNKDELQRDKIFQCLSHKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEM--------------------EKRRRVEEAYKSALSELKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKIEEQSHCEKSRIQRSSSVPSGDVFSIVGSHRFAEKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHCVKGVTGHEVCQYFWDTDVRNDWETTV-ENFNIVETLSDNAIIIYQTHKRVWPASQRDVLYLSAIRKI----MANNENDP---------DTWLVCNFSVEHDNAQPN--NRCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNITCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 494          

HSP 2 Score: 115.931 bits (289), Expect = 1.242e-26
Identity = 69/168 (41.07%), Postives = 91/168 (54.17%), Query Frame = 3
Query:  147 WTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            WTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A +                                         +ESGYGSE +LRR  S     ++ +  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:    1 WTNYIHGWQDRWVVLKNNTLSYYKSQDEREYGCRGSLCLSKAVI----------------------------------------TAESGYGSESSLRRHGSMLSLTSATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDGCADAVNK---DELQR 125          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Match: cert1a (ceramide transporter 1a [Source:NCBI gene;Acc:796455])

HSP 1 Score: 263.462 bits (672), Expect = 1.018e-76
Identity = 158/426 (37.09%), Postives = 239/426 (56.10%), Query Frame = 3
Query: 1149 ALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD---QMELED--ERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
             +DFKGEA TFKATT GIL+ L +CI+I+ +RE+SW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD   Q+E +   ER  A + +  +      +  +  L  +V+ +V  H+ Y   + Q++  +  WQ++ EEG+M++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD  +R +WE TV E   V+E   +   ++HQ  KRVWP +QRD +Y S +R+I    L++  N P         + WLV N+S D+    +  + + IR  ++V +ICQT+I     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T++    F
Sbjct:  235 GIDFKGEAITFKATTAGILSTLSHCIDILVKREESWQKR-----------------LDKEI--------------------ERRRRAEDAYKAALTELKKKPHYGGPDYEEGPNSLINEEEFFDAVEAALDKHDQIEEQSQVERSRASRQISLTPDTFSSISTQKYL-TKVEEMVHSHMTY---SLQDVGGDANWQLVVEEGDMKVYRREVEEN-GIVLDPLKATHAVKGVTGHEVCHYFWDTAYRNDWETTV-ESFQVVETLSDQACIIHQTLKRVWPASQRDVLYVSVMRKI----LSTNENDP---------DTWLVCNFSVDHDG--YPPSTRCIRAKINVAMICQTLI-----SPPEGDKEIS---RDNIICKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTSSEAILF 594          

HSP 2 Score: 187.963 bits (476), Expect = 4.686e-50
Identity = 104/196 (53.06%), Postives = 137/196 (69.90%), Query Frame = 3
Query:   87 TDDDISDE-ERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS------AIVRDSVYDKLERF 650
            +D+D+  E E L  + GKL+KWTN +HGWQ+R+  LK  +LSYY+S D+  YGCRGSI L  A + PHE D+CRF+I V DSIWYLR      R++WI+ IE H+ +ESGYGSE +LRR  S     ++A+ LS ASASS K+ + L+EKLAEMETF++ILCRQV++LQ YFD C+       + RD V D+ E F
Sbjct:    9 SDEDLDPESELLDELGGKLSKWTNYIHGWQDRWIALKGNILSYYRSADEKEYGCRGSICLSKAVITPHEFDECRFDISVNDSIWYLRAEHPLLRQQWIDTIELHK-AESGYGSESSLRRHGSLLSLTSAASGLSTASASSLKKAYSLQEKLAEMETFRDILCRQVDTLQKYFDNCADTESKDELHRDKVSDEEEDF 203          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Match: cert1a (ceramide transporter 1a [Source:NCBI gene;Acc:796455])

HSP 1 Score: 263.462 bits (672), Expect = 1.018e-76
Identity = 158/426 (37.09%), Postives = 239/426 (56.10%), Query Frame = 3
Query: 1149 ALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD---QMELED--ERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
             +DFKGEA TFKATT GIL+ L +CI+I+ +RE+SW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD   Q+E +   ER  A + +  +      +  +  L  +V+ +V  H+ Y   + Q++  +  WQ++ EEG+M++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD  +R +WE TV E   V+E   +   ++HQ  KRVWP +QRD +Y S +R+I    L++  N P         + WLV N+S D+    +  + + IR  ++V +ICQT+I     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T++    F
Sbjct:  235 GIDFKGEAITFKATTAGILSTLSHCIDILVKREESWQKR-----------------LDKEI--------------------ERRRRAEDAYKAALTELKKKPHYGGPDYEEGPNSLINEEEFFDAVEAALDKHDQIEEQSQVERSRASRQISLTPDTFSSISTQKYL-TKVEEMVHSHMTY---SLQDVGGDANWQLVVEEGDMKVYRREVEEN-GIVLDPLKATHAVKGVTGHEVCHYFWDTAYRNDWETTV-ESFQVVETLSDQACIIHQTLKRVWPASQRDVLYVSVMRKI----LSTNENDP---------DTWLVCNFSVDHDG--YPPSTRCIRAKINVAMICQTLI-----SPPEGDKEIS---RDNIICKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTSSEAILF 594          

HSP 2 Score: 187.963 bits (476), Expect = 4.686e-50
Identity = 104/196 (53.06%), Postives = 137/196 (69.90%), Query Frame = 3
Query:   87 TDDDISDE-ERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS------AIVRDSVYDKLERF 650
            +D+D+  E E L  + GKL+KWTN +HGWQ+R+  LK  +LSYY+S D+  YGCRGSI L  A + PHE D+CRF+I V DSIWYLR      R++WI+ IE H+ +ESGYGSE +LRR  S     ++A+ LS ASASS K+ + L+EKLAEMETF++ILCRQV++LQ YFD C+       + RD V D+ E F
Sbjct:    9 SDEDLDPESELLDELGGKLSKWTNYIHGWQDRWIALKGNILSYYRSADEKEYGCRGSICLSKAVITPHEFDECRFDISVNDSIWYLRAEHPLLRQQWIDTIELHK-AESGYGSESSLRRHGSLLSLTSAASGLSTASASSLKKAYSLQEKLAEMETFRDILCRQVDTLQKYFDNCADTESKDELHRDKVSDEEEDF 203          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Match: cert1a (ceramide transporter 1a [Source:NCBI gene;Acc:796455])

HSP 1 Score: 262.307 bits (669), Expect = 5.390e-76
Identity = 162/451 (35.92%), Postives = 241/451 (53.44%), Query Frame = 3
Query: 1149 ALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD-------QMELEDER--------------LEAFKYL-----HQSQSVQVEMPVE----HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
             +DFKGEA TFKATT GIL+ L +CI+I+ +RE+SW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD       Q ++E  R              +   KYL     H S    V++       H    +V+ +V  H+ Y   + Q++  +  WQ++ EEG+M++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD  +R +WE TV E   V+E   +   ++HQ  KRVWP +QRD +Y S +R+I    L++  N P         + WLV N+S D+    +  + + IR  ++V +ICQT+I     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T++    F
Sbjct:  235 GIDFKGEAITFKATTAGILSTLSHCIDILVKREESWQKR-----------------LDKEI--------------------ERRRRAEDAYKAALTELKKKPHYGGPDYEEGPNSLINEEEFFDAVEAALDKHDQIEEQSQVERSRASRQISLTPDTFSSISTQKYLTKPHSHTSSLSSVDLISASDDVHRFSAQVEEMVHSHMTY---SLQDVGGDANWQLVVEEGDMKVYRREVEEN-GIVLDPLKATHAVKGVTGHEVCHYFWDTAYRNDWETTV-ESFQVVETLSDQACIIHQTLKRVWPASQRDVLYVSVMRKI----LSTNENDP---------DTWLVCNFSVDHDG--YPPSTRCIRAKINVAMICQTLI-----SPPEGDKEIS---RDNIICKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTSSEAILF 620          

HSP 2 Score: 188.348 bits (477), Expect = 5.017e-50
Identity = 104/196 (53.06%), Postives = 137/196 (69.90%), Query Frame = 3
Query:   87 TDDDISDE-ERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS------AIVRDSVYDKLERF 650
            +D+D+  E E L  + GKL+KWTN +HGWQ+R+  LK  +LSYY+S D+  YGCRGSI L  A + PHE D+CRF+I V DSIWYLR      R++WI+ IE H+ +ESGYGSE +LRR  S     ++A+ LS ASASS K+ + L+EKLAEMETF++ILCRQV++LQ YFD C+       + RD V D+ E F
Sbjct:    9 SDEDLDPESELLDELGGKLSKWTNYIHGWQDRWIALKGNILSYYRSADEKEYGCRGSICLSKAVITPHEFDECRFDISVNDSIWYLRAEHPLLRQQWIDTIELHK-AESGYGSESSLRRHGSLLSLTSAASGLSTASASSLKKAYSLQEKLAEMETFRDILCRQVDTLQKYFDNCADTESKDELHRDKVSDEEEDF 203          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Match: cert (ceramide transporter 1 [Source:NCBI gene;Acc:387331])

HSP 1 Score: 263.077 bits (671), Expect = 1.050e-76
Identity = 160/461 (34.71%), Postives = 239/461 (51.84%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD------QMELEDER---------LEAFKYLHQSQSVQ-----------VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD      Q + E  R          EA+      + VQ           V    EH    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+    +   N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  170 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEQSQSEKGRSHWPSSLPSTEAYTTAGSHRFVQAPPSCPPPTDLVSSSDEHRFRIQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDH---DNAPLNRCVRAKINIAMICQTLVSPPEGN--------KEISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 564          

HSP 2 Score: 66.6254 bits (161), Expect = 1.181e-10
Identity = 32/57 (56.14%), Postives = 40/57 (70.18%), Query Frame = 3
Query:  501 FKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            FK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   98 FKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 154          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Match: cert (ceramide transporter 1 [Source:NCBI gene;Acc:387331])

HSP 1 Score: 262.307 bits (669), Expect = 4.773e-76
Identity = 160/451 (35.48%), Postives = 238/451 (52.77%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD------QMELEDER---------LEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD      Q + E  R          EA+      + VQ    +   L   V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+  AP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  223 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEQSQSEKGRSHWPSSLPSTEAYTTAGSHRFVQAVSDILFTL--SVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDHDNAP----LNRCVRAKINIAMICQTLVSPPEGNK--------EISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 604          

HSP 2 Score: 176.792 bits (447), Expect = 4.393e-46
Identity = 93/196 (47.45%), Postives = 126/196 (64.29%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            +++D+  E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WYLR      R++WI++IEQH+            R  +    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   12 SEEDLETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYLRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 207          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Match: cert (ceramide transporter 1 [Source:NCBI gene;Acc:387331])

HSP 1 Score: 260.766 bits (665), Expect = 6.483e-76
Identity = 156/436 (35.78%), Postives = 237/436 (54.36%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD+   +D+  + F        ++  +     LY  V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+  AP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  213 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDR---QDKIEQVF--------IKSSLHYVFILYI-VEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDHDNAP----LNRCVRAKINIAMICQTLVSPPEGNK--------EISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 569          

HSP 2 Score: 168.703 bits (426), Expect = 1.532e-43
Identity = 86/175 (49.14%), Postives = 113/175 (64.57%), Query Frame = 3
Query:  147 WTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            WTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WYLR      R++WI++IEQH+            R  +    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   23 WTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYLRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 197          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Match: cert (ceramide transporter 1 [Source:NCBI gene;Acc:387331])

HSP 1 Score: 261.151 bits (666), Expect = 7.989e-76
Identity = 158/447 (35.35%), Postives = 239/447 (53.47%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQ-----------SQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ + + E++     LH              +  V    EH    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+  AP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  213 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQD-KIEQVFIKSSLHYVFILYIPPSCPPPTDLVSSSDEHRFRIQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDHDNAP----LNRCVRAKINIAMICQTLVSPPEGN--------KEISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 591          

HSP 2 Score: 169.088 bits (427), Expect = 1.516e-43
Identity = 86/175 (49.14%), Postives = 113/175 (64.57%), Query Frame = 3
Query:  147 WTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            WTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WYLR      R++WI++IEQH+            R  +    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   23 WTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYLRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 197          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Match: cert (ceramide transporter 1 [Source:NCBI gene;Acc:387331])

HSP 1 Score: 261.922 bits (668), Expect = 9.139e-76
Identity = 162/462 (35.06%), Postives = 240/462 (51.95%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD------QMELEDER---------LEAFKYLHQSQSVQ-----------VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD      Q + E  R          EA+      + VQ           V    EH    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+  AP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  223 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEQSQSEKGRSHWPSSLPSTEAYTTAGSHRFVQAPPSCPPPTDLVSSSDEHRFRIQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDHDNAP----LNRCVRAKINIAMICQTLVSPPEGN--------KEISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 617          

HSP 2 Score: 177.178 bits (448), Expect = 4.299e-46
Identity = 93/196 (47.45%), Postives = 126/196 (64.29%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            +++D+  E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WYLR      R++WI++IEQH+            R  +    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   12 SEEDLETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYLRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 207          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Match: Col4a3bp (collagen, type IV, alpha 3 (Goodpasture antigen) binding protein [Source:MGI Symbol;Acc:MGI:1915268])

HSP 1 Score: 269.626 bits (688), Expect = 5.661e-79
Identity = 166/432 (38.43%), Postives = 251/432 (58.10%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVE------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +RE+SW++R DRE+E+RR+VEE  + + +EL                                      K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREVEKRRRVEEAYKNVMEEL-------------------------------------KKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTSLPSGDTFSSVGTHRFVQKVEEMVQNHMNY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINIAMICQTLV-----SPPEGDQEIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 189.504 bits (480), Expect = 1.608e-50
Identity = 99/189 (52.38%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++W++AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPEHRQQWVDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDVCADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Match: Col4a3bp (collagen, type IV, alpha 3 (Goodpasture antigen) binding protein [Source:MGI Symbol;Acc:MGI:1915268])

HSP 1 Score: 269.626 bits (688), Expect = 5.661e-79
Identity = 166/432 (38.43%), Postives = 251/432 (58.10%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVE------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +RE+SW++R DRE+E+RR+VEE  + + +EL                                      K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREVEKRRRVEEAYKNVMEEL-------------------------------------KKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTSLPSGDTFSSVGTHRFVQKVEEMVQNHMNY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINIAMICQTLV-----SPPEGDQEIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 189.504 bits (480), Expect = 1.608e-50
Identity = 99/189 (52.38%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++W++AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPEHRQQWVDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDVCADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Match: Col4a3bp (collagen, type IV, alpha 3 (Goodpasture antigen) binding protein [Source:MGI Symbol;Acc:MGI:1915268])

HSP 1 Score: 261.151 bits (666), Expect = 1.300e-75
Identity = 168/451 (37.25%), Postives = 253/451 (56.10%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKY-LHQSQSVQ-------------VEMPVE-----------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +RE+SW++R DRE+E+RR+VEE  + + +EL                                      K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+ ++ K  LH   S+              V+ P                   H    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREVEKRRRVEEAYKNVMEEL-------------------------------------KKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDTFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMNY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINIAMICQTLV-----SPPEGDQEIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 619          

HSP 2 Score: 189.889 bits (481), Expect = 2.060e-50
Identity = 99/189 (52.38%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++W++AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPEHRQQWVDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDVCADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Match: Plekha3 (pleckstrin homology domain-containing, family A (phosphoinositide binding specific) member 3 [Source:MGI Symbol;Acc:MGI:1932515])

HSP 1 Score: 90.1225 bits (222), Expect = 4.172e-19
Identity = 46/160 (28.75%), Postives = 88/160 (55.00%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAIEQHR--ISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYF 596
            ++G L KWTN L GWQ R+F L +G+LSYY S+DDV  G +GSI++    ++ H AD+ R E+ + G+  +Y++  +  ER++W+ A+   +  ++++    E+ +                       + +  LK K++E+  + ++L +QV ++Q + 
Sbjct:    1 MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHPADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTAKEKEIS----------------------ETSESLKTKMSELRLYCDLLMQQVHTIQEFV 138          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Match: Plekha8 (pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8 [Source:MGI Symbol;Acc:MGI:2681164])

HSP 1 Score: 85.5001 bits (210), Expect = 9.170e-17
Identity = 48/168 (28.57%), Postives = 89/168 (52.98%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDS 626
            ++G L KWTN L GWQ R+F L  G+LSYY S +D   GC+GSI++    ++ H  D+ R ++ + G+  +YL+  S+ ER++W+ A+     S     ++   +++  +                 +   +LK K++E+  + ++L +QV+  +   +  +A V DS
Sbjct:    1 MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTRMDLIIPGEQYFYLKARSVAERQRWLVALG----SAKACLTDSRTQKEKEFA----------------ENTENLKTKMSELRLYCDLLVQQVDKTK---EVATAGVTDS 145          
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Match: sp|Q6VVX2|CERT_CRIGR (Ceramide transfer protein OS=Cricetulus griseus OX=10029 GN=CERT1 PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.058e-77
Identity = 158/432 (36.57%), Postives = 241/432 (55.79%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPV------------EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +RE+SW++R D+E+              ++   L+  Y                        + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+        QS+ V++  P              H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDKEM--------------EKRRRLEEAY-----------------------KNAMAELKKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQ-------SQSEKVRLHWPTPLPSGDAFSSVGTHRFVQKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWSVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 593          

HSP 2 Score: 190.274 bits (482), Expect = 7.209e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDVCADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Match: sp|Q9GKI7|CERT_BOVIN (Ceramide transfer protein OS=Bos taurus OX=9913 GN=CERT1 PE=2 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 3.146e-76
Identity = 169/453 (37.31%), Postives = 248/453 (54.75%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKY-LHQSQSVQ-------------VEMPVE-----------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSA---NQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R+D+E E+RR+VEE  +    EL                                      K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+ ++ K  LH S S+              V+ P                   H    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D     H+SA   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRMDKETEKRRRVEEAYKNAMTEL-------------------------------------KKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWSTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDGVHRFSSQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKI-------------PALNENDPETWIVCNFSVD-----HSSAPLNNRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 619          

HSP 2 Score: 188.734 bits (478), Expect = 3.593e-49
Identity = 97/182 (53.30%), Postives = 132/182 (72.53%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS-AIVRD 623
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ +FD C+ A+ +D
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKFFDACADAVSKD 192          
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Match: sp|Q6NRZ4|CERT_XENLA (Ceramide transfer protein OS=Xenopus laevis OX=8355 GN=cert1 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.567e-75
Identity = 157/443 (35.44%), Postives = 236/443 (53.27%), Query Frame = 3
Query: 1149 ALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQME----LEDER-----------LEAFKYLHQSQSVQ-----------VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
             +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +     + E+            EA       + VQ           V    EH    +V+++V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C YFW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+ KAP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA+
Sbjct:  237 GIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIELCQSEKGRSHWPPSPPSSEAHTAAGSHRLVQAPPSCPPPTDLVSSSDEHRFRIQVEDMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQYFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRVV-------------PAASENEMDTWIVCNFSVDHDKAP----LNRCVRAKINIAMICQTLVSPPEGN--------KEISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAD 612          

HSP 2 Score: 173.711 bits (439), Expect = 3.073e-44
Identity = 93/196 (47.45%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            +++D+  E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WY+R      R++WI++IEQH+            R  +    ++ A+S S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   12 SEEDLEPESGPPVERCGVLSKWTNYIHGWQDRWVDLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYIRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASSYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACAGAVSKDELERDKVEDDEDDFL 207          
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Match: sp|Q9Y5P4|CERT_HUMAN (Ceramide transfer protein OS=Homo sapiens OX=9606 GN=CERT1 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.917e-75
Identity = 160/451 (35.48%), Postives = 239/451 (52.99%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKY-LHQSQSVQ-------------VEMPVE-----------------HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            G + +DFKGEA TFKATT GIL  L +CIE+M +REDSW++R                 L +E                          T     + ++   K    G PD +EGPN  I E+EFFDAV+A LD+ +  +E+ ++ K  LH   S+              V+ P                   H    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C+YFW+V  R +WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR+I             P   E     W+V N+S D+  AP +   N+ +R  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  235 GINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKR-----------------LDKE--------------------TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTI-ENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKI-------------PALTENDPETWIVCNFSVDHDSAPLN---NRCVRAKINVAMICQTLVSPPEGN--------QEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 619          

HSP 2 Score: 190.274 bits (482), Expect = 8.499e-50
Identity = 100/189 (52.91%), Postives = 134/189 (70.90%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
            +++D   E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PH+ D+CRF+I V DS+WYLR      R++WI+AIEQH+ +ESGYGSE +LRR  S    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V     D+L+R
Sbjct:   12 SEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHK-TESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSK---DELQR 196          
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Match: sp|Q6P3Q6|CERT_XENTR (Ceramide transfer protein OS=Xenopus tropicalis OX=8364 GN=cert1 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 4.841e-75
Identity = 162/462 (35.06%), Postives = 240/462 (51.95%), Query Frame = 3
Query: 1119 KKILKQH----GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD------QMELEDER---------LEAFKYLHQSQSVQ-----------VEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDY-KAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            K  L QH    G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+                               + ++   K    G PD +EGPN  I E+EFFDAV+A LD      Q + E  R          EA+      + VQ           V    EH    +V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+C +FW+V  R +WE T+ E   V+E    + ++++Q +KRVWP +QRD +Y S IR +             P  +E   + W+V N+S D+  AP     N+ +R  +++ +ICQT++    G           + R+ ++CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA     F
Sbjct:  223 KDKLFQHVSPKGINGIDFKGEAITFKATTAGILATLSHCIDLMVKREDSWQKR-----------------LDKEI--------------------EKRRRVEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEQSQSEKGRSHWPSSLPSTEAYTTAGSHRFVQAPPSCPPPTDLVSSSDEHRFRIQVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCQHFWNVDVRNDWETTI-ENFHVVEKLSPNAIIVYQTHKRVWPASQRDVLYLSAIRMV-------------PAASENEMDTWIVCNFSVDHDNAP----LNRCVRAKINIAMICQTLVSPPEGN--------KEISRDNIQCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKSILF 617          

HSP 2 Score: 177.178 bits (448), Expect = 2.278e-45
Identity = 93/196 (47.45%), Postives = 126/196 (64.29%), Query Frame = 3
Query:   87 TDDDISDEERLPVIQ-GKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV------RDSVYDKLERFL 653
            +++D+  E   PV + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGSI L  A + PHE D+CRF+I V DS+WYLR      R++WI++IEQH+            R  +    ++ A+  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD C+  V      RD V D  + FL
Sbjct:   12 SEEDLETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHEFDECRFDISVNDSVWYLRAQDPDHRQRWIDSIEQHKSESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELERDKVEDDEDDFL 207          
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Match: A0A5J4NLI0 (Collagen type IV alpha-3-binding protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006558 PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 367/878 (41.80%), Postives = 519/878 (59.11%), Query Frame = 3
Query:   87 TDDDISDEE---RLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV--RDSVYDKLERFLIXXXXXXXXXXXLANEYRIGLDARQHNXXXXXXXXXXXXXXXXXMPMPTIIANGQ------------IESANNGTIFEDARENMP-----ETAVGLDLSTSEKASTPTKENNT-----TSQLTQPTR------GFLSKFFP-FRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELA------------ILQNQYMXXXXXXXXXXXXXX-XXXTVSRISSTIS-----------NTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLI-YCDP------------------------TAQELRIEDG-WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREID------------------NEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHT-SANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            + + +SDEE    +PV +G L+KWTN+LHGWQER+F L DG L+YY+++D+ + G RGS+R++ AFV+PHE DDCRFE+RVG+ IWYLRG ++ +R+ WI AIE+HR++ESGYGSE+ L R NS HSLNS  S SIASASSFKR H L+EKLAEMETFKEILC+QV+SLQ YFD C+A+V  + S+ D+LE +L         D  L N     LD  +            +    +  P    +A+              ++SA++    +   E MP      T V    ST  + S   + + T     T+  TQ T+      GFLS+F P FRS+           ++  + P      +   +   SR  DL++ILK HG HALDF+GE++ FKATT GILTNL + IE+MQQ E+ WRRRL+RE+E+RR++EE  R ++QE+A             LQ+Q + +    G+     S     + R+ ST+            +   +  +  PD +EGPN  I E+EF+DA+DA+ D++E +  RL A + + +       MP  HPL+ +++ VV   +  + +P                        TA +     G WQ++ +EGEM IYK+EVE ++G+VLDPL+ +H V GVTARE+C YFWDV++RM+WE TVD+ PTVLE CG+DTVVLHQVYKRVWPTTQRDS++WSHIR+++                  +E   +V   P         + W+V+N ST+Y A + T ++  MIRL LDVVL CQT+++ E    +      T +PR++L+ +L+Y +++NPGGW PA+ LRT+ARREYPRF++RFS YV +QT +  P F
Sbjct:    7 SGEGVSDEEVWAPMPV-RGVLSKWTNLLHGWQERYFVLSDGTLTYYRNEDETNLGSRGSVRIRTAFVKPHEYDDCRFEVRVGELIWYLRGVNVAQRQSWIAAIERHRVAESGYGSERTLHRPNSLHSLNSTHSPSIASASSFKRGHGLREKLAEMETFKEILCKQVDSLQAYFDACNAVVAHQHSIDDRLEDWL--------KDGELTNLDE--LDWLEDRGDSVRGQIPTTYSYSSDAPHTDFVADSNQRYHQQQPFLDLVDSADDHWKQKAEVETMPLNNSISTTVLPPHSTRSEVSVAVQGDKTGTPSTTAVETQSTKSAGSSGGFLSRFLPSFRSSNTAISTKHCSDTTRDVKP------EAQHFRSLSRVSDLRRILKHHGAHALDFRGESHMFKATTVGILTNLAHTIEMMQQHEEQWRRRLEREVEKRRRMEETQRAMAQEMAQLRQLLGLRSVTQLQSQTIGTTLRGGHHTRLQSCGQLDLHRLQSTVDFPSDRRPQRTPDNRALFNLVGPDFEEGPNSPIREEEFYDAIDAESDKIEQDAARLAALRSVGKLLRSAQAMPPTHPLHADLEQVVADRIRNFANPQAFQPPISRNTSDLSTFQAGIVANTAVDAHTAGGDWQVLTQEGEMIIYKREVETEDGVVLDPLQAVHVVHGVTAREMCTYFWDVQYRMDWEFTVDQAPTVLEVCGDDTVVLHQVYKRVWPTTQRDSLFWSHIRQVNGHSDPSNGPLHRPSFLAADEHSQNVSKPPTAPDTNVALDSWMVVNMSTNYLADKVTCTSTPMIRLGLDVVLYCQTVVDAELAQSVVPTGHATIIPRDQLRTRLVYVANINPGGWVPAAGLRTLARREYPRFLRRFSAYVQEQTRDKIPLF 867          
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Match: A0A0X3P0E3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR117176 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 2.806e-154
Identity = 311/836 (37.20%), Postives = 460/836 (55.02%), Query Frame = 3
Query:   66 SHENLYLTD-DDISDEE-RLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFLIXXXXXXXXXXXLANEYRIGLDARQHNXXXXXXXXXXXXXXXXXMPMPTIIANGQIESANNGTIFEDARENMP-ETAVGLDLSTSEKASTPTKENNTTSQLTQPTRG-FLSKFFPFRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELA--------------------ILQNQYMXXXXXXXXXXXXXXXXXTVS-----RISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHL----IYCDPTAQELRIE-DGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQ-HTSANQMIRLVLDVVLICQTI------IEDENGTPITADIDITT-------------VPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            S E L  +D +D SDEE R P ++G LNKWTN+LHGWQER+F LKDGVLSYY+S+ ++  GCRGSIRL+NA V+ H  DDCR ++ +GDS WY R SS   R++WI  IE+HR++ESGY S+ ++   NS +SL++            KR+  + +K+ E+E  K+ + RQ + LQ YFD C AI  ++   +   F++D           +  ++  LD    ++    +  S    S    P    +A+       N  +   AR      +AV  D  +S++    T +       + P RG F S+  PFRS+   G        S T + V  +    ++    +R  DLK +L Q+G +A++FK E+  FKAT + +L  L    E  QQRED WRRRL+RE ERRRK E++   L Q+ A                    IL    M        S +   +  T+       +S+  SN  KM++I  P  QEGP+  + E++F+DA+DAQL++M  ++  L A K +         MP  HPLY EV  V ++ +     +  P         +GW ++A++GEM IY +EVE+ +G  LDPL+ IH V  VTARE+C  FWDV++R++WEIT+D  P+V+E CG++TV+ +Q YKR+WP TQRDS++WSHIR +D +         P +  +   + W+V NYST Y   +   SA+ +IR+ +DV L CQT+      +++E      A +D+T              V R  ++C+LLYAS +NPGGWAPA+++RT+A+REYP F++R S +VI  T + QP F
Sbjct:   35 SPERLLGSDVEDSSDEETRPPTVKGNLNKWTNILHGWQERYFVLKDGVLSYYRSEAEMDQGCRGSIRLRNAHVQAHPYDDCRIDVSLGDSTWYFRCSSESVRQQWISGIEKHRLAESGYSSKCSMLSLNSINSLSTNG----------KRSQSMSDKMIELERLKDSINRQTDRLQLYFDACHAIALEA---QQNEFVLD-----------SGRFQDILDRETLDNLLTPTPKSSFDESLVDFPPDGDLADADANFGRNTPLVRSARSTQSIGSAVEEDSPSSDEGGKQTPKATIYRAPSPPARGGFFSRLLPFRSSSNAG-------QSKTSDSVKSR---ANRESSNTRMHDLKLLLNQYGSYAVNFKVESLQFKATCSDMLMKLMQFTEAAQQREDYWRRRLERESERRRKAEDMVTGLLQDSATAGSHFRPFRANHIPTQAASILPAVRMGPGKAHQRSHSHGGAIGTLPTNNGMAVSTVTSNDVKMMLITEPGYQEGPDFNMAEEQFYDAIDAQLEKMRQDEAYLAALKSVGDKLRSANAMPSTHPLYNEVSKVCEERMDIFRGFPGPNDDGAACSGEGWNVVAKQGEMTIYNREVESADGNYLDPLQAIHTVHKVTAREMCEAFWDVQYRLDWEITIDHAPSVIEICGDNTVLQYQAYKRIWPATQRDSLFWSHIRRLDLKDFPGSERKSPSD--DIVLDNWMVCNYSTKYGEDRIPASASPLIRIEVDVELFCQTVWTPPAEMQEE-----LASLDLTQLSEAEFDEFVRSRVDRSTVRCRLLYASQINPGGWAPAAIVRTMAKREYPHFLQRISSFVISHTTDKQPHF 829          
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Match: A0A1S8WT59 (START domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06628 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.595e-121
Identity = 236/563 (41.92%), Postives = 342/563 (60.75%), Query Frame = 3
Query:  903 SEKASTPTKENNTTSQLTQPTRG-FLSKFFP-FRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQ------------------NQYMXXXXXXXXXXXXXXXXXTV------SRISST------------ISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVK---KHLIYCD---PTAQELR---------------IEDG------WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNE-QLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQ-HTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQT 2390
            + +  TPT +  T +    PT G F S+F P FRS+  T P A     S+  + ++ + + C Q  P+ RF D+++ILKQHG HA DF+GE++ FKAT  GILTNL + IE+M Q E+ WR+RL+RE E+RR++EE  R ++QE+A L+                  N +MTS +        + S   +      + + ST            ++    +  +  PD +EGPN  I ++EF+DA+DA+ D++E +  RL A K + +       MP  HPL+ E++  V    ++    D   P  Q+L+                +DG      WQ++ ++G+M IYK+EVE ++G+VLDPL+ +H V GVTAREIC YFWDV++RM+WE TVD PPTVLE CG+DTVVLHQVYKRVWPTTQRDS++WSH+R++    Q +S  N P  +      + W+V+N STDY + +   S+  MIRL LDVVL CQT+I  ++   IT ++ I ++PR+RL+ +L+Y +++NPGGW PA+ LRT+ARREYPRF+KRFS YV +QT
Sbjct:  203 ASRQGTPTVKPTTNA----PTSGGFFSRFLPSFRSSSSTQPVAVKAPQSSDADQLSTEHLPCEQPRPSCRFNDIQRILKQHGAHAPDFRGESHMFKATAVGILTNLSHTIELMVQHEEQWRKRLEREAEKRRRLEETQRAMAQEMAHLRHLIGLSSVSHSNSATALWNPFMTSGSAHFGGHARLKSCGQLELRHLHAGLDSTGLSHGPAPPQTPVTANRTLFNLVGPDFEEGPNSVIRDEEFYDAIDAESDRIEQDAARLAALKSVGKLLRSAQAMPTTHPLHAELEQAVTERIRNFANTDAFQPPGQQLQPLQHHPSGLVDTFGQSDDGTQTIGDWQVVTQDGDMIIYKREVETEDGVVLDPLQAVHTVPGVTAREICTYFWDVQYRMDWEFTVDRPPTVLEVCGDDTVVLHQVYKRVWPTTQRDSLFWSHLRQVSVPFQSSSEGNGPVTSDRVTVLDSWMVVNMSTDYLSEKIAESSTPMIRLGLDVVLFCQTVI--DSSVAITHNVSIDSLPRDRLRTRLVYVANINPGGWVPAAGLRTLARREYPRFLKRFSAYVQEQT 759          

HSP 2 Score: 129.028 bits (323), Expect = 8.606e-27
Identity = 73/114 (64.04%), Postives = 91/114 (79.82%), Query Frame = 3
Query:  312 IRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFL 653
            +RVG+ IWYLRG++  +R+ WI AIE+HR++ESGYGSE+ L R +S  SLNS  S SIASASS+K  H L+EKLAEMETFKEILC+QV+SLQ YFD CSA V+ S  D+LE +L
Sbjct:    1 VRVGELIWYLRGTNSGQRQSWIAAIERHRVAESGYGSERTLHRPSSLMSLNSGHSPSIASASSYKWGHRLREKLAEMETFKEILCKQVDSLQAYFDACSAAVQHSSPDRLEDWL 114          
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Match: A0A074Z6Q0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10410 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 4.027e-120
Identity = 236/563 (41.92%), Postives = 342/563 (60.75%), Query Frame = 3
Query:  903 SEKASTPTKENNTTSQLTQPTRG-FLSKFFP-FRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQ------------------NQYMXXXXXXXXXXXXXXXXXTV------SRISST------------ISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVK---KHLIYCD---PTAQELR---------------IEDG------WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNE-QLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQ-HTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQT 2390
            + +  TPT +  T +    PT G F S+F P FRS+  T P A     S+  + ++ + + C Q  P+ RF D+++ILKQHG HA DF+GE++ FKAT  GILTNL + IE+M Q E+ WR+RL+RE E+RR++EE  R ++QE+A L+                  N +MTS +        + S   +      + + ST            ++    +  +  PD +EGPN  I ++EF+DA+DA+ D++E +  RL A K + +       MP  HPL+ E++  V    ++    D   P  Q+L+                +DG      WQ++ ++G+M IYK+EVE ++G+VLDPL+ +H V GVTAREIC YFWDV++RM+WE TVD PPTVLE CG+DTVVLHQVYKRVWPTTQRDS++WSH+R++    Q +S  N P  +      + W+V+N STDY + +   S+  MIRL LDVVL CQT+I  ++   IT ++ I ++PR+RL+ +L+Y +++NPGGW PA+ LRT+ARREYPRF+KRFS YV +QT
Sbjct:  333 ASRQGTPTVKPTTNA----PTSGGFFSRFLPSFRSSSSTQPVAVKAPQSSDADQLSTEHLPCEQPRPSCRFNDIQRILKQHGAHAPDFRGESHMFKATAVGILTNLSHTIELMVQHEEQWRKRLEREAEKRRRLEETQRAMAQEMAHLRHLIGLSSVSHSNSATALWNPFMTSGSAHFGGHARLKSCGQLELRHLHAGLDSTGLSHGPAPPQTPVTANRTLFNLVGPDFEEGPNSVIRDEEFYDAIDAESDRIEQDAARLAALKSVGKLLRSAQAMPTTHPLHAELEQAVTERIRNFANTDAFQPPGQQLQPLQHHPSGLVDTFGQSDDGTQTIGDWQVVTQDGDMIIYKREVETEDGVVLDPLQAVHTVPGVTAREICTYFWDVQYRMDWEFTVDRPPTVLEVCGDDTVVLHQVYKRVWPTTQRDSLFWSHLRQVSVPFQSSSEGNGPVTSDRVTVLDSWMVVNMSTDYLSEKIAESSTPMIRLGLDVVLFCQTVI--DSSVAITHNVSIDSLPRDRLRTRLVYVANINPGGWVPAAGLRTLARREYPRFLKRFSAYVQEQT 889          

HSP 2 Score: 228.794 bits (582), Expect = 5.946e-59
Identity = 123/204 (60.29%), Postives = 156/204 (76.47%), Query Frame = 3
Query:   66 SHENLYL----TDDDISDEER----LPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFL 653
            S ENL      +D+D S+E      LP I G L+KWTN+LHGWQER+F L DG L+YY+S+D++  G RGS+R++ AFV+PHE DDCRFE+RVG+ IWYLRG++  +R+ WI AIE+HR++ESGYGSE+ L R +S  SLNS  S SIASASS+K  H L+EKLAEMETFKEILC+QV+SLQ YFD CSA V+ S  D+LE +L
Sbjct:   42 SQENLTAGSSASDEDQSEESDVWAPLP-ISGVLSKWTNLLHGWQERYFVLSDGTLTYYRSEDEIGLGSRGSVRIRTAFVKPHEYDDCRFEVRVGELIWYLRGTNSGQRQSWIAAIERHRVAESGYGSERTLHRPSSLMSLNSGHSPSIASASSYKWGHRLREKLAEMETFKEILCKQVDSLQAYFDACSAAVQHSSPDRLEDWL 244          
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Match: A0A3R7FUS0 (Collagen type IV alpha-3-binding protein OS=Clonorchis sinensis OX=79923 GN=COL4A3BP PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 5.208e-118
Identity = 232/557 (41.65%), Postives = 335/557 (60.14%), Query Frame = 3
Query:  918 TPTKENNTTSQLTQPTRGFLSKFFP-FRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQ------------------NQYMXXXXXXXXXXXXXXXXXTV------SRISST------------ISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHL-------IYCDPTAQEL--------------RIEDG------WQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNE-QLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQ-HTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQT 2390
            TPT +  T    T  + GF S+F P FRS+  T P A     S+    ++ + + C Q+ P+ RF D+++ILKQHG HA DF+GE++ FKAT  GILTNL + IE+M Q E+ WR+RL+RE E+R +++E  R ++QE+A L+                  N +MTS +        + S   +      + + ST            ++    +  +  PD +EGPN  I ++EF+DA+DA+ D++E +  RL A K + +       MP  HPL+ E++  V + +        +  P  Q                + +DG      WQ+I ++G+M IYK+EVE ++G+VLDPL+ +H V GVTAREIC YFWDV++RM+WE TVD PPTVLE CG+DTVVLHQVYKRVWPTTQRDS++WSH+R++    Q +S  N    +      + W+V+N STDY + +   S+  MIRL LDVVL CQT+I  ++   IT +I I ++PR+RL+ +L+Y +++NPGGW PA+ LRT+ARREYPRF+KRFS YV +QT
Sbjct:  338 TPTVKPTTN---TPTSGGFFSRFLPSFRSSNSTQPVAVKTPQSSDAEHLSTEHLPCEQHRPSCRFNDIQRILKQHGAHAPDFRGESHMFKATAVGILTNLSHTIELMVQHEEQWRKRLEREAEKRHRIDETQRAMAQEMAHLRHLIGLSSVSHSNSATALWNPFMTSGSAHLGGHARLKSCGQLELRHLHAGLDSTGLSHAPAPPQTPVTANRTLFNLVGPDFEEGPNSVIRDEEFYDAIDAESDRIEQDAARLAALKSVGKLLRSAQAMPTTHPLHAELEQAVTERIRNFANTDAFQPPGQQLQPLQHQLSGLVDAFGQSDDGTQTIGDWQVITQDGDMVIYKREVETEDGVVLDPLQAVHTVPGVTAREICTYFWDVQYRMDWEFTVDRPPTVLEVCGDDTVVLHQVYKRVWPTTQRDSLFWSHLRQVSVPFQPSSEGNSSVTSDRVTVLDSWMVVNMSTDYLSEKIAESSTPMIRLGLDVVLFCQTVI--DSSLAITHNISIDSLPRDRLRTRLVYVANINPGGWVPAAGLRTLARREYPRFLKRFSAYVQEQT 889          

HSP 2 Score: 228.409 bits (581), Expect = 9.270e-59
Identity = 123/204 (60.29%), Postives = 156/204 (76.47%), Query Frame = 3
Query:   66 SHENLYL----TDDDISDEER----LPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFL 653
            S ENL      +D+D S+E      LP I G L+KWTN+LHGWQER+F L DG L+YY+S+D++  G RGS+R++ AFV+PHE DDCRFE+RVG+ IWYLRG++  +R+ WI AIE+HR++ESGYGSE+ L R +S  SLNS  S SIASASS+K  H L+EKLAEMETFKEILC+QV+SLQ YFD CSA V+ S  D+LE +L
Sbjct:   42 SEENLTAGSSASDEDQSEESDVWAPLP-ISGVLSKWTNLLHGWQERYFVLSDGTLTYYRSEDEIGLGSRGSVRIRTAFVKPHEYDDCRFEVRVGELIWYLRGTNSGQRQSWIAAIERHRVAESGYGSERTLHRPSSLMSLNSGHSPSIASASSYKWGHRLREKLAEMETFKEILCKQVDSLQAYFDACSAAVQHSPPDRLEDWL 244          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Match: cert1b (ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-110125-5])

HSP 1 Score: 281.567 bits (719), Expect = 2.603e-83
Identity = 173/434 (39.86%), Postives = 254/434 (58.53%), Query Frame = 3
Query: 1110 EDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPV-----EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            E L + L   G + +DFKGEA TFKATT GIL  L +C+++M +REDSW+RRLD+E E+RR+VEE  +T   EL                                      K    G PD +EGPN  I EDEFFDAV+A LD+ +  +E+ +  K   Q  S    +        H   E+V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD   R +WE TV E   ++E   ++ ++++Q +KRVWP +QRD +Y S IR+I    +A+  N P         + WLV N+S D+   Q +S  + +R  +++ +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA 
Sbjct:  229 EKLFQSLSTKGINGIDFKGEAITFKATTAGILATLSHCLDLMVKREDSWQRRLDKETEKRRRVEEAYKTALSEL-------------------------------------KKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKIEEQTQTEKSRIQRLSPMPSLDAYSVMGTHRFAEKVEEMVQSHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHAVKGVTGHEVCHYFWDTDVRNDWETTV-ENFNIVETLSDNAIIVYQTHKRVWPASQRDVLYLSAIRKI----IANNENDP---------DTWLVCNFSVDHDNAQPSS--RCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAG 597          

HSP 2 Score: 186.037 bits (471), Expect = 2.286e-49
Identity = 96/175 (54.86%), Postives = 124/175 (70.86%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLER 647
              G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A + PHE D+CR +I V DS+WYLR      R +WI++IEQHR+ ESGYGSE +LRR  S     ++ +S S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD CS  V     D+L+R
Sbjct:   29 FSGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSQDEREYGCRGSLCLSKAVITPHEFDECRLDISVNDSVWYLRAMDPEHRNQWIDSIEQHRV-ESGYGSESSLRRHGSMLSLTSATSSYSATSTSSFKKGHSLQEKLAEMETFRDILCRQVDTLQKYFDACSDAVSK---DELQR 199          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Match: cert1a (ceramide transporter 1a [Source:NCBI gene;Acc:796455])

HSP 1 Score: 234.572 bits (597), Expect = 9.939e-67
Identity = 126/314 (40.13%), Postives = 194/314 (61.78%), Query Frame = 3
Query: 1479 EGPNCAIGEDEFFDAVDAQLDQ---MELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            EGPN  I EDEFFDAV+A LD+   +E + E+    + +  S      +   H    +V+ +V+ H+ Y   + Q++  +  WQ+I EEGEM++Y++EVE + G+VLDPL+  H V+GVT  E+CHYFWD   R +WE TV E  TV+E   +  V+++Q +KRVWP +QRD +Y S +R+I    L++  N P         + WLV N+S D+ +  +  +++ IR  ++V +ICQT++    G           + R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T+++   F
Sbjct:  278 EGPNSLINEDEFFDAVEAALDKQDKIEEQSEKCRTPRPITLSPDTYCSLSA-HRYSTKVEEMVQSHMTY---SLQDVGGDANWQLITEEGEMKVYRREVE-ENGVVLDPLKATHAVKGVTGHEVCHYFWDTAFRNDWETTV-EHFTVVEALSDQAVIIYQTHKRVWPASQRDVLYLSVMRKI----LSTNENEP---------DTWLVCNFSVDHDS--YAPSSRCIRAKINVAMICQTLVSPPEGNK--------EISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTSDNAILF 562          

HSP 2 Score: 122.865 bits (307), Expect = 1.209e-28
Identity = 74/175 (42.29%), Postives = 109/175 (62.29%), Query Frame = 3
Query:   90 DDDISDEERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSA 611
            +D  ++ E++  + G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A           F + + +S W    + I+     +  +     +ESGYGSE +LR   S     ++A+ LS  S SSF+++H L+EKLAEMETF++ILCRQV +LQ YFD C++
Sbjct:   13 EDVDTESEQMYELGGTLSKWTNYIHGWQDRWVVLKNNTLSYYKSQDEREYGCRGSLCLSKAV----------FTLDLSNSYWI---TYIHLNPDCVCLLCLQ--AESGYGSESSLRHHGSMVSLTSAASGLSTTSTSSFRKDHSLREKLAEMETFRDILCRQVNTLQKYFDNCAS 172          

HSP 3 Score: 57.7658 bits (138), Expect = 3.964e-8
Identity = 32/67 (47.76%), Postives = 39/67 (58.21%), Query Frame = 3
Query: 1056 PVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSW 1256
            P    D DC     +S+ E L       G   +DFKGEA TFKATT GIL+ L +CIEIM +RE+ W
Sbjct:  192 PTVRPDGDCLLNNNSSK-EKLFPSSSPRGPTGIDFKGEAITFKATTAGILSTLSHCIEIMVKREERW 257          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Match: plekha3 (pleckstrin homology domain containing A3 [Source:NCBI gene;Acc:103027880])

HSP 1 Score: 85.1149 bits (209), Expect = 1.595e-17
Identity = 45/159 (28.30%), Postives = 85/159 (53.46%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFD 599
            ++G L KWTN + GWQ R+F L  G++SYY S+DDV  G +GSI++    ++ H  D+ R E+ + G+  +Y++  +  ER+KW+ A+     S++G   ++  + +                    +    LK K++E+  + ++L +QV ++Q   +
Sbjct:    1 MEGVLYKWTNYMTGWQPRWFVLDSGIISYYDSQDDVCKGSKGSIKMSVCEIKVHPTDNTRLELIIPGEQHFYVKAVNAAERQKWLVALGS---SKAGLVDKRTKKERE-----------------LTETTESLKTKMSELRLYCDLLMQQVHTIQESVE 139          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 73.559 bits (179), Expect = 7.753e-13
Identity = 36/88 (40.91%), Postives = 57/88 (64.77%), Query Frame = 3
Query:  129 QGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIE 389
            +G L KWTN + G+Q R+F L +G+LSYY+++ ++ + CRG+I L  A +     D C F I  G +  ++L+ SS  ER++WI A+E
Sbjct:   16 KGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVE--DSCNFVISNGGAQTYHLKASSEVERQRWITALE 101          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 73.559 bits (179), Expect = 7.795e-13
Identity = 36/88 (40.91%), Postives = 57/88 (64.77%), Query Frame = 3
Query:  129 QGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIE 389
            +G L KWTN + G+Q R+F L +G+LSYY+++ ++ + CRG+I L  A +     D C F I  G +  ++L+ SS  ER++WI A+E
Sbjct:   16 KGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVE--DSCNFVISNGGAQTYHLKASSEVERQRWITALE 101          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010024.1 (pep scaffold:Pmarinus_7.0:GL476895:27553:46109:1 gene:ENSPMAG00000009059.1 transcript:ENSPMAT00000010024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 1.710e-38
Identity = 129/452 (28.54%), Postives = 201/452 (44.47%), Query Frame = 3
Query: 1152 LDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYL-------------------------------HQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEV----RGVTAREICHYF--WDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            +DFKGEA TFKATT GIL  L +CI++M +RE+SW++RL+RE E+R+KVEE  +   +EL                                      K   IG PD +EGPN  + E+EFFDAV+A LD+ E  +E+   F                                  H S  +    P       +V+  +K H+ Y   + Q++  +  WQ++ EEG+M++    +          + ++H V     GV    +C  +  W    +   E  V     + E   E T   + + +R     +R  ++        +     +            Y  + + N    +  P     N+ +R  ++V LICQT++   +G           + R+ L C++ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+QYV ++TAN
Sbjct:  166 IDFKGEAITFKATTAGILATLSHCIDLMAKREESWQKRLEREQEKRKKVEEAYKNALEEL-------------------------------------KKKSYIGGPDYEEGPNSLMNEEEFFDAVEAALDRHEKMEEQFFLFPLFLYYPTLINTGHGKLSLHTNTFINAMKSMCNKHGSNDIDSMSPPVPLCPPQVEESIKNHMQY---SLQDVGGDANWQLLVEEGDMKVTAASL---------AIAVLHRVPGGGGGVLGHRVCRAYVRWINGRKDLRETNVHRWQAMTEQASERTK-RYILDRRQHEQGERPCLFLGLRLSSLSLSRQHI------------YAYYYLCNSCRHHAYP---VTNRYVRAKINVALICQTLVSPPDGN--------QNIQRDNLLCRITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTQYVKERTAN 544          

HSP 2 Score: 117.472 bits (293), Expect = 1.313e-27
Identity = 62/121 (51.24%), Postives = 86/121 (71.07%), Query Frame = 3
Query:  276 VRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRI-SESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS-AIVRDSV 629
            ++PHE D+CRF+I V DS+WY R      R+ W+EA+E H++ +ESGYGSE +LRR  S     + A+  S  S SSFK+   L+EKLAEMETF++ILCRQV++LQ YFD C+ A+ +D +
Sbjct:    2 LQPHEFDECRFDISVNDSVWYFRAEDPQHRQMWVEALEHHKLQTESGYGSESSLRRHGSMLSLTSGASGFSTTSTSSFKKGLGLREKLAEMETFRDILCRQVDTLQKYFDVCADAVSKDEL 122          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006451.1 (pep scaffold:Pmarinus_7.0:GL478049:155037:165736:-1 gene:ENSPMAG00000005822.1 transcript:ENSPMAT00000006451.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 2.931e-37
Identity = 74/216 (34.26%), Postives = 129/216 (59.72%), Query Frame = 3
Query: 1641 EVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIE-DENGTPITADIDITTVPRERLKCKLLYASS 2285
            +++ +++KH+ Y   + Q++  +  WQ+I EEG+M++Y++EVE D G+VLDPL+  H V+GVT  E+CHYFWDV  + +WE T+ E   V+E   ++TV+++Q +KR+WP+TQRD++Y S ++ +   +             E   + W+V N S D+     T   + +R+ +++ +ICQT +   ENG  I          R+ + CK+ Y ++
Sbjct:    4 QLEELIQKHMEY---SLQDVGGDANWQLIVEEGDMKVYRREVE-DNGVVLDPLKATHTVKGVTGHELCHYFWDVGVKNDWETTL-ESFRVVETLADNTVIIYQTHKRIWPSTQRDALYLSCLKNVSTAK-------------ENYPDTWIVCNLSVDHADVPVTG--KCVRVKINIAMICQTFVSPPENGQDIM---------RDNILCKITYVAN 190          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005809.1 (pep scaffold:Pmarinus_7.0:GL476535:271497:285510:1 gene:ENSPMAG00000005242.1 transcript:ENSPMAT00000005809.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 2.011e-25
Identity = 60/121 (49.59%), Postives = 87/121 (71.90%), Query Frame = 3
Query:  276 VRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHX-XXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS-AIVRDSVY 632
            ++PHE D+CRF++RV D++WY+R     ER+ W+E +EQ +  E   GS+ NLRR  S  S L++ ++ S  S SSFKR   L+EKLAE+ETF++ILCRQVE+LQ YFD C+ +  RD+++
Sbjct:    7 LQPHEFDECRFDVRVNDNVWYMRAEDANERRIWMEILEQSK-QEIINGSDFNLRRHGSLASILSTTSAFSTTSISSFKRTRGLREKLAELETFRDILCRQVETLQKYFDACADSSSRDALH 126          

HSP 2 Score: 53.5286 bits (127), Expect = 5.109e-8
Identity = 22/37 (59.46%), Postives = 29/37 (78.38%), Query Frame = 3
Query: 1146 HALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSW 1256
            + LDFKGEA TFKATT GIL  L +C+E+M + ++SW
Sbjct:  170 NGLDFKGEAITFKATTAGILATLSHCVELMSKCDESW 206          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Match: plekha3 (pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1252])

HSP 1 Score: 74.7146 bits (182), Expect = 1.819e-15
Identity = 32/78 (41.03%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  156 MLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAI 386
            +L GWQ R+F L  G+LSYY S+DDV  GC+GSI++    ++ H +D  R ++ + G+  +YLR  +  ER+ W+ A+
Sbjct:    8 LLTGWQPRWFVLDGGILSYYDSQDDVSKGCKGSIKMAVCEIQVHSSDGTRLDLVIPGEQHFYLRAMNAAERQSWLVAL 85          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Match: osbp (oxysterol binding protein [Source:ZFIN;Acc:ZDB-GENE-090312-18])

HSP 1 Score: 72.4034 bits (176), Expect = 3.141e-13
Identity = 33/88 (37.50%), Postives = 58/88 (65.91%), Query Frame = 3
Query:  129 QGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIE 389
            +G L KWTN + G+Q+R+F L +G+LSYY+++ ++ + CRG+I L  A++     D C   +  G +  ++L+ SS  ER++W+ A+E
Sbjct:    4 KGWLFKWTNYIKGYQKRWFVLSNGLLSYYRTQAEMAHTCRGTINLAGAYIDTE--DSCNIVVSNGGTQTYHLKASSEVERQRWVTALE 89          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Yeast
Match: SWH1 (Protein similar to mammalian oxysterol-binding protein; contains ankyrin repeats and FFAT motif; interacts with ER anchor Scs2p at the nucleus-vacuole junction; regulated by sterol binding; SWH1 has a paralog, OSH2, that arose from the whole genome duplication [Source:SGD;Acc:S000000081])

HSP 1 Score: 65.4698 bits (158), Expect = 3.554e-11
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  120 PVIQGKLNKWTNMLHGWQERFFYLK-DGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS---IWYLRGSSIYERKKWIEAIE 389
            P  +G L KWTN   G++ R+F L  DG LSYY  + D    CRGS+ + +  +    ++  +FEI  G++    W+L+G+   E  +W+ AI+
Sbjct:  282 PTYKGYLKKWTNFAQGYKLRWFILSSDGKLSYYIDQADTKNACRGSLNMSSCSLHLDSSEKLKFEIIGGNNGVIRWHLKGNHPIETNRWVWAIQ 375          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Yeast
Match: OSH2 (Member of an oxysterol-binding protein family with seven members; in S. cerevisiae, family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane and at the nuclear envelope; regulated by sterol binding; OSH2 has a paralog, SWH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002177])

HSP 1 Score: 57.7658 bits (138), Expect = 8.714e-9
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 3
Query:  114 RLPVIQGKLNKWTNMLHGWQERFFYLK-DGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIR---VGDSIWYLRGSSIYERKKWIEAIE 389
            + P  +G L KWTN  HG++ R+F L  DG LSYYK +  V    RG++++    +    ++   FE+     G + W L+G+   E  +W+ AI+
Sbjct:  288 KPPTYKGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDR-PRGTLKVSTCRLHIDSSEKLNFELLGGITGTTRWRLKGNHPIETTRWVNAIQ 382          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Match: EDO32697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUD4])

HSP 1 Score: 185.652 bits (470), Expect = 1.337e-50
Identity = 89/188 (47.34%), Postives = 131/188 (69.68%), Query Frame = 3
Query:   96 DISDEERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAI-----VRDSVYDKL 641
            D S +  +P  QG L+KWTN LHGWQER+  L++G LSYYKS+ D  +GCRGSI +  A + PHE D+CRF++ V D ++YLR  S+ ER+KW++A+E  + +ESGYGSE +LR+  S     +  +  +  S SSFK+   L+EKL E+ETF++I+ RQ+++LQ+YFD C++      +RDS +D+L
Sbjct:   18 DASTQPNVPASQGYLSKWTNYLHGWQERWVVLREGTLSYYKSEFDTAFGCRGSISMAKASIEPHEFDECRFDVSVNDCMYYLRAESVEERQKWVDALEAVKAAESGYGSETSLRKGGSMLSLSSVTSLGTTLSTSSFKKGRGLREKLLELETFRDIVGRQIDTLQSYFDACASTSVTQDIRDSSHDEL 205          

HSP 2 Score: 140.198 bits (352), Expect = 3.497e-35
Identity = 97/326 (29.75%), Postives = 148/326 (45.40%), Query Frame = 3
Query: 1149 ALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYN----MWLVMNYSTDY 2114
             +DF+GEA TFKATT GIL  L +C+++M +RED W+RR                 L +E+                           + +  ++ +  K   +G PD +EGP+CA+ E+EF+DA       ME+E ER          Q+ Q E    H                                       ++Y+++ E + GI+LDP++  H V+GVTARE+ +YF+D   RM+W+ T+D    VLE     TV+ HQV KR+WP++QRD ++ SHI            N+ P    +R  N     W+V N+S ++
Sbjct:  250 GIDFRGEAITFKATTAGILATLEHCLDLMGKREDYWQRR-----------------LEREI--------------------EKRKKAEASVKESVVSAKKHAFLGGPDFEEGPHCALNEEEFYDA-------MEMELER----------QNEQAECMHSHV-------------------------------------TKVYRRDYE-EGGIILDPMKATHIVKGVTAREMANYFFDKDFRMDWDATIDYFK-VLETLSNSTVIFHQVMKRIWPSSQRDYLFVSHI-----------GNVTPSEEGQRLENEVGCAWMVNNWSVEH 471          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Match: EDO37291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG84])

HSP 1 Score: 91.6633 bits (226), Expect = 2.965e-19
Identity = 46/155 (29.68%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIW-YLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQ 587
            ++G L KWTN L GWQ R+F L+ GVLSYYKS+++V  G RGSI++    +  H  D  R ++R+    + YLR ++  ER++W+ A+   +   +   S  + +   +                   +   LKEK+ E+  ++ +L +Q+ +++
Sbjct:    1 MEGTLWKWTNYLSGWQPRYFVLEVGVLSYYKSQEEVGLGSRGSIKMSCCEISVHPTDTVRIDLRIPPEQYIYLRAATPAERQQWVVAMGTAKACITQCPSPNDKKPLQT------------------AKTSQLKEKMEELSMYRSLLLQQISTIK 137          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Match: EDO44125 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7RWH9])

HSP 1 Score: 77.0258 bits (188), Expect = 2.117e-14
Identity = 36/89 (40.45%), Postives = 60/89 (67.42%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDS-IWYLRGSSIYERKKWIEAIE 389
             +G L KWTN + G+Q R+F L +G+LSYY+++ ++ + CRG+I L  AF+   +A  C F I  G + +++LR S+  ER++W+ A+E
Sbjct:   11 FRGWLLKWTNYIKGYQRRWFVLSNGLLSYYRNQAEMAHTCRGTINLAGAFIDTEDA--CSFVISNGGTQVFHLRASTEVERQRWVTALE 97          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Match: EDO36148 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7SJE8])

HSP 1 Score: 73.9442 bits (180), Expect = 1.622e-13
Identity = 50/155 (32.26%), Postives = 81/155 (52.26%), Query Frame = 3
Query:  123 VIQGKLNKWTNMLHGWQERFFYLKD--GVLSYYKSKDDVHYGC-RGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVE 578
            V++G L+KWTN++ GWQ R+F L D  G+LSYY SK+ +  G  RG +RL+ A +   + DD  F I      ++ +     ER++WI A+E             +  +++S      AA +        K N  L ++LAE E + +IL +Q++
Sbjct:    4 VMEGPLSKWTNVVKGWQYRWFVLDDNTGLLSYYTSKEKMMRGARRGCLRLKGANLGIDDEDDSTFTISCDQKTFHFQARDAEERERWIRALE-------------DTIKRHSLIRKQRAAMVHEIEFDPMKEN--LDQRLAEAEAYYKILSKQIK 143          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Match: EDO47799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL45])

HSP 1 Score: 61.2326 bits (147), Expect = 1.306e-11
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 3
Query:  132 GKLNKWTNMLHGWQERFFYLKD--GVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIR-VGDSIWYLRGSSIYERKKWIEAI 386
            G+L KWTN + GWQ R+F L    G+  YY  K+ +  G RGS+ L  A V P + D   F +  +   ++ LR ++  ER+ WI  +
Sbjct:    1 GQLMKWTNYMKGWQYRWFTLDPDAGIFDYYVDKEKMKQGPRGSVNLAGASVCPSDEDSFTFSVNAINGDVFKLRANNAKERQHWINTL 88          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Match: CERT1 (ceramide transporter 1 [Source:NCBI gene;Acc:101157300])

HSP 1 Score: 276.559 bits (706), Expect = 1.432e-82
Identity = 161/425 (37.88%), Postives = 245/425 (57.65%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAI---LQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFK----YLHQSQSVQVEMPV-EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQT 2390
            G + +DFKGEA TFKATT GIL+ L +CIE+M +REDSW++R                 L +EL     +++ Y                        S ++   K    G PD +EGPN  I EDEF+DAV+A+LD+ +  +E+  + K    YL       V   +  H    +V+ +V+ H+ Y   + Q++  +  WQ++ EEG+M++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD   RM+WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR++     A+  N P         + WLV N+S ++     T  N+ +R  ++V +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T
Sbjct:  138 GTNGIDFKGEAITFKATTAGILSTLSHCIELMVKREDSWQKR-----------------LDRELEKRRRVEDAY-----------------------KSALNELKKKSHYGGPDYEEGPNSLINEDEFYDAVEAELDRQDKIEEQCHSEKIRKPYLSPVPPGDVFSVIGTHRFANKVEEMVQNHMTY---SLQDVGGDANWQLVIEEGDMKVYRREVE-ENGIVLDPLKATHNVKGVTGHEVCHYFWDTNFRMDWESTI-ENFNVVETLSDNAIIVYQTHKRVWPASQRDVLYLSAIRKVH----ATNENDP---------DTWLVCNFSVEHDKALPT--NRCVRAKINVAMICQTLV-----SPPEGDREIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTTYVQEKT 494          

HSP 2 Score: 74.3294 bits (181), Expect = 2.571e-13
Identity = 43/73 (58.90%), Postives = 59/73 (80.82%), Query Frame = 3
Query:  402 SESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXX-FKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV 617
            +ESGYGSE +LRR  S  SL SAAS   ++++S FK+ + L+EKLAEMETF++ILCRQV++LQ YFD+C+ +V
Sbjct:   24 AESGYGSESSLRRHGSMLSLTSAASALSSTSTSSFKKGYRLREKLAEMETFRDILCRQVDTLQKYFDSCADVV 96          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Match: cert1b (collagen type IV alpha-3-binding protein [Source:NCBI gene;Acc:101174116])

HSP 1 Score: 280.796 bits (717), Expect = 3.991e-82
Identity = 166/447 (37.14%), Postives = 255/447 (57.05%), Query Frame = 3
Query: 1110 EDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAI---LQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPV----------EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREI--DNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQP 2405
            E L + L   G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+     ++  Y                        S +++  K    G PD +EGPN  I EDEFFDAV+A LD+ +  +E+ +  K       VQ   PV           H   ++V+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+CH+FWD  +R +WE T+ E  +++E   ++ ++++Q +KRVWP +QRD +Y S +R++  +NE      N P         + WLV N+S D+   Q +S  + +R  +++ +ICQT++     +P   D +I+   R+ L CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA S+P
Sbjct:  317 EKLFQTLSLKGINGIDFKGEAITFKATTAGILATLTHCIDLMVKREDSWQKR-----------------LEKEMEKRRRIEESY-----------------------KSALTDLKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKMEEQCQTEK-----TRVQRSSPVPPGDVYSSSGSHRFADKVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCHFFWDTAYRNDWETTI-ENFSIVETLSDNAMIVYQTHKRVWPASQRDVLYLSAMRKMVTNNE------NDP---------DTWLVCNFSVDHDDAQVSS--RCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNLLCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTA-SKP 687          

HSP 2 Score: 113.62 bits (283), Expect = 2.114e-25
Identity = 63/142 (44.37%), Postives = 86/142 (60.56%), Query Frame = 3
Query:  249 GSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHR--------------------IS-ESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS 608
            G + +      PHE D+CR +I V DS+WYLR    Y R +WI++IE HR                    +S +SGYGSE +LRR  S    +++ +  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD+C+
Sbjct:  137 GFLVVAEGLKEPHEFDECRLDISVNDSVWYLRAHDPYHRNQWIDSIELHRNLRAGRTERSGVLGSVLIPPVSVDSGYGSESSLRRHGSMLSLISATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDSCA 278          

HSP 3 Score: 69.707 bits (169), Expect = 9.408e-12
Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFV 278
              G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A +
Sbjct:   31 FSGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSQDETEYGCRGSLCLSKAVI 81          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Match: cert1b (collagen type IV alpha-3-binding protein [Source:NCBI gene;Acc:101174116])

HSP 1 Score: 277.33 bits (708), Expect = 6.154e-81
Identity = 167/458 (36.46%), Postives = 258/458 (56.33%), Query Frame = 3
Query: 1110 EDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAI---LQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD-------QMELEDERLE---------------AFKYLHQSQSVQVE-MPVE-HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREI--DNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTAN 2396
            E L + L   G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+     ++  Y                        S +++  K    G PD +EGPN  I EDEFFDAV+A LD       Q + E  R++               + ++  + Q+V V  +P E H    EV+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+CH+FWD  +R +WE T+ E  +++E   ++ ++++Q +KRVWP +QRD +Y S +R++  +NE      N P         + WLV N+S D+   Q +S  + +R  +++ +ICQT++     +P   D +I+   R+ L CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA+
Sbjct:  295 EKLFQTLSLKGINGIDFKGEAITFKATTAGILATLTHCIDLMVKREDSWQKR-----------------LEKEMEKRRRIEESY-----------------------KSALTDLKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKMEEQCQTEKTRVQRSSPVPPGDVYSSSGSHRFADKPQAVIVRAVPHEVHRFSSEVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVEEN-GIVLDPLKATHSVKGVTGHEVCHFFWDTAYRNDWETTI-ENFSIVETLSDNAMIVYQTHKRVWPASQRDVLYLSAMRKMVTNNE------NDP---------DTWLVCNFSVDHDDAQVSS--RCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNLLCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAS 682          

HSP 2 Score: 124.02 bits (310), Expect = 1.042e-28
Identity = 62/121 (51.24%), Postives = 85/121 (70.25%), Query Frame = 3
Query:  249 GSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS 608
            G + +      PHE D+CR +I V DS+WYLR    Y R +WI++IE HR+ +SGYGSE +LRR  S    +++ +  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD+C+
Sbjct:  137 GFLVVAEGLKEPHEFDECRLDISVNDSVWYLRAHDPYHRNQWIDSIELHRV-DSGYGSESSLRRHGSMLSLISATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDSCA 256          

HSP 3 Score: 69.707 bits (169), Expect = 8.833e-12
Identity = 28/51 (54.90%), Postives = 37/51 (72.55%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFV 278
              G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A +
Sbjct:   31 FSGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSQDETEYGCRGSLCLSKAVI 81          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Match: cert1b (collagen type IV alpha-3-binding protein [Source:NCBI gene;Acc:101174116])

HSP 1 Score: 276.174 bits (705), Expect = 8.989e-81
Identity = 169/461 (36.66%), Postives = 260/461 (56.40%), Query Frame = 3
Query: 1110 EDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAI---LQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLD-------QMELEDERLE---------------AFKYLHQSQSVQVE-MPVE-HPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREI--DNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQP 2405
            E L + L   G + +DFKGEA TFKATT GIL  L +CI++M +REDSW++R                 L +E+     ++  Y                        S +++  K    G PD +EGPN  I EDEFFDAV+A LD       Q + E  R++               + ++  + Q+V V  +P E H    EV+ +V+ H+ Y   + Q++  +  WQ++ EEGEM++Y++EVE + GIVLDPL+  H V+GVT  E+CH+FWD  +R +WE T+ E  +++E   ++ ++++Q +KRVWP +QRD +Y S +R++  +NE      N P         + WLV N+S D+   Q +S  + +R  +++ +ICQT++     +P   D +I+   R+ L CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++TA S+P
Sbjct:  269 EKLFQTLSLKGINGIDFKGEAITFKATTAGILATLTHCIDLMVKREDSWQKR-----------------LEKEMEKRRRIEESY-----------------------KSALTDLKKKSHFGGPDYEEGPNSLINEDEFFDAVEAALDRQDKMEEQCQTEKTRVQRSSPVPPGDVYSSSGSHRFADKPQAVIVRAVPHEVHRFSSEVEEMVQNHMTY---SLQDVGGDANWQLVVEEGEMKVYRREVE-ENGIVLDPLKATHSVKGVTGHEVCHFFWDTAYRNDWETTI-ENFSIVETLSDNAMIVYQTHKRVWPASQRDVLYLSAMRKMVTNNE------NDP---------DTWLVCNFSVDHDDAQVSS--RCVRAKINIAMICQTLV-----SPPEGDKEIS---RDNLLCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTA-SKP 658          

HSP 2 Score: 172.17 bits (435), Expect = 2.155e-44
Identity = 86/177 (48.59%), Postives = 115/177 (64.97%), Query Frame = 3
Query:  144 KWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHR---------------------ISESGYGSEQNLRRQNS-YHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCS 608
            +WTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A + PHE D+CR +I V DS+WYLR    Y R +WI++IE HR                       +SGYGSE +LRR  S    +++ +  S  S SSFK+ H L+EKLAEMETF++ILCRQV++LQ YFD+C+
Sbjct:   54 QWTNYIHGWQDRWVVLKNNTLSYYKSQDETEYGCRGSLCLSKAVITPHEFDECRLDISVNDSVWYLRAHDPYHRNQWIDSIELHRNLRAGRTERSGVLGSVLIPPVSVDSGYGSESSLRRHGSMLSLISATSGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDSCA 230          
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Match: CERT1 (ceramide transporter 1 [Source:NCBI gene;Acc:101157300])

HSP 1 Score: 273.863 bits (699), Expect = 1.427e-80
Identity = 160/422 (37.91%), Postives = 241/422 (57.11%), Query Frame = 3
Query: 1140 GGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFK----YLHQSQSVQVEMPV-EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQT 2390
            G + +DFKGEA TFKATT GIL+ L +CIE+M +REDSW++R                 L +EL                               S ++   K    G PD +EGPN  I EDEF+DAV+A+LD+ +  +E+  + K    YL       V   +  H    +V+ +V+ H+ Y   + Q++  +  WQ++ EEG+M++Y++EVE + GIVLDPL+  H V+GVT  E+CHYFWD   RM+WE T+ E   V+E   ++ ++++Q +KRVWP +QRD +Y S IR++     A+  N P         + WLV N+S ++     T  N+ +R  ++V +ICQT++     +P   D +I+   R+ + CK+ Y ++VNPGGWAPASVLR VA+REYP+F+KRF+ YV ++T
Sbjct:  229 GTNGIDFKGEAITFKATTAGILSTLSHCIELMVKREDSWQKR-----------------LDREL--------------------EKRRRVEDAYKSALNELKKKSHYGGPDYEEGPNSLINEDEFYDAVEAELDRQDKIEEQCHSEKIRKPYLSPVPPGDVFSVIGTHRFANKVEEMVQNHMTY---SLQDVGGDANWQLVIEEGDMKVYRREVEEN-GIVLDPLKATHNVKGVTGHEVCHYFWDTNFRMDWESTI-ENFNVVETLSDNAIIVYQTHKRVWPASQRDVLYLSAIRKVH----ATNENDP---------DTWLVCNFSVEHDKALPT--NRCVRAKINVAMICQTLV-----SPPEGDREIS---RDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTTYVQEKT 585          

HSP 2 Score: 184.882 bits (468), Expect = 4.047e-49
Identity = 97/175 (55.43%), Postives = 128/175 (73.14%), Query Frame = 3
Query:   99 ISDEERLPV-IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSY-HXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIV 617
            I  E   PV   G L+KWTN +HGWQ+R+  LK+  LSYYKS+D+  YGCRGS+ L  A + PHE D+CRF+I V DS+WYLR      R++WIE+IE HR +ESGYGSE +LRR  S     ++A++LS  S SSFK+ + L+EKLAEMETF++ILCRQV++LQ YFD+C+ +V
Sbjct:   14 IDPESAQPVEFGGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDEREYGCRGSLCLSKAVITPHEFDECRFDISVNDSVWYLRAEDPEHRQRWIESIEVHR-AESGYGSESSLRRHGSMLSLTSAASALSSTSTSSFKKGYRLREKLAEMETFRDILCRQVDTLQKYFDSCADVV 187          
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Match: SMESG000032017.1 (SMESG000032017.1)

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 789/793 (99.50%), Postives = 790/793 (99.62%), Query Frame = 3
Query:   33 MQTILIKQEIDSHENLYLTDDDISDEERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHXXXXXXXXXXXXXXXFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFLIXXXXXXXXXXXLANEYRIGLDARQHNXXXXXXXXXXXXXXXXXMPMPTIIANGQIESANNGTIFEDARENMPETAVGLDLSTSEKASTPTKENNTTSQLTQPTRGFLSKFFPFRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWXXXXXXXXXXXXXXXXXXXTLSQELAILQNQYMXXXXXXXXXXXXXXXXXTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 2411
            MQTILIKQEIDSHENLYLTDDDISDEERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHSLNSAASLSIASASSFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFLIDDHESDEHDSSLANEYRIGLDARQHNSSDGVSVSSES+GSETSMPMPTIIANGQIESANNGTIFEDARENMPE AVGLDLSTSEKASTPTKENNTTSQLTQPTRGFLSKFFPFRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWRRRLDREIERRRKVEEVNRTLSQELAILQNQYMTSRN SGNSPNGVSSTPTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMP EHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF
Sbjct:    1 MQTILIKQEIDSHENLYLTDDDISDEERLPVIQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHSLNSAASLSIASASSFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVYDKLERFLIDDHESDEHDSSLANEYRIGLDARQHNSSDGVSVSSESIGSETSMPMPTIIANGQIESANNGTIFEDARENMPEIAVGLDLSTSEKASTPTKENNTTSQLTQPTRGFLSKFFPFRSNPPTGPPAPMQTSSTTINPVNYKDVDCSQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEIMQQREDSWRRRLDREIERRRKVEEVNRTLSQELAILQNQYMTSRNSSGNSPNGVSSTPTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDAQLDQMELEDERLEAFKYLHQSQSVQVEMPGEHPLYEEVQNVVKKHLIYCDPTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTAREICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQRDSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHTSANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYASSVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF 793          
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Match: SMESG000017529.1 (SMESG000017529.1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.044e-16
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAI 386
            + G L KWTN   GWQ R+F LKDG+LSYY+S+++V  G +GSI L    +     D+ RFEI + G+  ++L+ +SI ER++WI A+
Sbjct:    1 MNGVLWKWTNYYSGWQPRWFILKDGILSYYRSEEEVQSGSKGSINLSVCDLNVSNFDNTRFEIVIPGEQKYHLKAASIQERQRWIVAL 88          
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Match: SMESG000017529.1 (SMESG000017529.1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.770e-16
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRV-GDSIWYLRGSSIYERKKWIEAI 386
            + G L KWTN   GWQ R+F LKDG+LSYY+S+++V  G +GSI L    +     D+ RFEI + G+  ++L+ +SI ER++WI A+
Sbjct:    1 MNGVLWKWTNYYSGWQPRWFILKDGILSYYRSEEEVQSGSKGSINLSVCDLNVSNFDNTRFEIVIPGEQKYHLKAASIQERQRWIVAL 88          
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Match: SMESG000015616.1 (SMESG000015616.1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.803e-12
Identity = 35/94 (37.23%), Postives = 58/94 (61.70%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYL--KDGVLSYYKSKDDVHYG-CRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHR 398
            ++G L KWTN+++GWQ R+F L    GVLSYY S +    G  RG ++L+ A V   + +DC F I V +  ++ +     ER++W++A+++ R
Sbjct:    1 MEGPLTKWTNLVNGWQYRWFVLDVNVGVLSYYTSLEKERRGERRGCVKLKGAQVGIDDTEDCTFTITVDNKTFHFQARDSEERQRWLDALQEAR 94          
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Match: SMESG000015616.1 (SMESG000015616.1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.843e-12
Identity = 35/94 (37.23%), Postives = 58/94 (61.70%), Query Frame = 3
Query:  126 IQGKLNKWTNMLHGWQERFFYL--KDGVLSYYKSKDDVHYG-CRGSIRLQNAFVRPHEADDCRFEIRVGDSIWYLRGSSIYERKKWIEAIEQHR 398
            ++G L KWTN+++GWQ R+F L    GVLSYY S +    G  RG ++L+ A V   + +DC F I V +  ++ +     ER++W++A+++ R
Sbjct:    1 MEGPLTKWTNLVNGWQYRWFVLDVNVGVLSYYTSLEKERRGERRGCVKLKGAQVGIDDTEDCTFTITVDNKTFHFQARDSEERQRWLDALQEAR 94          
The following BLAST results are available for this feature:
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERT11.402e-7937.26ceramide transporter 1 [Source:HGNC Symbol;Acc:HGN... [more]
CERT11.402e-7937.26ceramide transporter 1 [Source:HGNC Symbol;Acc:HGN... [more]
CERT11.595e-7936.57ceramide transporter 1 [Source:HGNC Symbol;Acc:HGN... [more]
CERT11.595e-7936.57ceramide transporter 1 [Source:HGNC Symbol;Acc:HGN... [more]
CERT11.595e-7936.57ceramide transporter 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F25H2.66.806e-4631.53pep chromosome:WBcel235:I:10554366:10557838:1 gene... [more]
F25H2.66.806e-4631.53pep chromosome:WBcel235:I:10554366:10557838:1 gene... [more]
obr-41.481e-1327.17Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-41.481e-1327.17Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-12.786e-935.56Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cert5.448e-7737.61gene:FBgn0027569 transcript:FBtr0345035[more]
cert5.448e-7737.61gene:FBgn0027569 transcript:FBtr0076717[more]
cert1.557e-6741.92gene:FBgn0027569 transcript:FBtr0332136[more]
Osbp3.299e-1538.95gene:FBgn0020626 transcript:FBtr0084801[more]
CG15138.162e-1238.04gene:FBgn0033463 transcript:FBtr0088450[more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cert1b7.014e-8537.88ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
cert1b1.042e-8335.78ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
cert1a1.018e-7637.09ceramide transporter 1a [Source:NCBI gene;Acc:7964... [more]
cert1a1.018e-7637.09ceramide transporter 1a [Source:NCBI gene;Acc:7964... [more]
cert1a5.390e-7635.92ceramide transporter 1a [Source:NCBI gene;Acc:7964... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cert1.050e-7634.71ceramide transporter 1 [Source:NCBI gene;Acc:38733... [more]
cert4.773e-7635.48ceramide transporter 1 [Source:NCBI gene;Acc:38733... [more]
cert6.483e-7635.78ceramide transporter 1 [Source:NCBI gene;Acc:38733... [more]
cert7.989e-7635.35ceramide transporter 1 [Source:NCBI gene;Acc:38733... [more]
cert9.139e-7635.06ceramide transporter 1 [Source:NCBI gene;Acc:38733... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col4a3bp5.661e-7938.43collagen, type IV, alpha 3 (Goodpasture antigen) b... [more]
Col4a3bp5.661e-7938.43collagen, type IV, alpha 3 (Goodpasture antigen) b... [more]
Col4a3bp1.300e-7537.25collagen, type IV, alpha 3 (Goodpasture antigen) b... [more]
Plekha34.172e-1928.75pleckstrin homology domain-containing, family A (p... [more]
Plekha89.170e-1728.57pleckstrin homology domain containing, family A (p... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6VVX2|CERT_CRIGR1.058e-7736.57Ceramide transfer protein OS=Cricetulus griseus OX... [more]
sp|Q9GKI7|CERT_BOVIN3.146e-7637.31Ceramide transfer protein OS=Bos taurus OX=9913 GN... [more]
sp|Q6NRZ4|CERT_XENLA2.567e-7535.44Ceramide transfer protein OS=Xenopus laevis OX=835... [more]
sp|Q9Y5P4|CERT_HUMAN2.917e-7535.48Ceramide transfer protein OS=Homo sapiens OX=9606 ... [more]
sp|Q6P3Q6|CERT_XENTR4.841e-7535.06Ceramide transfer protein OS=Xenopus tropicalis OX... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NLI00.000e+041.80Collagen type IV alpha-3-binding protein OS=Parago... [more]
A0A0X3P0E32.806e-15437.20Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A1S8WT591.595e-12141.92START domain protein (Fragment) OS=Opisthorchis vi... [more]
A0A074Z6Q04.027e-12041.92Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7FUS05.208e-11841.65Collagen type IV alpha-3-binding protein OS=Clonor... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cert1b2.603e-8339.86ceramide transporter 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
cert1a9.939e-6740.13ceramide transporter 1a [Source:NCBI gene;Acc:7964... [more]
plekha31.595e-1728.30pleckstrin homology domain containing A3 [Source:N... [more]
osbp7.753e-1340.91oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp7.795e-1340.91oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010024.11.710e-3828.54pep scaffold:Pmarinus_7.0:GL476895:27553:46109:1 g... [more]
ENSPMAT00000006451.12.931e-3734.26pep scaffold:Pmarinus_7.0:GL478049:155037:165736:-... [more]
ENSPMAT00000005809.12.011e-2549.59pep scaffold:Pmarinus_7.0:GL476535:271497:285510:1... [more]
plekha31.819e-1541.03pleckstrin homology domain containing, family A (p... [more]
osbp3.141e-1337.50oxysterol binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SWH13.554e-1135.11Protein similar to mammalian oxysterol-binding pro... [more]
OSH28.714e-933.33Member of an oxysterol-binding protein family with... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326971.337e-5047.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372912.965e-1929.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441252.117e-1440.45Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO361481.622e-1332.26Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO477991.306e-1136.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERT11.432e-8237.88ceramide transporter 1 [Source:NCBI gene;Acc:10115... [more]
cert1b3.991e-8237.14collagen type IV alpha-3-binding protein [Source:N... [more]
cert1b6.154e-8136.46collagen type IV alpha-3-binding protein [Source:N... [more]
cert1b8.989e-8136.66collagen type IV alpha-3-binding protein [Source:N... [more]
CERT11.427e-8037.91ceramide transporter 1 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Collagen type IV alpha-3-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032017.10.000e+099.50SMESG000032017.1[more]
SMESG000017529.11.044e-1645.45SMESG000017529.1[more]
SMESG000017529.11.770e-1645.45SMESG000017529.1[more]
SMESG000015616.15.803e-1237.23SMESG000015616.1[more]
SMESG000015616.15.843e-1237.23SMESG000015616.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018655 ID=SMED30018655|Name=Collagen type IV alpha-3-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2829bp
ATCTATATAAATCTTATATGAAACCTATCTAAATGCAGACAATTTTGATC
AAACAAGAAATAGACAGCCACGAAAACTTGTATTTAACAGATGATGACAT
CAGTGATGAAGAAAGGTTGCCTGTTATCCAGGGTAAACTTAATAAGTGGA
CAAACATGCTTCATGGTTGGCAGGAGAGATTTTTTTATTTGAAAGACGGA
GTTCTTAGTTATTACAAATCTAAGGACGATGTCCATTATGGGTGCAGAGG
ATCTATTAGATTGCAAAATGCATTTGTTAGACCACATGAAGCTGACGATT
GTCGTTTTGAGATTCGAGTTGGTGATTCTATTTGGTATTTGCGCGGATCT
TCTATTTATGAACGTAAAAAATGGATAGAAGCCATTGAACAACATCGAAT
TAGTGAATCTGGCTATGGCAGTGAACAGAACCTTCGACGGCAGAATTCAT
ATCACTCATTAAATAGTGCAGCCAGTCTCAGTATTGCAAGCGCTTCAAGC
TTCAAAAGAAATCATCATCTTAAAGAAAAATTGGCTGAAATGGAAACATT
TAAAGAAATTTTATGTCGGCAAGTAGAATCACTCCAGAACTATTTTGATA
CATGTTCTGCCATTGTTCGGGATTCAGTTTATGACAAATTGGAAAGATTT
CTTATTGATGATCATGAATCTGATGAGCATGATAGTTCTCTTGCTAATGA
ATATAGAATTGGTCTTGATGCTCGGCAACATAATTCCTCAGACGGAGTTA
GTGTTTCATCGGAATCCGTTGGTTCAGAAACCTCTATGCCTATGCCAACT
ATAATTGCAAATGGGCAGATTGAATCAGCAAATAATGGCACTATATTTGA
GGATGCTCGGGAAAATATGCCAGAAACTGCCGTTGGATTAGATCTCTCCA
CATCAGAAAAAGCTTCCACACCTACAAAAGAAAATAATACAACATCACAA
CTTACCCAACCTACTAGGGGATTTCTTTCAAAATTTTTCCCATTCCGATC
AAATCCTCCTACTGGACCACCTGCACCAATGCAAACCTCTTCCACAACGA
TCAACCCTGTTAATTATAAAGATGTCGATTGCAGCCAGTATGAACCGACG
TCTCGATTTGAAGATTTAAAAAAGATTTTAAAACAGCACGGTGGACATGC
CTTGGATTTCAAAGGAGAAGCTTATACATTTAAGGCCACTACAACTGGAA
TTCTAACCAATCTCTGTTATTGTATAGAAATAATGCAACAAAGGGAAGAC
TCATGGCGGCGAAGGCTTGATAGAGAAATTGAAAGAAGACGCAAAGTAGA
AGAAGTCAATCGAACATTGTCACAAGAACTGGCAATCCTACAAAACCAGT
ATATGACATCGAGAAATCCTTCAGGCAATTCACCAAATGGCGTCTCATCA
ACACCGACAGTGTCGAGAATTTCGTCTACTATATCAAATACAAACAAAAT
GATCATGATTGGCAGTCCTGACATGCAGGAAGGCCCTAATTGTGCAATAG
GTGAAGATGAATTCTTTGATGCTGTTGATGCCCAATTAGATCAAATGGAA
CTTGAAGATGAAAGACTTGAAGCTTTCAAATACCTTCATCAAAGTCAATC
TGTGCAAGTGGAAATGCCCGTTGAGCATCCGTTGTATGAAGAAGTTCAAA
ATGTTGTCAAGAAGCATCTAATTTATTGTGATCCAACCGCACAAGAATTG
CGAATCGAGGATGGCTGGCAAATAATTGCTGAAGAAGGAGAAATGAGAAT
ATATAAAAAGGAAGTTGAAAATGATGAAGGTATCGTCCTTGATCCTCTTG
AAATAATACATGAAGTAAGAGGAGTCACAGCCAGAGAAATTTGTCATTAT
TTCTGGGATGTAAAACATCGTATGGAGTGGGAAATAACTGTTGATGAACC
CCCAACAGTCCTTGAATATTGTGGTGAAGACACTGTTGTTCTTCATCAAG
TGTACAAACGTGTTTGGCCTACTACCCAAAGAGATTCTGTTTATTGGTCT
CATATACGAGAAATCGACAACGAACAACTTGCTAGTGTTTGTAACATACC
TCCACCAAATCCAGCTGAAAGACCTTATAACATGTGGCTCGTCATGAATT
ACTCGACTGACTACAAAGCACCCCAACATACGTCGGCCAATCAAATGATT
CGTTTGGTGCTTGATGTGGTTTTGATTTGTCAGACAATAATCGAAGATGA
AAATGGAACTCCGATTACAGCAGATATCGATATTACAACTGTGCCGAGGG
AGCGACTGAAATGCAAACTCCTCTATGCCAGTAGCGTAAATCCTGGTGGT
TGGGCACCGGCATCGGTTTTGAGAACTGTTGCCCGCCGAGAGTATCCCAG
ATTTATCAAGAGATTCAGTCAATATGTTATTGATCAAACTGCCAATAGCC
AACCGAAATTTTGATTTCAATAAAAAATCTACAACAGAACAACAACAATA
GCAACAAAAATATTTTGTAATTTATTTTCTGCTACAATTTTGCGGTGAAA
TATTTCTCGTTTATATTGAGAAAAAACCCGAAGCGAAATCATTAGCAAAT
CCGTTTATGTCAATCGATTAATTTATTAGCGTTTTGATTGGTATATTTTT
TTAGTTTGAAATTGACGAAAATTCTGATTGGTTAATTGGATTTATCTTCA
TTATAAAATCGCTCAAATAATTCTCCGAATATAAATAAATCGATTTTTTG
GATGTTTTGACCAAGATTTCTATAAATTTCTATAATCAATGAATCAATAT
TATTATTTGTGTATTTTTTACATTGATTTATTAGTGTAAGCTTTTATATA
ATGATTTGGTTTATCGAGTGGCGGCTGTG
back to top

protein sequence of SMED30018655-orf-1

>SMED30018655-orf-1 ID=SMED30018655-orf-1|Name=SMED30018655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=794bp
MQTILIKQEIDSHENLYLTDDDISDEERLPVIQGKLNKWTNMLHGWQERF
FYLKDGVLSYYKSKDDVHYGCRGSIRLQNAFVRPHEADDCRFEIRVGDSI
WYLRGSSIYERKKWIEAIEQHRISESGYGSEQNLRRQNSYHSLNSAASLS
IASASSFKRNHHLKEKLAEMETFKEILCRQVESLQNYFDTCSAIVRDSVY
DKLERFLIDDHESDEHDSSLANEYRIGLDARQHNSSDGVSVSSESVGSET
SMPMPTIIANGQIESANNGTIFEDARENMPETAVGLDLSTSEKASTPTKE
NNTTSQLTQPTRGFLSKFFPFRSNPPTGPPAPMQTSSTTINPVNYKDVDC
SQYEPTSRFEDLKKILKQHGGHALDFKGEAYTFKATTTGILTNLCYCIEI
MQQREDSWRRRLDREIERRRKVEEVNRTLSQELAILQNQYMTSRNPSGNS
PNGVSSTPTVSRISSTISNTNKMIMIGSPDMQEGPNCAIGEDEFFDAVDA
QLDQMELEDERLEAFKYLHQSQSVQVEMPVEHPLYEEVQNVVKKHLIYCD
PTAQELRIEDGWQIIAEEGEMRIYKKEVENDEGIVLDPLEIIHEVRGVTA
REICHYFWDVKHRMEWEITVDEPPTVLEYCGEDTVVLHQVYKRVWPTTQR
DSVYWSHIREIDNEQLASVCNIPPPNPAERPYNMWLVMNYSTDYKAPQHT
SANQMIRLVLDVVLICQTIIEDENGTPITADIDITTVPRERLKCKLLYAS
SVNPGGWAPASVLRTVARREYPRFIKRFSQYVIDQTANSQPKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR002913START_lipid-bd_dom
IPR023393START-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0005581collagen trimer
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 412..439
NoneNo IPR availablePANTHERPTHR10219:SF71COLLAGEN TYPE IV ALPHA-3-BINDING PROTEINcoord: 365..788
NoneNo IPR availablePANTHERPTHR10219:SF71COLLAGEN TYPE IV ALPHA-3-BINDING PROTEINcoord: 85..200
NoneNo IPR availablePANTHERPTHR10219GLYCOLIPID TRANSFER PROTEIN-RELATEDcoord: 365..788
coord: 85..200
NoneNo IPR availableCDDcd13283PH_GPBPcoord: 32..131
e-value: 4.82209E-50
score: 168.62
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 555..782
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 26..125
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 30..125
e-value: 3.6E-18
score: 76.4
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 31..120
e-value: 3.6E-14
score: 53.2
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 29..123
score: 12.666
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 26..125
e-value: 1.2E-26
score: 94.6
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 532..793
e-value: 3.3E-67
score: 228.2
IPR002913START domainPFAMPF01852STARTcoord: 559..781
e-value: 1.2E-12
score: 47.8
IPR002913START domainPROSITEPS50848STARTcoord: 559..787
score: 19.678