Regulator of telomere elongation helicase 1 homolog

Overview
NameRegulator of telomere elongation helicase 1 homolog
Smed IDSMED30018649
Length (bp)2327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of telomere elongation helicase 1 homolog (SMED30018649) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of telomere elongation helicase 1 homolog (SMED30018649) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of telomere elongation helicase 1 homolog (SMED30018649) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of telomere elongation helicase 1 homolog (SMED30018649) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018649

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018649SMESG000018012.1 SmedASXL_015509SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30018649SMESG000018012.1 SmedASXL_015508SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30018649SMESG000018012.1 dd_Smed_v4_16638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018649SMESG000018012.1 dd_Smed_v6_16638_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30018649SMESG000018012.1 Contig44145newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30018649SMESG000018012.1 Contig44145uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30018649SMESG000018012.1 dd_Smed_v4_16638_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018649SMESG000018012.1 SMED_23278_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018649SMESG000018012.1 SMED_23278_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018649SMESG000018012.1 SmWIOct06_026635GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018649SMESG000018012.1 SMED_10849_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018649SMESG000018012.1 SMED_10849_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Match: BRIP1 (BRCA1 interacting protein C-terminal helicase 1 [Source:HGNC Symbol;Acc:HGNC:20473])

HSP 1 Score: 411.764 bits (1057), Expect = 1.582e-129
Identity = 238/679 (35.05%), Postives = 373/679 (54.93%), Query Frame = 1
Query:  244 CSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPET------TWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNGEI-TDSTSEIP---SSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCK-KRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            CST    KQ  SQ   N+   +    +K  KI+FGTRTHKQI Q+ REL+++AYS   M+ILS R+ +C++ EV+ +   ++ C +L        C     ++KI +Q   +T       WDIE +    KK+K CPY+  +  ++ ADI+FCPYNY+L+  IR+SM +NL+  ++ILDEAHNIED  RE AS S++   + + +  L  ++  + ++     L  +   +   +E  +  L  +D +   K W     +  L    +        + H  A L+ E +++     +   E+P   +S   ++    M++  +   +    +D+ I I +   +   I+    +G  +  K K+++       VLN WC+NP + F  I+   ++I+LTSGTLSP+ SF  EL   F+   +A H+++  + ++ +IG+GP G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L+E   +RW +TGL + +   K++ +EP+  + +  +E +  Y     +K  KDGALL+AV RGK SEG+DF+D+ AR VIT+GIP+P++ D +V LK  YN +  K     LL G +WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W++++       E    SL  F   H +V
Sbjct:  219 CST----KQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRG--LLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKV 891          

HSP 2 Score: 70.0922 bits (170), Expect = 1.296e-11
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 1
Query:   91 EFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            E+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    7 EYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Match: BRIP1 (BRCA1 interacting protein C-terminal helicase 1 [Source:HGNC Symbol;Acc:HGNC:20473])

HSP 1 Score: 409.838 bits (1052), Expect = 1.127e-126
Identity = 238/679 (35.05%), Postives = 373/679 (54.93%), Query Frame = 1
Query:  244 CSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPET------TWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNGEI-TDSTSEIP---SSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCK-KRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            CST    KQ  SQ   N+   +    +K  KI+FGTRTHKQI Q+ REL+++AYS   M+ILS R+ +C++ EV+ +   ++ C +L        C     ++KI +Q   +T       WDIE +    KK+K CPY+  +  ++ ADI+FCPYNY+L+  IR+SM +NL+  ++ILDEAHNIED  RE AS S++   + + +  L  ++  + ++     L  +   +   +E  +  L  +D +   K W     +  L    +        + H  A L+ E +++     +   E+P   +S   ++    M++  +   +    +D+ I I +   +   I+    +G  +  K K+++       VLN WC+NP + F  I+   ++I+LTSGTLSP+ SF  EL   F+   +A H+++  + ++ +IG+GP G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L+E   +RW +TGL + +   K++ +EP+  + +  +E +  Y     +K  KDGALL+AV RGK SEG+DF+D+ AR VIT+GIP+P++ D +V LK  YN +  K     LL G +WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W++++       E    SL  F   H +V
Sbjct:  219 CST----KQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRG--LLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKV 891          

HSP 2 Score: 69.707 bits (169), Expect = 1.690e-11
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 1
Query:   91 EFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            E+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    7 EYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 310.457 bits (794), Expect = 1.185e-91
Identity = 219/728 (30.08%), Postives = 341/728 (46.84%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW-------------LKQYQSQLL----LNSRNDECKENAKQV-------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEG-----------EKYAEPINEKVA-------SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKH--FDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M +  L+ V V FP +PY  Q   M +++  + +  N ++E PTG+GKT+ LLC+TL W              ++ Q +L     L+S  +        +       KI + +RTH Q+ QVI EL+ ++Y   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K ++CPY+  ++  + ADI+F PYNY+L+   R++  ++L+  ++I DEAHN+E +C E AS  ++  D+     ++  +L++  K   Q +            +  S  L  + ED+ K    L      +   +L  D   +    +++ +L  E ++     G I DS  +I          F     L   +D   Q  FS+  +EG           + Y   I+           S  W +   RK        VL+ WC +PG    + +    RS+ILTSGTL+PV SF  E+   F    +  H++   + ++  +  GP G  + + F           LG+ L   + VVP G+LIF  S+ ++E  ++ W    L  ++   K +F+EPR     +E I AY+  V      GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +    K       Q LSG EWY  QA RA+NQA+GR IRHR+D+GA+ + D R 
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEV-KKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSA-----DSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNTAGLQKLADII-QIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARK-----RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 309.686 bits (792), Expect = 3.797e-90
Identity = 219/728 (30.08%), Postives = 341/728 (46.84%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW-------------LKQYQSQLL----LNSRNDECKENAKQV-------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEG-----------EKYAEPINEKVA-------SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKH--FDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M +  L+ V V FP +PY  Q   M +++  + +  N ++E PTG+GKT+ LLC+TL W              ++ Q +L     L+S  +        +       KI + +RTH Q+ QVI EL+ ++Y   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K ++CPY+  ++  + ADI+F PYNY+L+   R++  ++L+  ++I DEAHN+E +C E AS  ++  D+     ++  +L++  K   Q +            +  S  L  + ED+ K    L      +   +L  D   +    +++ +L  E ++     G I DS  +I          F     L   +D   Q  FS+  +EG           + Y   I+           S  W +   RK        VL+ WC +PG    + +    RS+ILTSGTL+PV SF  E+   F    +  H++   + ++  +  GP G  + + F           LG+ L   + VVP G+LIF  S+ ++E  ++ W    L  ++   K +F+EPR     +E I AY+  V      GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +    K       Q LSG EWY  QA RA+NQA+GR IRHR+D+GA+ + D R 
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEV-KKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFS-----ADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNTAGLQKLADII-QIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARK-----RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Match: RTEL1 (regulator of telomere elongation helicase 1 [Source:HGNC Symbol;Acc:HGNC:15888])

HSP 1 Score: 309.301 bits (791), Expect = 8.418e-90
Identity = 218/728 (29.95%), Postives = 342/728 (46.98%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW-------------LKQYQSQLL----LNSRNDECKENAKQV-------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEK----------------YAEPINEKVA--SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKH--FDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M +  L+ V V FP +PY  Q   M +++  + +  N ++E PTG+GKT+ LLC+TL W              ++ Q +L     L+S  +        +       KI + +RTH Q+ QVI EL+ ++Y   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K ++CPY+  ++  + ADI+F PYNY+L+   R++  ++L+  ++I DEAHN+E +C E AS  ++  D+     ++  +L++  K   Q +            +  S  L  + ED+ K    L      +   +L  D   +    +++ +L  E ++     G I DS  +I          F     L   +D   Q  FS+  +EG                  + +  + + A  S  W +   RK        VL+ WC +PG    + +    RS+ILTSGTL+PV SF  E+   F    +  H++   + ++  +  GP G  + + F           LG+ L   + VVP G+LIF  S+ ++E  ++ W    L  ++   K +F+EPR     +E I AY+  V      GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +    K       Q LSG EWY  QA RA+NQA+GR IRHR+D+GA+ + D R 
Sbjct:    1 MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQVINELRNTSY-RPKVCVLGSREQLCIHPEV-KKQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFS-----ADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNTAGLQKLADII-QIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARK-----RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Match: rtel-1 (Regulator of telomere elongation helicase 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93575])

HSP 1 Score: 284.648 bits (727), Expect = 1.076e-82
Identity = 210/731 (28.73%), Postives = 352/731 (48.15%), Query Frame = 1
Query:  115 VTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLN------------SRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQN---CKDLCKKMGCIY--KIDNQPHPETT--------WDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKD----IDYLKMLLPHILKK----------------SGKEDC---------QHDLLTMLEKM----HEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGE-KYAEPINEKVASGEWISCKKR-KADALNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRW--------TNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNP 2088
            V FP EPY  Q   M+ +++ +++  +  +E PTG+GKT++LLCSTL W+++ +    L+             + DE  ++A    IF+ +RTH Q+ QV+ EL ++ Y   + +IL  R   C+NQ+V   KE ++    C+ L  K  C Y  K D     + T         DIE       +  +CPYF  +   ++A+++  PYNYI++P +R+   ++L+N+I+I DEAHN+E IC   AS  ++       I+ LK +L  ++ +                S K D            DL+T+LEK+     E+ +L  S        +  K  D E  ++ L     D  ++   E  +  LR+ I     +     E+  +  +  D    +   ++    T   D +  + E   K  + ++ K  +    +CK   + D  N    +  +C    I  + +     R+++L SGTLSP+ +F   +   F AI +  H ++      + +  G  G  +   F     L +   + + LL+  EV+P GILIF SS++ ++  +  W        +N     ++ K K + +EPR   E+      Y + V +  GA LLAV RGK SEG+DF D  +R VI +GIPYP I D +VVLK  Y  +   +K    +  S  +WY ++AFRA+NQA+GR +RH++D+G ++++D+R   + P
Sbjct:   19 VKFPFEPYECQRIFMKNVVDVLDRKLDAALESPTGTGKTLSLLCSTLAWVQRQKETKPLDFATWQTSGAGGAEKTDEKLKSAYVPTIFYASRTHSQLEQVVHELNRTEYKWVKTTILGSREHFCINQKVKKIKESNRQAHVCRGLVSKRACHYYNKFDACTTDKMTEFLDKGEAMDIEDFVKLGTQNSLCPYFMSRQRSETAELILLPYNYIIDPKMRRRYKLDLKNSIVIFDEAHNLESICESNASAELTSTSIALCIEELKKVLALLVDEEETARSEADAETGAFGSAKIDLTKKLIENLRTEDLMTVLEKIFSLEEEMDKLFGSSQLKSVPPLSGKASDGEILLETLAKAGFDANSV---ERLVDVLRDAISY---LLSKNEEV--ALTEKGDGMEKVADFLLSIYSTHAQDVAAAVGEETVKLVDRVDPKTVAR---NCKLYIQKDKDNEKLTIKYFCFQASISMRMLKMRGVRNVLLASGTLSPIQAFTYNMGLNFGAILENEHALKQVPVLTSIVTRGKRG-GLAGSFQNRKNLDYVTGVAEALLRVMEVIPQGILIFFSSYSQMDELVATWKTTKWSSNSNESFWEKMEKTKRVVVEPRAKEELAAIRLRYTQGVSEQHGAALLAVCRGKVSEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVNQAIGRVLRHKDDFGTVVLMDTRYASAKP 737          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Match: rtel-1 (Regulator of telomere elongation helicase 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93575])

HSP 1 Score: 284.648 bits (727), Expect = 1.076e-82
Identity = 210/731 (28.73%), Postives = 352/731 (48.15%), Query Frame = 1
Query:  115 VTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLN------------SRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQN---CKDLCKKMGCIY--KIDNQPHPETT--------WDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKD----IDYLKMLLPHILKK----------------SGKEDC---------QHDLLTMLEKM----HEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGE-KYAEPINEKVASGEWISCKKR-KADALNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRW--------TNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNP 2088
            V FP EPY  Q   M+ +++ +++  +  +E PTG+GKT++LLCSTL W+++ +    L+             + DE  ++A    IF+ +RTH Q+ QV+ EL ++ Y   + +IL  R   C+NQ+V   KE ++    C+ L  K  C Y  K D     + T         DIE       +  +CPYF  +   ++A+++  PYNYI++P +R+   ++L+N+I+I DEAHN+E IC   AS  ++       I+ LK +L  ++ +                S K D            DL+T+LEK+     E+ +L  S        +  K  D E  ++ L     D  ++   E  +  LR+ I     +     E+  +  +  D    +   ++    T   D +  + E   K  + ++ K  +    +CK   + D  N    +  +C    I  + +     R+++L SGTLSP+ +F   +   F AI +  H ++      + +  G  G  +   F     L +   + + LL+  EV+P GILIF SS++ ++  +  W        +N     ++ K K + +EPR   E+      Y + V +  GA LLAV RGK SEG+DF D  +R VI +GIPYP I D +VVLK  Y  +   +K    +  S  +WY ++AFRA+NQA+GR +RH++D+G ++++D+R   + P
Sbjct:   19 VKFPFEPYECQRIFMKNVVDVLDRKLDAALESPTGTGKTLSLLCSTLAWVQRQKETKPLDFATWQTSGAGGAEKTDEKLKSAYVPTIFYASRTHSQLEQVVHELNRTEYKWVKTTILGSREHFCINQKVKKIKESNRQAHVCRGLVSKRACHYYNKFDACTTDKMTEFLDKGEAMDIEDFVKLGTQNSLCPYFMSRQRSETAELILLPYNYIIDPKMRRRYKLDLKNSIVIFDEAHNLESICESNASAELTSTSIALCIEELKKVLALLVDEEETARSEADAETGAFGSAKIDLTKKLIENLRTEDLMTVLEKIFSLEEEMDKLFGSSQLKSVPPLSGKASDGEILLETLAKAGFDANSV---ERLVDVLRDAISY---LLSKNEEV--ALTEKGDGMEKVADFLLSIYSTHAQDVAAAVGEETVKLVDRVDPKTVAR---NCKLYIQKDKDNEKLTIKYFCFQASISMRMLKMRGVRNVLLASGTLSPIQAFTYNMGLNFGAILENEHALKQVPVLTSIVTRGKRG-GLAGSFQNRKNLDYVTGVAEALLRVMEVIPQGILIFFSSYSQMDELVATWKTTKWSSNSNESFWEKMEKTKRVVVEPRAKEELAAIRLRYTQGVSEQHGAALLAVCRGKVSEGIDFCDAESRAVIIIGIPYPPIHDERVVLKKMYLDDLMGRKDTKSERQSSQDWYQMEAFRAVNQAIGRVLRHKDDFGTVVLMDTRYASAKP 737          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Match: dog-1 (Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;Acc:O62217])

HSP 1 Score: 217.624 bits (553), Expect = 3.366e-59
Identity = 117/319 (36.68%), Postives = 179/319 (56.11%), Query Frame = 1
Query: 1303 VLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTS--KLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD---------GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGG-----LCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDK 2211
             +++WCM+P + F    + +RSI+L SGTL P+ + + EL  +F    +   V+  +  F A +  GP GN ++  +  TS  + SF  ELG ++      VP GIL FL S+ +++   Q       + +I   K +  EPR++SE+   +D +   + D         G+L+ AVFRGK SEG+DFAD+ AR+VI+VGIPYP+  D +V  K  YN    K  +  +L+G+EWY  QA+RALNQALGRC+RH+ DWGAM+MID RL+       GG     +  WI+ +   + + ++   + + FI     V+  K
Sbjct:  661 TISLWCMSPALSFFDAFNETRSIVLASGTLCPMDTLKTELGMEFKQQVEGDQVINKDNIFAAVLPIGPFGNRIQCTYRNTSDPESSFYCELGAIIKYVCSNVPAGILCFLPSYRVLDQLKQCMIRNSTMRQIEMKKVVLYEPRRSSELTSVMDQFDAAIFDPSRFGANINGSLMFAVFRGKVSEGIDFADDRARVVISVGIPYPNAMDDQVNAKKLYNDQNSK--EKGILTGDEWYTTQAYRALNQALGRCLRHKNDWGAMLMIDERLERQTGNLVGGASSARVSKWIRAQLKSYPSFKEFNANFREFIQRRHAVEKAK 977          

HSP 2 Score: 133.265 bits (334), Expect = 1.009e-31
Identity = 68/180 (37.78%), Postives = 107/180 (59.44%), Query Frame = 1
Query:  328 QVKIFFGTRTHKQIGQVIRELKKSAYSNT-RMSILSGRNLSCLNQEVLMSKEIDQNCKDL--CKKMGCIYKIDNQPHPE--------------TTWDIESI--SMKLKKVKICPYFQFKSWM-KSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDID 807
            +V+I++GTRTHKQI QV++E  +  Y+   + +IL+ R  SC+N       +I Q CK++     +GC +K   +P  E                +D+E I  ++ +   ++CPYF     + + ADI+FCP++Y+++P IR S  V + N+I+ILDEAHNIED CRE AS S + K++D
Sbjct:  237 RVRIYYGTRTHKQIAQVVKEFSRLPYAKILKHTILASREQSCINPAARKHADISQYCKEVNSAHSIGCSFKSAMKPRFEKALPLRDHLERNGTVVFDMEKIVETLAISYPQLCPYFSTNRILTQDADIIFCPFSYLVDPLIRNSSDVQIRNSIVILDEAHNIEDTCREAASFSFTEKELD 416          

HSP 3 Score: 58.5362 bits (140), Expect = 1.827e-8
Identity = 30/57 (52.63%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  109 VPVTFP--IEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQY 273
            VPV  P  +  Y  Q  M+ RI+ ++  S+N L E PTGSGKT+ALL ST  WLKQY
Sbjct:   80 VPVRVPRGLSLYSTQKLMIVRILTALKNSQNVLGESPTGSGKTMALLASTCAWLKQY 136          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 154.066 bits (388), Expect = 1.856e-38
Identity = 165/675 (24.44%), Postives = 282/675 (41.78%), Query Frame = 1
Query:  301 NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVL---MSKEIDQNCKDLCKKMGCIYKIDNQPHPET----------------TWDIESI-----SMKLKKV----------KICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLF-----YKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQL----------IDSFIMLVKLMMDSDKTKQNDFSIVITEG---------EKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELN-----CKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVK--DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLS-GNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            ++E ++  K +KIF+ +RTH Q+ Q+  EL K+ +   R+   + R   C+N+EV    ++  I++ C +L +K G   K   Q   +                 +  IE +     S KLK              CPYF  +  +    +V  PY  +L+   RK+ G+ L++N+I+LDEAHN+ +      S  IS K +     L+         +   H+LL M +     +E L+SK+         EDV+       +  QL +N  +        E +L KL   +    E TD   +    +M+L                + KLM   +   + +   +             + + + +  K   G  I  +K   +A     +LN     P     ++   +R+ IL  GT+ P     + L+           F   HV+   +    ++     G   +  + T    +    L   +      +PNG++IF+ S+  +  F ++    G++  I + K++F E RQ +  ++  D + +  K   GA+L AV  GK SEG++F DE  R VI +G+PYP+    ++  +M       K  D Q+ + GN  Y      A+NQA+GR IRHR D+ A+ + D R   +  +    L  WI  R
Sbjct:  174 DEEEEKPLKCLKIFYASRTHSQLEQLAEELAKTRF-QPRIVTCASRGTLCVNEEVKKLKLNHLINEKCMEL-RKNGMSEKEKVQKLEKGTTKKTKTCATSCEFYNSTQIEDVVNGVLSNKLKSTLEVSKQGKLSNGCPYFATRKSVPQCQLVLLPYQVLLHDGTRKAWGIELKDNVIVLDEAHNVLNTISSLYSAEISTKSLTLALRLIREYNAHYKLKLLAHNLLYMKQ-----LESLTSKMLIFLNSQSKEDVM-------TMAQLARNLNI-------LEINLFKLAEYM----EKTDLCKKFHGFYMRLQKEEIKKENEKPKLTGIQKLMAAKEAEPEPEAEPLPPPKPVPSPLFSLKSFIDALTNKCEDGRII-VEKSATEAKFRFMLLN-----PADRLSEVVTSARATILVGGTMEPAQLLVETLSRGSIGADSIRRFSCCHVIDDSQLLAVTVERTVDGKPFQLTYQTRGADTTLRSLATSIQALIPHIPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQPT--SDVWDRFSRAAKTSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERM-------KFLDTQMPNGGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRY--AKESTRRKLSTWIGDR 806          

HSP 2 Score: 54.299 bits (129), Expect = 3.372e-7
Identity = 22/50 (44.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  118 TFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            +FP +PY  QL +MR I   I + +  + E PTG+GK++++LCST+ WL+
Sbjct:    5 SFPFQPYDIQLNLMREIRQCIEQRKIGIFESPTGTGKSLSVLCSTMTWLE 54          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Match: chl-1 (ATP-dependent DNA helicase chl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21489])

HSP 1 Score: 154.066 bits (388), Expect = 1.856e-38
Identity = 165/675 (24.44%), Postives = 282/675 (41.78%), Query Frame = 1
Query:  301 NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVL---MSKEIDQNCKDLCKKMGCIYKIDNQPHPET----------------TWDIESI-----SMKLKKV----------KICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLF-----YKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQL----------IDSFIMLVKLMMDSDKTKQNDFSIVITEG---------EKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELN-----CKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVK--DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLS-GNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            ++E ++  K +KIF+ +RTH Q+ Q+  EL K+ +   R+   + R   C+N+EV    ++  I++ C +L +K G   K   Q   +                 +  IE +     S KLK              CPYF  +  +    +V  PY  +L+   RK+ G+ L++N+I+LDEAHN+ +      S  IS K +     L+         +   H+LL M +     +E L+SK+         EDV+       +  QL +N  +        E +L KL   +    E TD   +    +M+L                + KLM   +   + +   +             + + + +  K   G  I  +K   +A     +LN     P     ++   +R+ IL  GT+ P     + L+           F   HV+   +    ++     G   +  + T    +    L   +      +PNG++IF+ S+  +  F ++    G++  I + K++F E RQ +  ++  D + +  K   GA+L AV  GK SEG++F DE  R VI +G+PYP+    ++  +M       K  D Q+ + GN  Y      A+NQA+GR IRHR D+ A+ + D R   +  +    L  WI  R
Sbjct:  174 DEEEEKPLKCLKIFYASRTHSQLEQLAEELAKTRF-QPRIVTCASRGTLCVNEEVKKLKLNHLINEKCMEL-RKNGMSEKEKVQKLEKGTTKKTKTCATSCEFYNSTQIEDVVNGVLSNKLKSTLEVSKQGKLSNGCPYFATRKSVPQCQLVLLPYQVLLHDGTRKAWGIELKDNVIVLDEAHNVLNTISSLYSAEISTKSLTLALRLIREYNAHYKLKLLAHNLLYMKQ-----LESLTSKMLIFLNSQSKEDVM-------TMAQLARNLNI-------LEINLFKLAEYM----EKTDLCKKFHGFYMRLQKEEIKKENEKPKLTGIQKLMAAKEAEPEPEAEPLPPPKPVPSPLFSLKSFIDALTNKCEDGRII-VEKSATEAKFRFMLLN-----PADRLSEVVTSARATILVGGTMEPAQLLVETLSRGSIGADSIRRFSCCHVIDDSQLLAVTVERTVDGKPFQLTYQTRGADTTLRSLATSIQALIPHIPNGVVIFVPSYDFLFNFQKKMKEFGILKRIEEKKAVFTESRQPT--SDVWDRFSRAAKTSKGAILFAVVGGKMSEGINFCDELGRAVIVIGLPYPNKTSVELRERM-------KFLDTQMPNGGNLLYESLCMHAVNQAIGRAIRHRRDYAAVYLFDDRY--AKESTRRKLSTWIGDR 806          

HSP 2 Score: 54.299 bits (129), Expect = 3.372e-7
Identity = 22/50 (44.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  118 TFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            +FP +PY  QL +MR I   I + +  + E PTG+GK++++LCST+ WL+
Sbjct:    5 SFPFQPYDIQLNLMREIRQCIEQRKIGIFESPTGTGKSLSVLCSTMTWLE 54          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0070807)

HSP 1 Score: 371.703 bits (953), Expect = 7.457e-115
Identity = 240/742 (32.35%), Postives = 382/742 (51.48%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK----QYQSQLLLNSRND-----------ECKENAKQV---------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCK----KMGCIYKI---DNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILK--KSGK-EDCQHDLLT--MLEKMHEVIELLSSKLFYKDEDVLKKTWDLESF-----VQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSI-VITEGEKYAEPINEKV-ASGEWISCKKRKADALNNNFV---LNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY-NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNC 2148
            M E  ++ +PV FP EPYP Q   M ++I+ +    N ++E PTG+GKT++LLCS+L W++    ++Q Q++   + D           +  E AK +         K+ + +RTH Q+ Q +RELK++AY+N R  +L  R+  C++ EV M ++ + N  ++CK       C +++     + HP+    T  DIE +    +++KICPYF  +  +  ADI F PYNY+L+P  RK+  + L N I+ILDEAHNIE IC E AS+ I   D+      + HI++   SG+ +D   D      L+ +  + E+L       D  V+    D  +F      +LL        N+    + L KL   + V  +    +     +F  L D   ++     D        F + V+ E  K      +     G W+  K   A A   + V   +N WC NPG   +Q+ +   RS+ILTSGTL+P+     EL    +   +  H+V   + ++  IG GP    + + ++      +   LGQ +L  + +VP+G+L+F  S+ ++   +  W  +GL  +I   K IF+EPR   +    ++ +++ ++D  GA+ +AV RGK SEG+DFAD   R VI  G+P+P + DPKV+LK  Y   N+ +  ++QLLSG EWYN+ A RA+NQA+GR IRHR D+GA+++ DSR   ++      L  WI+    D   C
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIHCLRDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQKQMVKMEKADFSGLGGGAPGGDLSELAKTMGRANNWGVPKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPEV-MREQGNSNKTNMCKLRVHSKTCSFQMRVESRKDHPDLRGPTIMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAMAIEDVTHIMQVFASGESQDMAGDEPKDFTLDDLTLLKEMLLELEKAIDAIVVDNAVDGTTFPASMMYELLGKANFTYGNVATIVSLLDKLVQYLLVASQ--QMSIRKGGTFTLLSDLLTIVFANKEDVMSKVYASFKVHVLVEESKQGHGKQQGAKQQGGWLG-KGTIAAATGLSKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQQLISNYANRDNPKYISSLGQTILNVARIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRDSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTR--ENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQ--LSKWIRGHLGDRPQC 734          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Fly
Match: CG4078 (gene:FBgn0029798 transcript:FBtr0332398)

HSP 1 Score: 371.703 bits (953), Expect = 7.457e-115
Identity = 240/742 (32.35%), Postives = 382/742 (51.48%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK----QYQSQLLLNSRND-----------ECKENAKQV---------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCK----KMGCIYKI---DNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILK--KSGK-EDCQHDLLT--MLEKMHEVIELLSSKLFYKDEDVLKKTWDLESF-----VQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSI-VITEGEKYAEPINEKV-ASGEWISCKKRKADALNNNFV---LNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY-NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNC 2148
            M E  ++ +PV FP EPYP Q   M ++I+ +    N ++E PTG+GKT++LLCS+L W++    ++Q Q++   + D           +  E AK +         K+ + +RTH Q+ Q +RELK++AY+N R  +L  R+  C++ EV M ++ + N  ++CK       C +++     + HP+    T  DIE +    +++KICPYF  +  +  ADI F PYNY+L+P  RK+  + L N I+ILDEAHNIE IC E AS+ I   D+      + HI++   SG+ +D   D      L+ +  + E+L       D  V+    D  +F      +LL        N+    + L KL   + V  +    +     +F  L D   ++     D        F + V+ E  K      +     G W+  K   A A   + V   +N WC NPG   +Q+ +   RS+ILTSGTL+P+     EL    +   +  H+V   + ++  IG GP    + + ++      +   LGQ +L  + +VP+G+L+F  S+ ++   +  W  +GL  +I   K IF+EPR   +    ++ +++ ++D  GA+ +AV RGK SEG+DFAD   R VI  G+P+P + DPKV+LK  Y   N+ +  ++QLLSG EWYN+ A RA+NQA+GR IRHR D+GA+++ DSR   ++      L  WI+    D   C
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIHCLRDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQKQMVKMEKADFSGLGGGAPGGDLSELAKTMGRANNWGVPKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPEV-MREQGNSNKTNMCKLRVHSKTCSFQMRVESRKDHPDLRGPTIMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAMAIEDVTHIMQVFASGESQDMAGDEPKDFTLDDLTLLKEMLLELEKAIDAIVVDNAVDGTTFPASMMYELLGKANFTYGNVATIVSLLDKLVQYLLVASQ--QMSIRKGGTFTLLSDLLTIVFANKEDVMSKVYASFKVHVLVEESKQGHGKQQGAKQQGGWLG-KGTIAAATGLSKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQQLISNYANRDNPKYISSLGQTILNVARIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISCKKPIFLEPRSKDQFTSTMEEFYQAIRDSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTR--ENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQ--LSKWIRGHLGDRPQC 734          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Fly
Match: Xpd (gene:FBgn0261850 transcript:FBtr0071576)

HSP 1 Score: 189.889 bits (481), Expect = 2.551e-50
Identity = 174/736 (23.64%), Postives = 319/736 (43.34%), Query Frame = 1
Query:  115 VTFPIEP-YPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMS---------ILSGRNLSCLNQEVLMSKE---IDQNCKDL-----------------CKKM-GCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFI---------------MLVKLMMDSDKTKQNDFSIVI---TEGEKYA-------EPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVK--DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL-LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKID 2136
            V FP E  YP+Q   M  +  S++   +CL+E+P+G+GKT  LL   + ++ ++   +                K+ + +RT  +I +VI EL+       R           +LS R   C++ EV   +E   +D  C  L                 C+   G   +      P   + I+ +    +    CPYF  +  +  A IV   Y+Y+L+P I + +   +   + ++ DEAHNI+++C +  S+ I+ + ++     L H L K  ++  + D   + E+   +++ L      +D D++     L + V L +    ++ N  +F + L +    I+    +     E P+ F++ I S I                L++ +  SD T+    +++    T    Y        EP ++K  +               +N +L+  C++  I    +    +++++TSGTLSP+  + K L+  F  +  +   +   +  L    +  G     + + F T    +     GQ+L++ ++ VP+GI+ F +S+  +E  +  W + G+++ + ++K +FIE +  +E +  +  Y K      GA+LLAV RGK SEGVDF     R V+  GIPY       +  +++Y         DQ  +  N++    A R   Q +GR +R + D+G MI  D R   S       L  WIQ+  +D
Sbjct:   10 VYFPYEYIYPEQYAYMLELKRSLDAKGHCLLEMPSGTGKTATLLSLIVAYMVEHPETVR---------------KLIYCSRTVPEIEKVIAELQNLMVYYERHCPNPPPFTGLVLSSRKNMCIHPEVSKEREGKAVDGKCYGLTASYIRERHEMDTETPICQYFEGFSLEGKESTLPVGVYSIDDLKEYGRSRNWCPYFLARYAIAHAHIVVYSYHYLLDPKIAQVVSKEMSRESCVVFDEAHNIDNVCIDSMSVKINRRTVERSTNALNH-LTKLVQDIREEDTNRLNEEYQRMVQGLKDASVQRDTDMILANPVLPNDV-LTEVVPGNIRNADHFLSFLRRFIEYIKTRLRVHHVVQESPAGFLKDISSKICIERKPLRFCAERLSSLLRTLEISDLTEYGALTLITHFATLVSTYTKGFTIIIEPFDDKTPT--------------VSNPILHFSCLDSSIAMAPVFSRFQTVVITSGTLSPMDMYPKILD--FDPVVMSSFTMTLARPCLLPMIVSKGNDQVTISSKFETREDTAVIRNYGQLLVEVAKTVPDGIVCFFTSYLYLESVVASWYDQGIVDTLLRYKLLFIETQDNAETSYALMNYVKACDCGRGAVLLAVARGKVSEGVDFDHHYGRAVLMFGIPYVYTQSRILKARLDY-------LRDQFQIRENDFLTFDAMRHAAQCVGRALRGKTDYGIMIFADKRF--SRHDKRSRLPKWIQEHLVD 703          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Fly
Match: CG11403 (gene:FBgn0026876 transcript:FBtr0070245)

HSP 1 Score: 135.576 bits (340), Expect = 2.369e-32
Identity = 85/287 (29.62%), Postives = 145/287 (50.52%), Query Frame = 1
Query: 1303 VLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKEL--NCKFSAIFQ-AGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL--LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKID 2136
             L    ++P   F  I   +R+I++  GT+ P    +++L   C    + +   HVV  +      I NGPSG  +   F+         EL  +L    +VVP G++ FL S+  ++   +    +G +  I   KS+F E   ++E  + +D Y   +K     GALLL+V  GK SEG++FAD+  R V+ VG+PY +   P++  +M       +H D++L   +GNE+Y     +A+NQ +GR +RH +D+  + ++D R   ++P   G L  WI +  ++
Sbjct:  564 TLKYILLDPAEQFADIVAEARAIVIAGGTMQPTKELKEQLFTGCHDRLVERFYNHVVANDAILPFVISNGPSGAPLSFKFAHRGSAEMLRELSMILRNLCQVVPGGVVCFLPSYEYLDKVYKYLEQSGTLETISGRKSVFREVSGSAE--QLLDNYALAIKRPASYGALLLSVVGGKLSEGLNFADDLGRAVLVVGLPYSNSLSPELRQRM-------QHLDEKLGPGAGNEYYENLCVKAVNQCIGRAVRHIKDYACVYLLDKRF--ADPKIRGKLPKWISRHIVE 839          

HSP 2 Score: 58.151 bits (139), Expect = 2.891e-8
Identity = 49/200 (24.50%), Postives = 91/200 (45.50%), Query Frame = 1
Query:  301 NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSI-LSGRNLSCLNQEVLMSKEI---DQNCKDLCKKMG-----------------CIYKIDNQPHP------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKM 819
             +  ++  + V+IFF +RTH Q+ Q++ EL+K+ +  +  SI L  R   C N  V   K +   ++ C D+  K                   C +K  +              DIE ++ +      C Y+  +S ++ A ++  PY  +L    R  +G++L+ +I+I+DEAHN+ D   +     IS + ++  K+
Sbjct:  178 QEAAEDRYRPVQIFFCSRTHSQLAQIVAELRKTPHGQSVRSISLGSRQQLCGNPAVRKLKHVGLMNERCLDMATKKARPNPSKKSRLTAEANSRCPFKAASLVESLRDLALTEPLDIEELANEGTACGGCSYYASRSAVEHAQLILLPYQLLLQKSARNQLGISLKGSIVIVDEAHNLLDSVAQLHGSEISRQQLERAKV 377          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 409.838 bits (1052), Expect = 3.070e-127
Identity = 224/629 (35.61%), Postives = 346/629 (55.01%), Query Frame = 1
Query:  334 KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRV---NG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV--LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV---------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+         C+    ++K+ +Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++   +   +  +  ++  + + D    LL     +   ++     L  ++ +   K W     + + +   +  +     + +LA  L  E RV   NG E T     I S+   ++ S  M+++ +   +    +D+ + + +   +    +   A G +    +R+        V  L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ +IG GP G  + A F      +FQDE+G +LLK    V  G+L FL S+ +++    RWTNTGL +++ + K++  EPR     + +E +  Y++ +         +DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W+++
Sbjct:  272 KIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNERCKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEIDGMVTHNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSNTQSMLKSLFMVLEFLFRQNCRFADDYRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSSTVRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAK--SRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQ 898          

HSP 2 Score: 72.7886 bits (177), Expect = 1.259e-12
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            VE+ +  V + FP + YP QL MM  II  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    6 VEYTIGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 409.838 bits (1052), Expect = 4.304e-127
Identity = 224/629 (35.61%), Postives = 346/629 (55.01%), Query Frame = 1
Query:  334 KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRV---NG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV--LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV---------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+         C+    ++K+ +Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++   +   +  +  ++  + + D    LL     +   ++     L  ++ +   K W     + + +   +  +     + +LA  L  E RV   NG E T     I S+   ++ S  M+++ +   +    +D+ + + +   +    +   A G +    +R+        V  L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ +IG GP G  + A F      +FQDE+G +LLK    V  G+L FL S+ +++    RWTNTGL +++ + K++  EPR     + +E +  Y++ +         +DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W+++
Sbjct:  273 KIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNERCKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEIDGMVTHNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSNTQSMLKSLFMVLEFLFRQNCRFADDYRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSSTVRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAK--SRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQ 899          

HSP 2 Score: 72.7886 bits (177), Expect = 1.309e-12
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            VE+ +  V + FP + YP QL MM  II  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    6 VEYTIGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 409.453 bits (1051), Expect = 4.522e-127
Identity = 224/629 (35.61%), Postives = 346/629 (55.01%), Query Frame = 1
Query:  334 KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRV---NG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV--LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV---------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+         C+    ++K+ +Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++   +   +  +  ++  + + D    LL     +   ++     L  ++ +   K W     + + +   +  +     + +LA  L  E RV   NG E T     I S+   ++ S  M+++ +   +    +D+ + + +   +    +   A G +    +R+        V  L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ +IG GP G  + A F      +FQDE+G +LLK    V  G+L FL S+ +++    RWTNTGL +++ + K++  EPR     + +E +  Y++ +         +DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W+++
Sbjct:  272 KIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNERCKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEIDGMVTHNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSNTQSMLKSLFMVLEFLFRQNCRFADDYRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSSTVRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAK--SRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQ 898          

HSP 2 Score: 72.7886 bits (177), Expect = 1.327e-12
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            VE+ +  V + FP + YP QL MM  II  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    6 VEYTIGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 409.838 bits (1052), Expect = 4.690e-127
Identity = 224/629 (35.61%), Postives = 346/629 (55.01%), Query Frame = 1
Query:  334 KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRV---NG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV--LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV---------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+         C+    ++K+ +Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++   +   +  +  ++  + + D    LL     +   ++     L  ++ +   K W     + + +   +  +     + +LA  L  E RV   NG E T     I S+   ++ S  M+++ +   +    +D+ + + +   +    +   A G +    +R+        V  L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ +IG GP G  + A F      +FQDE+G +LLK    V  G+L FL S+ +++    RWTNTGL +++ + K++  EPR     + +E +  Y++ +         +DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W+++
Sbjct:  272 KIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNERCKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEIDGMVTHNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSNTQSMLKSLFMVLEFLFRQNCRFADDYRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSSTVRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAK--SRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQ 898          

HSP 2 Score: 72.7886 bits (177), Expect = 1.287e-12
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            VE+ +  V + FP + YP QL MM  II  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    6 VEYTIGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 409.838 bits (1052), Expect = 4.690e-127
Identity = 224/629 (35.61%), Postives = 346/629 (55.01%), Query Frame = 1
Query:  334 KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRV---NG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV--LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV---------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+         C+    ++K+ +Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++   +   +  +  ++  + + D    LL     +   ++     L  ++ +   K W     + + +   +  +     + +LA  L  E RV   NG E T     I S+   ++ S  M+++ +   +    +D+ + + +   +    +   A G +    +R+        V  L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ +IG GP G  + A F      +FQDE+G +LLK    V  G+L FL S+ +++    RWTNTGL +++ + K++  EPR     + +E +  Y++ +         +DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W+++
Sbjct:  272 KIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVVPHANRNERCKEFLEAKNGRSCRYYHNVHKMRDQSTLQWVHGLHQAWDIEELVRLGGKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLKEQIVVLDEAHNIEDCARESASFTLNQAQLLLARDEIDGMVTHNIRRDQHRPLLAFCCSLTNWVQESCGGLEEREYESSCKVWTGVEVLGIFRGLGITADTFPLLQKNLAAVLEKEERVGLVNGREETVQVPTISSNTQSMLKSLFMVLEFLFRQNCRFADDYRVALQQSYMWTTQQDLPDAQGFFARPHRRRQSNRTKTLVHTLSFWCLNPAVAFSDLSSTVRSIVLTSGTLSPMGSFSSELGIKFSIQLEANHVINKSQVWVGTIGAGPQGRKLCATFQHAETFAFQDEVGALLLKVCHTVSRGVLCFLPSYKMLDKLRDRWTNTGLWDKLEECKTVITEPRGGGKGDFDELLQTYYEAIRGTAAKGEKRDGALLVAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDKHAK--SRGLLPGGRWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRTNPNKYITGLSKWVRQ 898          

HSP 2 Score: 72.7886 bits (177), Expect = 1.287e-12
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            VE+ +  V + FP + YP QL MM  II  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    6 VEYTIGGVKINFPCKAYPSQLAMMNSIIRGLNNGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 404.831 bits (1039), Expect = 5.438e-127
Identity = 226/631 (35.82%), Postives = 357/631 (56.58%), Query Frame = 1
Query:  316 ENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQ------PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNE----IRVNGE--ITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALN-NNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV-----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            E  K  KIFFGTRTHKQI Q+ REL+++AYS+ RM+ILS R  +C++ ++  ++  ++ CK+L        C+    + K++ Q         +  WDIE +    K+++ CPYF  +  M+ ADIVFCPYNY+L+  IR+SM + LE  ++ILDEAHNIED  RE AS S S + + Y +  +  ++    +      L  +   +   I   S +L  ++ +   K W+ +  + +  +  +        + +LA +  +      ++G+  +    +  P + M L   F++L  L   +++  + D+ I + +   +A   +    +G +   + R+A       + LN WC+NP + F  +S  +R+I+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T    FQDE+G +LL   + V +G+L FL S+ ++E    RW +TGL   + + K++  EP+    ++ ++ +  Y+  +     KDGALL+AV RGK SEG+DF+D  AR V+TVGIP+P+I D +V LK  YN    K     LL G++WY IQA+RALNQALGRCIRH+ DWGA+I++D R   SNP Y  GL  W+++
Sbjct:  236 EKPKVPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHPDIHSNR--NEKCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASFSCSDEQLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQLVEREYEASCKVWNGKEILAIFHDMGITNATFPLLKANLAAVVEKEEKITMLHGQENVIKIPTLSPQTQMVLKGLFLVLDYLFRQNNRFAE-DYRIALQQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSSNARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKDGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAK--SRGLLPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFR-SNPKYITGLSKWVRQ 860          

HSP 2 Score: 70.0922 bits (170), Expect = 1.031e-11
Identity = 32/85 (37.65%), Postives = 52/85 (61.18%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKI 339
            + E+ +  V + FP   YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W +    +  ++ +++E KE  K  ++
Sbjct:    5 LSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAWQQSLYGKQAVDEKSNE-KECTKMERV 88          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 400.979 bits (1029), Expect = 4.679e-126
Identity = 226/636 (35.53%), Postives = 357/636 (56.13%), Query Frame = 1
Query:  307 ECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQ------PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNE----IRVNGE--ITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALN-NNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV-------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            E  E  K  KIFFGTRTHKQI Q+ REL+++AYS+ RM+ILS R  +C++ ++  ++  ++ CK+L        C+    + K++ Q         +  WDIE +    K+++ CPYF  +  M+ ADIVFCPYNY+L+  IR+SM + LE  ++ILDEAHNIED  RE AS S S + + Y +  +  ++    +      L  +   +   I   S +L  ++ +   K W+ +  + +  +  +        + +LA +  +      ++G+  +    +  P + M L   F++L  L   +++  + D+ I + +   +A   +    +G +   + R+A       + LN WC+NP + F  +S  +R+I+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T    FQDE+G +LL   + V +G+L FL S+ ++E    RW +TGL   + + K++  EP+    ++ ++ +  Y+  +       K GALL+AV RGK SEG+DF+D  AR V+TVGIP+P+I D +V LK  YN    K     LL G++WY IQA+RALNQALGRCIRH+ DWGA+I++D R   SNP Y  GL  W+++
Sbjct:  181 ENGEKPKVPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHPDIHSNR--NEKCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASFSCSDEQLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQLVEREYEASCKVWNGKEILAIFHDMGITNATFPLLKANLAAVVEKEEKITMLHGQENVIKIPTLSPQTQMVLKGLFLVLDYLFRQNNRFAE-DYRIALQQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSSNARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKGKYGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAK--SRGLLPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFR-SNPKYITGLSKWVRQ 810          

HSP 2 Score: 68.5514 bits (166), Expect = 3.172e-11
Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            + + E+ +  V + FP   YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    3 SALSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Match: phlpp2 (PH domain and leucine rich repeat protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-964802])

HSP 1 Score: 403.675 bits (1036), Expect = 1.582e-124
Identity = 228/634 (35.96%), Postives = 358/634 (56.47%), Query Frame = 1
Query:  307 ECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQ------PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNE----IRVNGE--ITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALN-NNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            E  E  K  KIFFGTRTHKQI Q+ REL+++AYS+ RM+ILS R  +C++ ++  ++  ++ CK+L        C+    + K++ Q         +  WDIE +    K+++ CPYF  +  M+ ADIVFCPYNY+L+  IR+SM + LE  ++ILDEAHNIED  RE AS S S + + Y +  +  ++    +      L  +   +   I   S +L  ++ +   K W+ +  + +  +  +        + +LA +  +      ++G+  +    +  P + M L   F++L  L   +++  + D+ I + +   +A   +    +G +   + R+A       + LN WC+NP + F  +S  +R+I+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T    FQDE+G +LL   + V +G+L FL S+ ++E    RW +TGL   + + K++  EP+    ++ ++ +  Y     +K  KDGALL+AV RGK SEG+DF+D  AR V+TVGIP+P+I D +V LK  YN    K     LL G++WY IQA+RALNQALGRCIRH+ DWGA+I++D R   SNP Y  GL  W+++
Sbjct:  243 ENGEKPKVPKIFFGTRTHKQIAQITRELRRTAYSSVRMTILSSREHTCVHPDIHSNR--NEKCKELLEAKDGHSCRFYHGVQKMNEQNLLKYRHGVDKAWDIEELVGLGKRLRACPYFAARELMQEADIVFCPYNYLLDSQIRESMDIFLEGQVVILDEAHNIEDCARESASFSCSDEQLMYARDEIDSMVNHGIRVSDHEPLRAVCYSLTNWIRECSDQLVEREYEASCKVWNGKEILAIFHDMGITNATFPLLKANLAAVVEKEEKITMLHGQENVIKIPTLSPQTQMVLKGLFLVLDYLFRQNNRFAE-DYRIALQQSYTWANRQDIPDENGFFARPRNRRAVRQKIMVYTLNFWCLNPAVAFSDLSSNARTIVLTSGTLSPMGSFSSELGVKFSIQLEANHVIHKSQVWVGTVGAGPKGRKLCATFQHTETFDFQDEIGALLLSVCQTVSHGVLCFLPSYKMLEKLKDRWMHTGLWENLERIKTVIKEPQGGDKTDFDKMLQMYYDAIRYKGEKDGALLIAVCRGKVSEGLDFSDNNARAVVTVGIPFPNIKDLQVELKRKYNDQHAK--SRGLLPGSQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFR-SNPKYITGLSKWVRQ 870          

HSP 2 Score: 70.0922 bits (170), Expect = 1.131e-11
Identity = 32/85 (37.65%), Postives = 52/85 (61.18%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKI 339
            + E+ +  V + FP   YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W +    +  ++ +++E KE  K  ++
Sbjct:    5 LSEYTIGGVKILFPCRAYPSQLAMMNSIMRGLNCKQHCLLESPTGSGKSLALLCSALAWQQSLYGKQAVDEKSNE-KECTKMERV 88          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Match: ephx3 (epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-5900414])

HSP 1 Score: 201.83 bits (512), Expect = 3.367e-54
Identity = 182/739 (24.63%), Postives = 337/739 (45.60%), Query Frame = 1
Query:  115 VTFPIEP-YPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK-SAYSNTR---------MSILSGRNLSCLNQEV---LMSKEIDQNCKDL-----------------CKKMGCIYKIDNQ-PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDL--ESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLI---------------DSFIMLVKLMMDSDKTKQN------DFSIVITEGEK----YAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL-LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKID 2136
            V FP E  YP+Q   M  +  +++   + ++E+P+G+GKT++LL   + + + Y  ++                K+ + +RT  +I +V+ EL+K   Y+  +         +++ S RNL C+N EV      KEID  C  L                 C+       I  + P P   ++++ +    ++   CPY+  +  +   ++V   Y+Y+L+P I   +   L + ++++ DEAHNI+++C +  S++I+ + ++  +  +   L  + ++  + D   + E+  +++E L      ++ DV      L  E   + +  C   + N  +F   L +L   I+        T E P++F++ +               +    L + +  +D T  +      +F+ +++   K      EP  ++  S               +N VL+  C++  +  K +    +S+I+TSGTLSP+  + K L+  F  +  A   +   +  L    +G G    AM + F T   L+     G +LL+ S VVP+GI+ F +S+  +E  +  W   G++  I+++K IFIE +  +E +  ++ Y +  ++  GA+LL+V RGK SEG+DF     R VI  G+PY  +     +LK      + +   DQ  L  N++    A R   Q +GR IR + D+G M+  D R   S+    G L  WIQ+   D
Sbjct:   10 VYFPYEYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLSLIVAYQRAYPLEV---------------TKLIYCSRTVPEIEKVVEELRKLIEYTQAQTGGTLNFMALALSSRRNL-CVNPEVSALRFGKEIDGRCHSLTASFVRSQKQRDPTVQTCRFFEEFDAIGRETPLPPGIYNLDDLRTLGRQKGWCPYYLARHALGQCNVVVYSYHYLLDPKIADLVSRELSKKSVVVFDEAHNIDNVCIDSMSVTITRRTLERCQTNI-ETLNTAIEKIKETDEKKLKEEYAQLVEGLREASVARETDVYLSNPVLPDEILQEAVPGC---IRNALHFLGFLRRLVGYIKSRLRAGHVTQEGPAAFLRDLYEKVCIERKPMRFCAERLRSLTRTLEIADITDLSPLTLITNFATLVSTYTKGFMIIIEPFEDRTPS--------------ISNPVLHFSCLDSSLAIKPVFQRFQSVIITSGTLSPLDIYPKILD--FRPVTMATFTMTLARVCLCPMVVGRGNDQVAMSSKFETREDLAVMRNYGNLLLEMSAVVPDGIVGFFTSYLYMENIVASWYEQGILENIQRNKLIFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPY--VYTQSRILKA-----RLQFLRDQFHLRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMLFADKRYARSDK--RGKLPLWIQEHLTD 703          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Match: ephx3 (epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-5900414])

HSP 1 Score: 200.29 bits (508), Expect = 1.004e-53
Identity = 178/716 (24.86%), Postives = 334/716 (46.65%), Query Frame = 1
Query:  115 VTFPIEP-YPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK-SAYSNTR---------MSILSGRNLSCLNQEV---LMSKEIDQNCKDL-----------------CKKMGCIYKIDNQ-PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDL--ESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMD--SDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL-LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKID 2136
            V FP E  YP+Q   M  +  +++   + ++E+P+G+GKT++LL   + + + Y  ++                K+ + +RT  +I +V+ EL+K   Y+  +         +++ S RNL C+N EV      KEID  C  L                 C+       I  + P P   ++++ +    ++   CPY+  +  +   ++V   Y+Y+L+P I   +   L + ++++ DEAHNI+++C +  S++I+ + ++  +  +   L  + ++  + D   + E+  +++E L      ++ DV      L  E   + +  C   + N  +F   L +L   I+        T E P++F++ +   + + +  M   +++ +    ++ I +    + P+         +S    K   L   F +  +C++  +  K +    +S+I+TSGTLSP+  + K L+  F  +  A   +   +  L    +G G    AM + F T   L+     G +LL+ S VVP+GI+ F +S+  +E  +  W   G++  I+++K IFIE +  +E +  ++ Y +  ++  GA+LL+V RGK SEG+DF     R VI  G+PY  +     +LK      + +   DQ  L  N++    A R   Q +GR IR + D+G M+  D R   S+    G L  WIQ+   D
Sbjct:   10 VYFPYEYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLSLIVAYQRAYPLEV---------------TKLIYCSRTVPEIEKVVEELRKLIEYTQAQTGGTLNFMALALSSRRNL-CVNPEVSALRFGKEIDGRCHSLTASFVRSQKQRDPTVQTCRFFEEFDAIGRETPLPPGIYNLDDLRTLGRQKGWCPYYLARHALGQCNVVVYSYHYLLDPKIADLVSRELSKKSVVVFDEAHNIDNVCIDSMSVTITRRTLERCQTNI-ETLNTAIEKIKETDEKKLKEEYAQLVEGLREASVARETDVYLSNPVLPDEILQEAVPGC---IRNALHFLGFLRRLVGYIKSRLRAGHVTQEGPAAFLRDLYEKVCIERKPMRFCAERLRSLTRTLEIADITDLS-PLTLITNFATLVSTYT-KGIFLTVGFCV-FFCLDSSLAIKPVFQRFQSVIITSGTLSPLDIYPKILD--FRPVTMATFTMTLARVCLCPMVVGRGNDQVAMSSKFETREDLAVMRNYGNLLLEMSAVVPDGIVGFFTSYLYMENIVASWYEQGILENIQRNKLIFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPY--VYTQSRILKA-----RLQFLRDQFHLRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMLFADKRYARSDK--RGKLPLWIQEHLTD 691          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Match: Brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:MGI Symbol;Acc:MGI:2442836])

HSP 1 Score: 404.831 bits (1039), Expect = 1.816e-125
Identity = 233/649 (35.90%), Postives = 355/649 (54.70%), Query Frame = 1
Query:  265 KQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNG-EITDSTSEIP---SSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPIN--EKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            KQ  +Q   N+   +     K+ KI+FGTRTHKQI Q+ REL+K+AYS   M+ILS R+ SC++ EV+ +    + C +L        C     ++KI NQ   +        WDIE +    +K+K CPY+  +  ++ ADIVFCPYNY+L+  IR++M + L+  ++ILDEAHNIED  RE AS S++   + + +  L  ++  + ++     L  +   +   +E  S  L  +  +   K W     +  L    +        + HL A L+ E +V      +   +IP   +S   ++    M++  +   +    +D+ + I +   +   I   +K         KK     +  N  LN WC+NP + F  I+D  R+I+LTSGTLSP+ SF  EL   FS   +A HV+   + ++ ++G+GP G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L+E   +RW  TGL + +   K++  EP+  + ++ +E +  Y     FK  KDGALL+AV RGK SEG+DF+D+ AR VITVGIP+P++ D +V LK  YN +  K     LL G +WY IQA+RALNQALGRCIRH+ DWGA+I++D R + +   Y  GL  W++++
Sbjct:  225 KQGNNQEPANTVKKDHGGQCKRPKIYFGTRTHKQIAQITRELRKTAYSGVPMTILSSRDHSCVHPEVVGNFNRKEKCMELLDGKHGKSCYFYHGVHKISNQQTLQHLQGMSRAWDIEELVSLGRKLKACPYYTARELIEDADIVFCPYNYLLDSQIRETMDIKLKGQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSLINGNIRKKSHEPLRDVCYNLINWLETNSKHLVERGYESSCKIWSGNEMLLNLYRMGITTATFPVLQRHLSAVLQKEEKVTPIHGKEEAIQIPIISASTQVVLKGLFMVLDYLFRENSRFADDYKVAIQQTYSWTNQIAIFDKTGVLAVPKNKKHSRQKIGVN-ALNFWCLNPAVAFSDINDKVRTIVLTSGTLSPLKSFSSELGVTFSIQLEANHVISNSQVWVGTVGSGPKGRNLCATFQHTETFEFQDEVGMLLLSVCQTVSQGILCFLPSYKLLEKLRERWIFTGLWHSLESVKTVIAEPQGGEKTDFDELLQVYYDAIKFKGEKDGALLIAVCRGKVSEGLDFSDDNARAVITVGIPFPNVKDLQVELKRQYNDHHSK--SRGLLPGRQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFNNNPNRYISGLSKWVRQQ 870          

HSP 2 Score: 70.8626 bits (172), Expect = 5.955e-12
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            + ++ +  V + FP   YP QL MM  I+  +N S++CL+E PTGSGK++ALLCS L W
Sbjct:    5 LSDYTIGGVKIHFPCRAYPAQLAMMNSIVRGLNSSQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 336.265 bits (861), Expect = 1.770e-100
Identity = 225/733 (30.70%), Postives = 362/733 (49.39%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQLLLNSR-----------------------NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEI-------------PSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIV---ITEGEK---YAEPINEKVA--SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M    L+ V V FP +PYP Q   M +++  + K  N ++E PTG+GKT+ LLCSTL W   L+   S L +  R                       + EC  +    KI + +RTH Q+ QVIREL+ +AY   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K K+CPY+  ++  + ADI+F PYNY+L+   RK+  ++L+  ++I DEAHN+E IC E AS  ++ +D+     ++  +L++  +   Q +L     +   +++  SS L  + ED+ K    L    + +   QL  D   +    +++ +L  E ++     G I +S  +I              +   +L+D    +++++   D  + +  S+V   I+   K   + E  + + A  S  W +   RK        VL+ WC +P    ++ +    R++ILTSGTL+P+ SF  E+   F    +  H++   + ++  +  GP G  + + +           LG+ L   + VVP+G+L+F  S+ ++E  ++ W   GL  ++   K +F+EPR     +E IDAY++ V     +GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +      +     Q LSG EWY  QA RA+NQA+GR IRHR D+GA+ + D R 
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGDSIECYTDIP--KIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEV-KKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGEL-----QQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGDDRGVTKPGSYIFELFAEAQITFQTKGCILESLDQIIQHLAGRTGVFTNTAGLQKLMD----IIQIVFSVDPPEGSPGSLVGLGISHSYKVHIHPETSHRRAAKRSDAWSTTASRK-----QGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASNGATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 336.65 bits (862), Expect = 2.585e-100
Identity = 225/733 (30.70%), Postives = 362/733 (49.39%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQLLLNSR-----------------------NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEI-------------PSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIV---ITEGEK---YAEPINEKVA--SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M    L+ V V FP +PYP Q   M +++  + K  N ++E PTG+GKT+ LLCSTL W   L+   S L +  R                       + EC  +    KI + +RTH Q+ QVIREL+ +AY   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K K+CPY+  ++  + ADI+F PYNY+L+   RK+  ++L+  ++I DEAHN+E IC E AS  ++ +D+     ++  +L++  +   Q +L     +   +++  SS L  + ED+ K    L    + +   QL  D   +    +++ +L  E ++     G I +S  +I              +   +L+D    +++++   D  + +  S+V   I+   K   + E  + + A  S  W +   RK        VL+ WC +P    ++ +    R++ILTSGTL+P+ SF  E+   F    +  H++   + ++  +  GP G  + + +           LG+ L   + VVP+G+L+F  S+ ++E  ++ W   GL  ++   K +F+EPR     +E IDAY++ V     +GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +      +     Q LSG EWY  QA RA+NQA+GR IRHR D+GA+ + D R 
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGDSIECYTDIP--KIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEV-KKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGEL-----QQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGDDRGVTKPGSYIFELFAEAQITFQTKGCILESLDQIIQHLAGRTGVFTNTAGLQKLMD----IIQIVFSVDPPEGSPGSLVGLGISHSYKVHIHPETSHRRAAKRSDAWSTTASRK-----QGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASNGATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 336.265 bits (861), Expect = 3.574e-100
Identity = 225/733 (30.70%), Postives = 362/733 (49.39%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQLLLNSR-----------------------NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEI-------------PSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIV---ITEGEK---YAEPINEKVA--SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M    L+ V V FP +PYP Q   M +++  + K  N ++E PTG+GKT+ LLCSTL W   L+   S L +  R                       + EC  +    KI + +RTH Q+ QVIREL+ +AY   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K K+CPY+  ++  + ADI+F PYNY+L+   RK+  ++L+  ++I DEAHN+E IC E AS  ++ +D+     ++  +L++  +   Q +L     +   +++  SS L  + ED+ K    L    + +   QL  D   +    +++ +L  E ++     G I +S  +I              +   +L+D    +++++   D  + +  S+V   I+   K   + E  + + A  S  W +   RK        VL+ WC +P    ++ +    R++ILTSGTL+P+ SF  E+   F    +  H++   + ++  +  GP G  + + +           LG+ L   + VVP+G+L+F  S+ ++E  ++ W   GL  ++   K +F+EPR     +E IDAY++ V     +GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +      +     Q LSG EWY  QA RA+NQA+GR IRHR D+GA+ + D R 
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGDSIECYTDIP--KIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEV-KKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGEL-----QQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGDDRGVTKPGSYIFELFAEAQITFQTKGCILESLDQIIQHLAGRTGVFTNTAGLQKLMD----IIQIVFSVDPPEGSPGSLVGLGISHSYKVHIHPETSHRRAAKRSDAWSTTASRK-----QGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASNGATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Match: Rtel1 (regulator of telomere elongation helicase 1 [Source:MGI Symbol;Acc:MGI:2139369])

HSP 1 Score: 336.65 bits (862), Expect = 3.692e-100
Identity = 225/733 (30.70%), Postives = 362/733 (49.39%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQLLLNSR-----------------------NDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQL--DLENIKNFENHLAKLRNEIRVN----GEITDSTSEI-------------PSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIV---ITEGEK---YAEPINEKVA--SGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQ-ISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            M    L+ V V FP +PYP Q   M +++  + K  N ++E PTG+GKT+ LLCSTL W   L+   S L +  R                       + EC  +    KI + +RTH Q+ QVIREL+ +AY   ++ +L  R   C++ EV   +E +     LC+K      C +      K   Q       DIE +     K K+CPY+  ++  + ADI+F PYNY+L+   RK+  ++L+  ++I DEAHN+E IC E AS  ++ +D+     ++  +L++  +   Q +L     +   +++  SS L  + ED+ K    L    + +   QL  D   +    +++ +L  E ++     G I +S  +I              +   +L+D    +++++   D  + +  S+V   I+   K   + E  + + A  S  W +   RK        VL+ WC +P    ++ +    R++ILTSGTL+P+ SF  E+   F    +  H++   + ++  +  GP G  + + +           LG+ L   + VVP+G+L+F  S+ ++E  ++ W   GL  ++   K +F+EPR     +E IDAY++ V     +GA  LAV RGKASEG+DF+D   R VI  G+PYP   DP+VVLKM +      +     Q LSG EWY  QA RA+NQA+GR IRHR D+GA+ + D R 
Sbjct:    1 MPRVVLNGVTVDFPFQPYPCQQEYMTKVLECLQKKVNGILESPTGTGKTLCLLCSTLAWQQHLRDAVSSLKIAERVQGELFASRTLSSWGSAAAASGDSIECYTDIP--KIIYASRTHSQLTQVIRELRNTAY-RPKVCVLGSREQLCIHPEV-KKQESNHMQISLCRKKVASRSCHFYNNVEAKFLEQDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKGTVVIFDEAHNVEKICEESASFDLTPRDVASGLEIINQVLEEQARVTQQGEL-----QQEFIVDTSSSGLNMELEDIAKLKMILLRLEEAIDAVQLPGDDRGVTKPGSYIFELFAEAQITFQTKGCILESLDQIIQHLAGRTGVFTNTAGLQKLMD----IIQIVFSVDPPEGSPGSLVGLGISHSYKVHIHPETSHRRAAKRSDAWSTTASRK-----QGKVLSYWCFSPSQSMRELVCQGVRTLILTSGTLAPLSSFALEMQIPFPVCLENPHIIDKNQLWVGIVPRGPDGVQLSSAYDKRFSEECLSSLGKALSNIARVVPHGLLVFFPSYPVMEKSLEFWQVQGLARKVEALKPLFVEPRNKGSFSEVIDAYYQQVASPASNGATFLAVCRGKASEGLDFSDMNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMRGRSGVGGQCLSGQEWYQQQASRAVNQAIGRVIRHRHDYGAIFLCDHRF 715          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Match: sp|Q3YK19|FANCJ_CHICK (Fanconi anemia group J protein homolog OS=Gallus gallus OX=9031 GN=BRIP1 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.649e-126
Identity = 243/666 (36.49%), Postives = 362/666 (54.35%), Query Frame = 1
Query:  292 NSRNDECKENAKQV---KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKM-------GCIY-----------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNGEITDSTSEIP--SSFMQLIDSFIMLVKLMMDSDKTK-QNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFV---LNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFID 2184
            +S N + K N  Q    KIFFGTRTHKQI Q+ RELK++AYS   M+ILS R+ +C++  V  S   + N  +LC ++        C+Y            + +  +    WDIE +    KK++ CPYF  +  M  ADIVFCPYNY+L+P IR+SM +NL+  ++ILDEAHNIED  RE  S S++   ++  +  L  ++  + ++     L  M   +   +   SS+L     +   K W  +  +    +  +   +    + HL A L  E +++    +   EIP  SS  Q++   + +V L +  D ++  +D+ + + +   +       V+       K +    L +  V   LN WC+NP + F  ++D+ R+++LTSGTLSP+ SF  EL  KFS   +A HV++  + ++ +IG GP+G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L++    RW +TGL   +   K++  EP+    S+ +E +  Y     FK  KDGALL+AV RGK SEG+DF DE AR VIT+GIP+P++ D +V LK  YN   K      LL G++WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  WI+++     N      SL  F +
Sbjct:  237 DSGNTKKKANGDQTFIPKIFFGTRTHKQIAQITRELKRTAYSGVPMTILSSRDYTCIHPVVSSS---NSNRNELCVELLEGKHGKSCLYYHGVHKLSEHYALQSAHNTYQAWDIEDLVSLGKKLRACPYFAARELMVGADIVFCPYNYLLDPQIRESMEINLKGQVVILDEAHNIEDSAREAVSYSVTESQLNAAREELDFMVNNNIRQKDHEQLRAMCCSLTNWLRESSSQLVETGYETSCKVWSGKEMLNHFHDMGITNISFPILQKHLSAVLEKEEKISMFGKEELVEIPIVSSATQIVLKGLFMVLLYLFKDNSRFADDYRVALQQTYAWTNDNQPDVSDTSAFFTKTKHKRNLRHKTVVHMLNFWCLNPAVAFSDLNDV-RTVVLTSGTLSPMDSFSSELGVKFSIQLEANHVIRNSQVWVGTIGTGPNGRKLCATFQHTETFEFQDEVGALLLSVCQKVGQGILCFLPSYKLLDKLKDRWIHTGLWRNLELVKTVIAEPQGGAKSDFDELLKIYYDAIKFKGEKDGALLIAVCRGKVSEGLDFCDENARAVITIGIPFPNVKDLQVELKRKYNDQHKT--TRGLLPGSQWYEIQAYRALNQALGRCIRHRSDWGALILVDDRFRNNPNKYITGLSKWIRQQVQHHENFGSALESLHAFAE 896          

HSP 2 Score: 73.559 bits (179), Expect = 6.080e-12
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQ-YQSQLLLNSRNDECKENA 324
            +++ ++ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W +  Y+  LL +S   E +E A
Sbjct:    3 SDVSQYTIGGVKIMFPCKAYPSQLAMMNAIVKGLNNRQHCLLESPTGSGKSLALLCSALSWQQSLYEKSLLKSSCEKEDREPA 85          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Match: sp|Q9BX63|FANCJ_HUMAN (Fanconi anemia group J protein OS=Homo sapiens OX=9606 GN=BRIP1 PE=1 SV=2)

HSP 1 Score: 409.838 bits (1052), Expect = 5.415e-126
Identity = 238/679 (35.05%), Postives = 373/679 (54.93%), Query Frame = 1
Query:  244 CSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPET------TWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNGEI-TDSTSEIP---SSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCK-KRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            CST    KQ  SQ   N+   +    +K  KI+FGTRTHKQI Q+ REL+++AYS   M+ILS R+ +C++ EV+ +   ++ C +L        C     ++KI +Q   +T       WDIE +    KK+K CPY+  +  ++ ADI+FCPYNY+L+  IR+SM +NL+  ++ILDEAHNIED  RE AS S++   + + +  L  ++  + ++     L  +   +   +E  +  L  +D +   K W     +  L    +        + H  A L+ E +++     +   E+P   +S   ++    M++  +   +    +D+ I I +   +   I+    +G  +  K K+++       VLN WC+NP + F  I+   ++I+LTSGTLSP+ SF  EL   F+   +A H+++  + ++ +IG+GP G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L+E   +RW +TGL + +   K++ +EP+  + +  +E +  Y     +K  KDGALL+AV RGK SEG+DF+D+ AR VIT+GIP+P++ D +V LK  YN +  K     LL G +WY IQA+RALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W++++       E    SL  F   H +V
Sbjct:  219 CST----KQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRG--LLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKV 891          

HSP 2 Score: 69.707 bits (169), Expect = 8.116e-11
Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 1
Query:   91 EFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            E+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    7 EYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Match: sp|Q5SXJ3|FANCJ_MOUSE (Fanconi anemia group J protein homolog OS=Mus musculus OX=10090 GN=Brip1 PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.270e-124
Identity = 233/649 (35.90%), Postives = 355/649 (54.70%), Query Frame = 1
Query:  265 KQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIRVNG-EITDSTSEIP---SSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPIN--EKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAY-----FKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            KQ  +Q   N+   +     K+ KI+FGTRTHKQI Q+ REL+K+AYS   M+ILS R+ SC++ EV+ +    + C +L        C     ++KI NQ   +        WDIE +    +K+K CPY+  +  ++ ADIVFCPYNY+L+  IR++M + L+  ++ILDEAHNIED  RE AS S++   + + +  L  ++  + ++     L  +   +   +E  S  L  +  +   K W     +  L    +        + HL A L+ E +V      +   +IP   +S   ++    M++  +   +    +D+ + I +   +   I   +K         KK     +  N  LN WC+NP + F  I+D  R+I+LTSGTLSP+ SF  EL   FS   +A HV+   + ++ ++G+GP G  + A F  T    FQDE+G +LL   + V  GIL FL S+ L+E   +RW  TGL + +   K++  EP+  + ++ +E +  Y     FK  KDGALL+AV RGK SEG+DF+D+ AR VITVGIP+P++ D +V LK  YN +  K     LL G +WY IQA+RALNQALGRCIRH+ DWGA+I++D R + +   Y  GL  W++++
Sbjct:  225 KQGNNQEPANTVKKDHGGQCKRPKIYFGTRTHKQIAQITRELRKTAYSGVPMTILSSRDHSCVHPEVVGNFNRKEKCMELLDGKHGKSCYFYHGVHKISNQQTLQHLQGMSRAWDIEELVSLGRKLKACPYYTARELIEDADIVFCPYNYLLDSQIRETMDIKLKGQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSLINGNIRKKSHEPLRDVCYNLINWLETNSKHLVERGYESSCKIWSGNEMLLNLYRMGITTATFPVLQRHLSAVLQKEEKVTPIHGKEEAIQIPIISASTQVVLKGLFMVLDYLFRENSRFADDYKVAIQQTYSWTNQIAIFDKTGVLAVPKNKKHSRQKIGVN-ALNFWCLNPAVAFSDINDKVRTIVLTSGTLSPLKSFSSELGVTFSIQLEANHVISNSQVWVGTVGSGPKGRNLCATFQHTETFEFQDEVGMLLLSVCQTVSQGILCFLPSYKLLEKLRERWIFTGLWHSLESVKTVIAEPQGGEKTDFDELLQVYYDAIKFKGEKDGALLIAVCRGKVSEGLDFSDDNARAVITVGIPFPNVKDLQVELKRQYNDHHSK--SRGLLPGRQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFNNNPNRYISGLSKWVRQQ 870          

HSP 2 Score: 70.8626 bits (172), Expect = 4.165e-11
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            + ++ +  V + FP   YP QL MM  I+  +N S++CL+E PTGSGK++ALLCS L W
Sbjct:    5 LSDYTIGGVKIHFPCRAYPAQLAMMNSIVRGLNSSQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Match: sp|B3MSG8|RTEL1_DROAN (Regulator of telomere elongation helicase 1 homolog OS=Drosophila ananassae OX=7217 GN=GF20802 PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 4.997e-118
Identity = 239/748 (31.95%), Postives = 385/748 (51.47%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK----QYQSQLL-----------LNSRNDECKENAKQV---------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCK-DLCK----KMGCIYKI---DNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQ------------HDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVA---SGEWISCKKRKADALNNNF-----VLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY-NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNC 2148
            M E  ++ +PV FP EPYP Q   M ++I  +    N ++E PTG+GKT++LLCS+L W++    ++Q Q++                 E  + AK +         K+ + +RTH Q+ Q +RELK++AYSN R  +L  R+  C++ EV  S+E+  + K ++CK       C +++     + HP+    +  DIE +    +K+K+CPY+  K  +  ADI F PYNY+L+P  RK+  + L N I+ILDEAHNIE IC E AS+ I   D+      + HI+K    +  Q             DL+ + E + ++ + + +     D  +   T+      +LL        N+      L KL   + V  +   S  +  S    L+   + +V    +S   K +    V  + E+  +P  ++     +G W+S    KA   N +      ++N WC NPG   +Q+ +   RS+ILTSGTL+P+     EL    +   +  H+V   + ++  IG GP    + + ++      +   LGQ +L  S +VP+G+L+F  S+ ++   +  W  +GL  +I   K IF+EPR   +    ++ +++ ++D  GA  +AV RGK SEG+DFAD   R VI  G+P+P + DPKV+LK  Y  +N+ +  ++QLLSGNEWYN++A RA+NQA+GR IRHR D+GA+++ DSR   +       L  WI+    D   C
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIQCLKDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQQQMIKLDKGADLLGGGAGGGPELSDLAKTMGKANNWGVPKVIYASRTHSQLTQAMRELKRTAYSNMRSVVLGSRDQLCIHPEV--SREVGNSNKVNMCKLRVHSKTCTFQLRVESKKDHPDFRGPSIMDIEDLIKVGQKLKMCPYYASKELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAIAIEDVTHIMKAFASDSPQDMAGDEPKDFTIDDLMLLKEMLLDLEKAIDAVAV--DNPIDGATYPASMIYELLGKANFTYGNVATIVALLDKLVQYLMVASQQQMSLRKGGS--FTLLSDLLTIVFANKESVMGKVHASFKVHVQVEESKQPQGKQAPAKQAGGWLS----KASLTNGSTGKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQPLISNYTNRDNPKYISSLGQTILNVSRLVPDGLLVFFPSYPMLNKCVDAWQASGLWADIASKKPIFLEPRGKDQFTSTMEEFYQAIRDSKGACFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLESNRTR--ENQLLSGNEWYNLEATRAVNQAIGRVIRHRNDYGAILLCDSRFKDAAQVQQ--LSKWIRGHLGDRPQC 734          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Match: sp|B4PZB4|RTEL1_DROYA (Regulator of telomere elongation helicase 1 homolog OS=Drosophila yakuba OX=7245 GN=GE16425 PE=3 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.792e-116
Identity = 236/749 (31.51%), Postives = 383/749 (51.13%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK----QYQSQLLLNSRND-----------ECKENAKQV---------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCK----KMGCIYKI---DNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILK--KSGK---------EDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKA-----------DALNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY-NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNC 2148
            M E  ++ +PV FP EPYP Q   M ++I  +    N ++E PTG+GKT++LLCS+L W++    ++Q Q++   + D           +  E AK +         K+ + +RTH Q+ Q +RELK++AY+N R  +L  R+  C++ EV M ++ + N  ++CK       C +++     + HP+    +  DIE +    +++KICPYF  +  +  ADI F PYNY+L+P  RK+  + L N I+ILDEAHNIE IC E AS+ I   D+      + HI++   SG+         +D   D LT+L++M    E     +  ++  V   T+      +LL        N+    + L KL   + V  +            ++   +F ML  L+      K++  S V    + + +    K   G+    K+               ++    ++N WC NPG   +Q+ +   RS+ILTSGTL+P+     EL    +   +  H+V   + ++  IG GP    + + ++      +   LGQ +L  S +VP+G+L+F  S+ ++   +  W  +GL  +I   K IF+EPR   +    ++ +++ ++D  GA+ +AV RGK SEG+DFAD   R VI  G+P+P + DPKV+LK  Y   N+ +  ++QLLSG EWYN+ A RA+NQA+GR IRHR D+GA+++ DSR   ++      L  WI+    D   C
Sbjct:    1 MPESLIAGIPVHFPFEPYPVQRAYMEKVIQCLRDGTNGVLESPTGTGKTLSLLCSSLAWIRTRQSEHQQQMVKMEKADFTGLGGGAAGGDLSELAKTMGRANNWGVPKVIYASRTHSQLTQAMRELKRTAYANMRSVVLGSRDQLCIHPEV-MREQGNSNKTNMCKLRVHSKTCSFQMRVESRKDHPDLRGPSIMDIEDLVKVGQRLKICPYFASRELVPQADITFMPYNYLLDPKARKANKIELGNTIVILDEAHNIEKICEESASVQIKSSDVAMAIEDVTHIMQVFASGESQDMGGDEPKDFTLDDLTLLKEMLLEFEKAIDAVVVENA-VEGTTFPASMMYELLGKANFTYGNVATIVSLLDKLVQYLLVASQ---------QMTIRKGGTFTMLSDLLTIVFANKEDVMSKVYASFKVHVQLEEVKQGHGKQQGGKQHGGWLGKGTIAAATGSIKVAKIINFWCFNPGFGMEQLLNTQVRSVILTSGTLAPLKPLIAELAIPVAQHLENPHIVDQSQVYVKIIGTGPDRQQLISNYANRDNPKYISSLGQTILNVSRIVPDGLLVFFPSYPMLNKCVDAWQASGLWADISVKKPIFLEPRSKDQFTSTMEEFYQAIRDSKGAVFMAVCRGKVSEGLDFADRNGRAVIITGLPFPPLKDPKVILKRRYLEANRTR--ENQLLSGQEWYNLDATRAVNQAIGRVIRHRNDYGAILLCDSRFKDASQVQQ--LSKWIRGHLGDRPQC 734          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Match: A0A4E0RUG0 (Fanconi anemia group J protein OS=Fasciola hepatica OX=6192 GN=D915_007941 PE=4 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 2.675e-151
Identity = 270/828 (32.61%), Postives = 416/828 (50.24%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQY---QSQLLLNSRNDECKENAKQV---------------------------------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL----------CKKMGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLK-KTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSE-------IPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKY-------AEPINEKVASGEWISCKKRKADAL---NNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV---------------------------------------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL---------------------LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            ++F + D+P+ FP +PY  QL +M R+I ++    NCL+E PTG+GKT++LLC++L W+ +    +  +     +D C  NA  V                                 KI+F TRTHKQI QV+REL+K+ Y N +M+ILS R  +C+N  +  S  I + C++L           +K   + +  N+      WDIE +   L  V  CPYF  +   K+ADI+FCPYNY+L+P  R +  + L  +I+ILDEAHNIED  RE AS  I+   +      L +++K++ ++D    L  M+  +  V++L  S+L +  E     + W       LL    L  E     E    KL + +  N     S++E       + SS + L+ +  +++  M   ++    DF +V+ E   Y       +  +NE   S  WIS +  K       N    LN WC+NP IVF++++ ++  +IL SGTLSP+ + E EL   F    +A HV+  ++ F+AS+ +GP GN + A +   S  +FQDE+G ++L+  ++VP G+L FL S+ L++  +QRW  TGL+  +R  K + IEPR +  ++  ++ ++  +                                       ++GA++LAV RGK SEG+DFAD   RLVI +GIPYP+   P+V  K  +N   ++    QL                     LSG++WYN QA+RALNQALGRCIRH EDWGA+++ D+R       Y  G+  WI+ R     N  D  V L+ FI+   +V
Sbjct:    1 MDFLIQDIPINFPYKPYGCQLSIMNRVIEALESKRNCLLESPTGTGKTLSLLCASLAWVNKKLVDRETVSAKGLDDHCANNAVDVHQALKNEKMLDSDASLSLYDDVQEEKENQPEIPKIYFCTRTHKQISQVVRELRKTKYRNAKMTILSSRQHTCINPAIRKSPNITEACQNLLQSGVCEFDQARKKSSLTRALNKLDAGGPWDIEDLVAALTPVPTCPYFCSRKLAKTADIIFCPYNYLLDPINRSATLIELNGHIVILDEAHNIEDASRESASFKITDHQLIKTNEDLENLIKQNLEKDSCEQLKCMIAAVLRVMQLTRSRLVHAGESTQPTQVWTGTEISGLLGTVGLGPEQFLCVERAYRKLSSAVTENPSEVPSSNENSENKLKLASSSLHLMQALFVVLGYMFRDNQKYLKDFRVVLMETVNYERKSTGCSAELNESPLSS-WISKRTNKTKTKLIENRELSLNFWCLNPAIVFREVASLAHCLILMSGTLSPLDALEAELGVDFPIRLEANHVIAKDRLFVASLAHGPGGNRLCATYQYQSTYAFQDEVGNLVLQACDIVPGGVLCFLPSYGLLDKLVQRWEATGLLENLRHVKHVMIEPRSSVGLDAWLEEFYAAIDQSENCGTPTRPRRRRCLKPGDTADNGNQIVAYPDLLDTQNGAIVLAVCRGKVSEGLDFADSYGRLVIAIGIPYPAFNSPQVQQKREFNDASRRLSASQLVAPHGQPQSPSTSSASISNCVLSGSDWYNAQAYRALNQALGRCIRHTEDWGAVLLADARFVEQPGRYLTGISRWIRSRVAHHNNWGDFAVRLRSFIETRTKV 827          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Match: A0A4S2MG60 (Helicase ATP-binding domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000187 PE=4 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.623e-145
Identity = 260/819 (31.75%), Postives = 411/819 (50.18%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQ--YQSQL-------LLNSRNDECKENAKQV------------------------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLC----------KKMGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLK-KTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTS--------EIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGE-----WISCKKRKADALN-NNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD------------------------------GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFD---------------------------DQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            ++F++ ++PV+FP +PY  QL  M R+I ++    NCL+E PTG+GKT++LLCS+L WL +    ++L        LNS   +  EN                            K+++ TRTHKQI Q++REL+K+ Y   +M+ILS R  +C+N  V  +  I + C++L           +K   + +  N    + +WD+E +   L +V  CPYF  +   K+ADIVFCPY+Y+L+P  R +  ++L+ +++ILDEAHNIED  RE  S  I+   +   K  L ++L+K+ + +   DL+TMLE M  V++L  ++L +  E     + W  +    +L    L  E +   E    KL      + E TD           ++ SS + L ++  + ++ M   D     D+  V+ E   Y     E  A  +     W+S +  K+  +      LN WC+NP +VF  ++   R +IL SGTLSP+ + E EL   F    +A HV+  ++  ++++ +GP G  + A F   +   FQDELG +LL+   +VP G+L FL S++L++  +QRW  T L++++R+ K + +EPR +  ++  +  ++  V                                GAL+LAV RGK SEG+DFAD   RLVI VGIPYP+  +P+V  K  +N    +                               ++L+G+EWY+ QA+RALNQALGRCIRH  DWGA++++D+R       Y  G+  WI+ R         L   L+ F+  H  V
Sbjct:    1 MDFQIQNIPVSFPYKPYGCQLSCMNRVIEALESGRNCLIESPTGTGKTLSLLCSSLAWLNKRIVDTELDWSSNCDQLNSEQHDEVENGDTFLREKASPAVFASDQAGKNLESCLPKVYYCTRTHKQIAQLVRELRKTKYRKAKMTILSSRQHTCINPVVKKTSNITEACQNLLLNGFCEFDQPRKKSDLVRTINSLDSKGSWDLEDLVESLSQVPSCPYFCSRRLAKTADIVFCPYSYLLDPINRSATNLDLKGHVVILDEAHNIEDASREAGSFKITEHQLITTKDDLGNLLRKNVEPESCTDLITMLEGMLRVMQLTHTRLVHAGESAQPTQVWTGQEISGILSTVGLGPEKVTRMEMAYRKLSAYTSDSTEWTDRNGRSEGTEQPKLASSSLHLFEALFVALRYMFRDDSKHLGDYRFVLMETINYERQTTESSAEKDNSLNSWLSKRSAKSRYVEARELSLNFWCLNPSVVFSDLASEVRCLILVSGTLSPLEALEAELGVAFPIRLEAAHVIPKDRLLVSTLSHGPGGTRLCATFQNQNTFGFQDELGNLLLQACRLVPGGVLCFLPSYSLLDKLVQRWETTDLLSQLRQVKHVMLEPRSSVGLDSWLAEFYAAVDQSVMSLSRSPRHPVSTSSPASRCHSHSSQITGALVLAVCRGKVSEGLDFADAYGRLVIAVGIPYPAFNNPQVQQKREFNDRAHRSPGTLSIPPKIGPPTNAVASTPPSLSSPRITRVLTGSEWYDAQAYRALNQALGRCIRHLNDWGAILLVDARFVEQPSRYLAGISRWIRSRATLHTQWSTLASDLEQFVASHQAV 819          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Match: A0A1W2W4U1 (Fanconi anemia group J protein homolog OS=Ciona intestinalis OX=7719 GN=LOC100181276 PE=4 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 5.487e-141
Identity = 265/726 (36.50%), Postives = 388/726 (53.44%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK------QYQSQLLLNSRND----EC-------KENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMG-------CI-YKIDNQPHPETT---------WDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSE---IPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEP--RQTSEMNECIDAYFKHVK-------DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            VE  +  V + FP +PYP QL MM  I+  + +SE+CL+E PTGSGKT++LLCS L W +      Q + +L   S  D    EC       KE  K   I+FGTRTHKQI Q+  EL  + Y +  MSILS R  +C++     SK  ++ CK+L K +        CI Y+  N+     +         WD+E +     +VK CPY+  +   K+A I+FCPYNY+++P IR SM ++L+N+I+ILDEAHNIED  RE AS +    D+      L H++      +    L  +L KM   +      L     +   K W  E F+  L    +  + +        K            +   +   + S     + +   ++  ++ S K    D+ + +    ++  P  ++   G W++  KRK+        L+ WC+NP + F  ++D +R IILTSGTLSP+ SF  EL   F    +A HV+   + F+ S+G GP+G+ ++A +  T+ L FQDELG+++     VVP G+L F SS+ ++E   +RW NTGL  +I + K I  EP  R  ++ +  +  ++  V         GAL LAV RGKASEG+DFA+  AR VITVGIP+P+  D +V LK  YN    +  D  LL+GN+WY IQAFRALNQALGRCIRHR DWGA+I++D R   +   Y  GL  W++++
Sbjct:    8 VELMIGGVKIHFPFKPYPSQLSMMSMIVKGLQRSEHCLLESPTGSGKTLSLLCSALAWQQDLAMRLQKKEELYEQSNVDCAEEECCSIEQPPKEKEKVPTIWFGTRTHKQIAQITHELATTQYRHVNMSILSSREHACIHPLNSQSKTKNEGCKELRKGIHPDLPGTHCIFYQNVNRLRSHASLKNCGITQAWDLEDLVKLGTRVKSCPYYAARELQKTASIIFCPYNYLIDPSIRSSMQIDLQNDIVILDEAHNIEDSSREAASFTAVETDLMSTVADLEHLISVESNVEEHQKLHLVLSKMGGWMNKHVKDLKESAYETWSKVWTGEDFIPHLDEWGITADTLSLLVEAFLKAVETKEEEEGGVEEEKKEMIMHSMSKSFLGALFDVLTYILASSKKFAGDYRVTMIRTAQFGIPPPKRTRDG-WVTINKRKSKFFL--LKLHFWCLNPAVAFTDLAD-TRCIILTSGTLSPMSSFSSELGLAFPIQLEAAHVISNSQVFVGSLGCGPNGHRLQATYQNTNSLDFQDELGKLVQSVCNVVPYGVLCFFSSYKMLEKLCERWKNTGLWYDICQKKEIVCEPHGRNKADFDGVLQNFYHTVAMVGTSDLTGALFLAVCRGKASEGLDFANNNARAVITVGIPFPNYRDKQVELKKTYNNFHCQ--DRGLLTGNDWYEIQAFRALNQALGRCIRHRNDWGALIIVDDRFCQNPRKYCKGLSKWVRQK 727          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Match: A0A0X3Q5H2 (Fanconi anemia group J protein homolog (Fragment) OS=Schistocephalus solidus OX=70667 GN=FANCJ PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 7.714e-140
Identity = 269/842 (31.95%), Postives = 419/842 (49.76%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK--------QY--------------------QSQLLLNSRNDE--------------------CKENAKQV------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKIDNQP-------------HPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDI-----DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYK-DEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRV-NGEITDSTS---EIPSS-FMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEP------IN--EKVASGEWISCKKRKADAL----NNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHV---------------------KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYN---------------------------------TNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFI 2181
            +E K+  V +  P +PY  QL M+ R+++++N  + CL+E PTG+GKT+ALLC+TLGW++        QY                     S ++ + + DE                    C   A++       +IFFGTRTHKQI QVIREL+K+ Y+NTRM ILS R  +C+N +V     I+  C +L +   C Y   +QP             H    WD+E    +L KV +CPYF+    +++A IVFCPYNY+L+  +R  +  +LE +III+DEAHN+ED  R+  S ++  KDI     D  K++    L+   KE+ Q  LL +L  +H V+++  S+L    D       W       LL+   L  +  ++  +   KL ++I   NG    S S   E P+S  ++L D    L+  +   +     D+  V+TE   Y         +N  E  +   W+S   +         +    LN WC+NP +    ++  + S+IL SGTL+P+ +   EL  +F    +A HVV  ++ F ASI  GP G+ + A ++  +  +FQD++G +++    +VP G+L F  S+ L++  +QRW  TG+++++ K K I  EPR +S+ +  +  +++ +                     + GA+ LAV+RGK SEG+DFAD+ ARL+++VGIP+P+  +P+V  K  +N                                 T        ++LSG+EWY  QA+RALNQALGRCIRHR DWGA+I+ D R       Y  G+  W++ + +  +   DL  SL  FI
Sbjct:   14 MELKVQGVKIHVPYKPYGCQLSMINRVVSALNDKKCCLLESPTGTGKTLALLCATLGWVENRMECLKEQYINMGDEGPCKACLNLTTNATTSTVVRSKQTDEWYEEFVEHDSAGIASFAEKRCTCGAQEALPERPPRIFFGTRTHKQISQVIRELRKTKYANTRMCILSSRTHTCINPDVRRQSNINDACANLTRMGTCPY---DQPKRRSDLTKCMEDLHRSGPWDLEEYVERLSKVPVCPYFRAWKLVETATIVFCPYNYLLDTVVRGKVASDLEGSIIIIDEAHNLEDAARDATSCTLLEKDILTATEDLHKLIR---LRPPEKENTQ-PLLNLLGSLHRVMDITRSRLVSAGDSANSSHVWTGSEIEGLLQTVGLGEDKFRSIRSCYQKLISKIPTSNGPSQQSFSPYLETPTSGTIRLFDYIFTLLGFLYGEEGHHMADYRAVLTEVVDYERTHGGDNGVNGLEHNSPARWLSKVTKSGSKSRLLESRTLSLNFWCLNPAVCMSSLASCAHSLILASGTLAPLDALAAELGLEFPVRLEANHVVSADRVFAASIARGPGGSRLLANYTNQNSFAFQDDIGSLIVGACRLVPGGVLCFFPSYGLLDKLVQRWELTGMLDKLAKVKHILQEPRTSSDFSAWMSEFYEAIDATRPSAGHSPRSLQDLGLPTQTGAVALAVYRGKVSEGLDFADDYARLIVSVGIPFPAFKNPQVEQKRRFNDALRATALTASNNVAPSLKVTTTTEVRTPGERETTAGPSRVRRVLSGSEWYEAQAYRALNQALGRCIRHRNDWGAIILADCRFTEQPTRYLSGVSRWLRNQVVAHQTWPDLTKSLSRFI 848          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Match: A0A0L7R388 (Fanconi anemia group J protein OS=Habropoda laboriosa OX=597456 GN=WH47_09825 PE=4 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 3.131e-137
Identity = 254/717 (35.43%), Postives = 387/717 (53.97%), Query Frame = 1
Query:  100 LSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQY-----QSQLLLNSRNDEC---------------------KENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKIDNQ-------PHPE-----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTM-LEKMHEVIE--LLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNF----ENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGE----KYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----------GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            +S + V  P++PY  Q+ +M ++I    K ENCL+E PTGSGKT+ALLC  L W   Y     ++ L+ NSR +                       ++  K  KI++GTRTHKQI QV+RELKK+ Y + +M+ILS R  +C+ +      ++  +  D  K+  C +  DN        P  E       WDIE +    K   +CPYF  +S M+ ADI+FCPYNYI++P IR+S+ ++L++ +IILDEAHNIEDICRE AS++     +         + K    +   +D + + ++K+ + ++   L     Y  +++    W      +L    +L       F    +  +A L+     N     +   + S   +++   +M    M+ S++   ND+   +TE      KYA           W S KK++  A +    L + CMNPG++F  +++ +RSIIL SGTL+PV+SF+ ELN  F  +   GHV+  E+ +   +  GP+G  +KA +   +   FQDELG+ML+   E VP+G+L F SS+ ++   M RW +  + N I   K +FIEPR + ++   +  Y + +++          GALLLAVFRGK +EG+DF D+ AR V+TVGIPY    DP + +K+ YN    K     LL G++WY+IQAFRALNQALGRC+RH  DWGA++++D R 
Sbjct:  168 ISGIRVKLPVKPYSCQVAVMNKLIQGCVKKENCLLESPTGSGKTLALLCGVLAWHDHYVEGGSENVLINNSRENSITLFYSTFSSLSFFFWKLEEYRRKKLKIPKIYYGTRTHKQIEQVVRELKKTCYKHKKMTILSSREHTCIQESTRNKTDLCNDLLDPTKRQSCPFYNDNNKKTISSFPAVENRGLNAVWDIEDLVAIGKNEGLCPYFAARSLMEHADIIFCPYNYIVDPDIRESIQLDLKDQVIILDEAHNIEDICREVASVTFREDHLASTAHECESLAKTRAADFSVYDTIKVYIQKLVKFLKNIGLEKHRDYNSDNLSSPYWTGAELQELFNMHELGESAYLTFLAASKAAIADLKKAKEENKMFLKTVKPVISPSTKIVIEHLMFAIRMVTSEQY-MNDYRACVTETTVKDFKYA-------TDNTWYSAKKQEHRARS----LKLLCMNPGVIFSPLANNARSIILASGTLTPVLSFQSELNTPFVHVLNTGHVIPKEQVYATCVPKGPNGIYLKANYQNVNSWGFQDELGKMLVDVCESVPHGVLCFFSSYNVLHTQMDRWKSNFIWNRIASVKQVFIEPRYSGDLTAIMKEYREVIEETSSGPRGKINGALLLAVFRGKVAEGIDFKDDEARCVVTVGIPYGVRKDPVIDMKLKYNDMNVKR---GLLRGSDWYSIQAFRALNQALGRCLRHIHDWGAVLLVDERF 869          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:ZFIN;Acc:ZDB-GENE-081107-11])

HSP 1 Score: 363.999 bits (933), Expect = 1.593e-110
Identity = 223/660 (33.79%), Postives = 352/660 (53.33%), Query Frame = 1
Query:  244 CSTLGWLKQYQSQLLLNSRNDECKENAKQV--KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHPE------TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSIS----LKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHL-AKLRNEIR---VNG-EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNN-FVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPR--QTSEMNECIDAYFKHV-----KDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            C+TLG  ++   +     ++ E + N K+   KIFFGTRTHKQI Q+ RELK++ YS   M+ILS R+ +C++ EV+     ++ CK+L        C+    ++K+  Q   +        WDIE +     K++ C Y+  +  M+ A IVFCPYNY+L+P IR+SM +NL+  I++LDEAHNIED  RE AS +++    L+  + ++ L+ + +++S  E     LL     +   ++  S  L  +D +   K W     +++     +        + HL A L  E R   VNG E T     I SS   ++ S  M+++ +   +    +D+ + + +   ++   +   A G +   ++R+          L+ WC+NP +V +++      + +   + S    F   L C     F  G        ++ ++G GP G  + A F  T   +FQDE+G +LLK  + V  G+L FL S+ L++    RW NTGL  ++ + K++  EPR    S+ +E +  Y++ +     +DGALL+AV RGK SEG+DF D+ AR V+TVGIP+P+I D +V LKM YN    K     LL G  WY IQA+RALNQALGRCIRH+ DWGA+I++D R   +   Y  GL  W+++
Sbjct:  230 CATLGEAQKTGEKTKDKEKDKEKEGNMKKTVPKIFFGTRTHKQITQIARELKRTLYSTVPMTILSSRDHTCVHPEVMPHANRNERCKELLEAKNGLSCRFYHNVHKMREQSSLQWVHGLHQAWDIEELVRLGTKLRSCAYYAARELMQEACIVFCPYNYLLDPLIRESMEINLQGQIVVLDEAHNIEDCARESASFTLNQAQLLQAREEIESLVSYNIRRSNHE----PLLAFCCSLLNWVQESSGSLRERDYESACKVWTGREVLEIFHGFGITAATFPLLQKHLEAVLEKEERIGLVNGREDTVQVPTIASSTQSVLKSLFMVLEFLFRQNCRFADDYRVALQQSYIWSTQQDAPDAQGFFARPQRRRQTRTKTMVHTLSFWCLNPAVVSERLHIFFMHLGIMFSSTSLTHCFWITLCC-----FTPG-------VWVGTVGMGPQGRRLCATFQHTETFAFQDEVGALLLKVCQTVSRGVLCFLPSYKLLDKLRDRWMNTGLWEKLEECKAVITEPRGGAKSDFDELLQTYYEAIRQSGSRDGALLIAVCRGKVSEGLDFTDDNARAVVTVGIPFPNIKDLQVELKMKYNDQHSK--SRGLLPGGRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFRSNPNKYITGLSKWVRQ 871          

HSP 2 Score: 72.7886 bits (177), Expect = 1.160e-12
Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 1
Query:   82 NMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW 261
            + VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCS L W
Sbjct:    4 STVEYTIGGVKINFPCKAYPSQLAMMNSIVRGLNHGQHCLLESPTGSGKSLALLCSALAW 63          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:103025871])

HSP 1 Score: 336.265 bits (861), Expect = 1.638e-100
Identity = 221/741 (29.82%), Postives = 360/741 (48.58%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQV--------------------------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQ----NCKDLCKKMGCIY--KIDNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKD----IDYLKMLLPHILKKSGKEDCQHDLLTMLEKMH-----EVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNC-----QLDLENIKNFENHLAKLRNEIRVNGEITDSTS-EIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEP----INEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQI-SDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 2121
            M    L  V V FP  PYP Q   M ++I  +    N ++E PTG+GKT+ LLC+TLGW + ++  +  ++R    K    ++                          KI + +RTH Q+ QV+ ELK +AY   ++ +L  R   C+NQE+ M +E +      C+       C++   +D +   +    +  D+E +    KK ++CPY+  +S  + AD++F PYNY+L+P  R++  + L+  ++I DEAHN+E +C E  S  ++  D    ID +  LL       GK D   D    +E ++     ++  +   K    D ++   ++++ S  Q +        +L  +   NF+   A +    ++ G +       + +S +Q +   I LV ++  ++ +K++     + + + +  P      +K ++  W S   +K        VL+ WC  PG   +++     R IILTSGTLSP+ SF  E+   F    +  HV+Q ++ F++ +  GP G  +   F           LG  ++  S VVP+G+L+F  S+ +++  ++ W   G  + I   K +F+EPR      E ID ++  V D    G    AV RGKASEG+DFAD   R VI  G+P+P   DP+VVLKM Y     + K    + LSG EWY  QA RA+NQA+GR IRHRED+GA+ + D R    N      L  W++
Sbjct:    1 MPVLSLRGVNVDFPFTPYPCQTDYMNKVIECLQSKVNGVLESPTGTGKTLCLLCATLGWREYFKDSI--SARKISEKMGGAELFPDRPMSSWGTAATDGDVPAYYTDIPKIIYASRTHSQLTQVVSELKNTAY-RPKVCVLGSREQLCINQEI-MKQESNHIKVHMCRAKVSTRSCLFYNNVDEKSTDKDIMNSILDVEDLVKTGKKERVCPYYLSRSLKQHADLIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPYDLTSAIDAVDKLLREQASDIGKGDSSEDF--NVESLNSGLKLDITTIAKIKQILMDLELTINSFEMPSNNQGITKPGSYIYELFEKTHVNFDTKTAIVEAMEQITGYLAGKPGIFLNTSGLQKVADIIQLVFVVDPAEGSKKSQMVNSMKQFKVHIHPDTSNFKKKQSTDVWASSSAKK-----QGNVLSYWCFCPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQKDQIFVSIVDKGPDGVQLSTAFDKRFVPENMASLGNTIVNLSRVVPHGLLVFFPSYPVLDKTLEFWRANGHADRIENMKPMFVEPRGKGTFTEVIDGFYDKVNDPKSNGGSFFAVCRGKASEGLDFADTYGRGVIITGLPFPPRMDPRVVLKMQYLDEMCRNKSSGMKYLSGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRF--KNTDVRAQLPSWVR 728          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Match: rtel1 (regulator of telomere elongation helicase 1 [Source:NCBI gene;Acc:103025871])

HSP 1 Score: 336.265 bits (861), Expect = 3.028e-100
Identity = 221/741 (29.82%), Postives = 360/741 (48.58%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQV--------------------------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQ----NCKDLCKKMGCIY--KIDNQPHPE----TTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKD----IDYLKMLLPHILKKSGKEDCQHDLLTMLEKMH-----EVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNC-----QLDLENIKNFENHLAKLRNEIRVNGEITDSTS-EIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEP----INEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQI-SDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 2121
            M    L  V V FP  PYP Q   M ++I  +    N ++E PTG+GKT+ LLC+TLGW + ++  +  ++R    K    ++                          KI + +RTH Q+ QV+ ELK +AY   ++ +L  R   C+NQE+ M +E +      C+       C++   +D +   +    +  D+E +    KK ++CPY+  +S  + AD++F PYNY+L+P  R++  + L+  ++I DEAHN+E +C E  S  ++  D    ID +  LL       GK D   D    +E ++     ++  +   K    D ++   ++++ S  Q +        +L  +   NF+   A +    ++ G +       + +S +Q +   I LV ++  ++ +K++     + + + +  P      +K ++  W S   +K        VL+ WC  PG   +++     R IILTSGTLSP+ SF  E+   F    +  HV+Q ++ F++ +  GP G  +   F           LG  ++  S VVP+G+L+F  S+ +++  ++ W   G  + I   K +F+EPR      E ID ++  V D    G    AV RGKASEG+DFAD   R VI  G+P+P   DP+VVLKM Y     + K    + LSG EWY  QA RA+NQA+GR IRHRED+GA+ + D R    N      L  W++
Sbjct:    1 MPVLSLRGVNVDFPFTPYPCQTDYMNKVIECLQSKVNGVLESPTGTGKTLCLLCATLGWREYFKDSI--SARKISEKMGGAELFPDRPMSSWGTAATDGDVPAYYTDIPKIIYASRTHSQLTQVVSELKNTAY-RPKVCVLGSREQLCINQEI-MKQESNHIKVHMCRAKVSTRSCLFYNNVDEKSTDKDIMNSILDVEDLVKTGKKERVCPYYLSRSLKQHADLIFMPYNYLLDPKSRRAHNIELKGAVVIFDEAHNVEKMCEESTSFDLTPYDLTSAIDAVDKLLREQASDIGKGDSSEDF--NVESLNSGLKLDITTIAKIKQILMDLELTINSFEMPSNNQGITKPGSYIYELFEKTHVNFDTKTAIVEAMEQITGYLAGKPGIFLNTSGLQKVADIIQLVFVVDPAEGSKKSQMVNSMKQFKVHIHPDTSNFKKKQSTDVWASSSAKK-----QGNVLSYWCFCPGFSMQELLRQEVRCIILTSGTLSPLSSFTCEMQIPFPVSLENPHVIQKDQIFVSIVDKGPDGVQLSTAFDKRFVPENMASLGNTIVNLSRVVPHGLLVFFPSYPVLDKTLEFWRANGHADRIENMKPMFVEPRGKGTFTEVIDGFYDKVNDPKSNGGSFFAVCRGKASEGLDFADTYGRGVIITGLPFPPRMDPRVVLKMQYLDEMCRNKSSGMKYLSGQEWYRQQASRAVNQAIGRVIRHREDYGAIFLCDHRF--KNTDVRAQLPSWVR 728          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 204.912 bits (520), Expect = 1.658e-55
Identity = 183/742 (24.66%), Postives = 334/742 (45.01%), Query Frame = 1
Query:  115 VTFPIEP-YPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK--------SAYSNTRMSI-LSGRNLSCLNQEV---LMSKEIDQNCKDL-----------------CKKMGCIYKIDNQ-PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDL--ESFVQLLKNCQLDLENIKNF-ENHLAKLRNEIRVNGEITDSTSEI-------------PSSF-----------MQLID----SFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL-LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKID 2136
            V FP +  YP+Q   M  +  +++   + ++E+P+G+GKTI+LL   + + K Y  ++                K+ + +RT  +I +V+ EL+K        +   N  +++ LS R   C++ EV      KE+D  C  L                 C+       +  Q P P   ++++ +    +K   CPY+  +  +  A+IV   Y+Y+L+P I   +   L + ++++ DEAHNI+++C +  S++I+ + +D  +  +   L+ + +   + D   + E+   ++E L      ++ D+      L  E   + +       E+   F +  L  L+  +R++  + +S+ +              P  F           +++ D    S I L+        T    F+I+I       EP  +K  +                N VL+  CM+P I  K + +  +S+++TSGTLSP+  + + L+  F  +  A   +   +T L    +G G    AM + F T    +     G +LL+ S +VP+GI+ F +S+  +E  +  W   G++  I+++K IFIE    +E +  ++ Y +  ++  GA+LL+V RGK SEG+DF     R VI  G+PY  +     +LK      + ++  DQ  +  N++    A R   Q +GR IR + D+G MI  D R   ++    G L  WIQ+   D
Sbjct:   10 VYFPYDYIYPEQYSYMLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQKAYPLEV---------------TKLIYCSRTVPEIEKVVEELRKLMEFYTKETGEKNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQHHSNPSQPVCRFYEEFDAVGRQVPIPSGIYNLDDLKDFGRKKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQTNV-DTLQNTIQRIKETDAAKLREEYRRLVEGLKEANVARETDIYLSNPVLPDEVLQEAIPGSIRTAEHFVGFLKRFLEYLKARLRIHHVVQESSPQFLKDIYEKVCIDRKPLRFCAERLRSLLRTLEIADIADFSPITLISHFATLVSTYSKGFTIII-------EPFEDKTPT--------------IANPVLHFSCMDPSIAIKPVFERFQSVVITSGTLSPLDIYPRILD--FRPVTMASFTMTLARTCLCPLIVGRGNDQVAMSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPY--VYTQSRILKA-----RLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK--RGKLPRWIQEHISD 703          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Match: ercc2 (ERCC excision repair 2, TFIIH core complex helicase subunit [Source:NCBI gene;Acc:103044920])

HSP 1 Score: 196.823 bits (499), Expect = 5.322e-53
Identity = 176/723 (24.34%), Postives = 325/723 (44.95%), Query Frame = 1
Query:  157 MRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK--------SAYSNTRMSI-LSGRNLSCLNQEV---LMSKEIDQNCKDL-----------------CKKMGCIYKIDNQ-PHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDL--ESFVQLLKNCQLDLENIKNF-ENHLAKLRNEIRVNGEITDSTSEI-------------PSSF-----------MQLID----SFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL-LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            M  +  +++   + ++E+P+G+GKTI+LL   + + K Y  ++                K+ + +RT  +I +V+ EL+K        +   N  +++ LS R   C++ EV      KE+D  C  L                 C+       +  Q P P   ++++ +    +K   CPY+  +  +  A+IV   Y+Y+L+P I   +   L + ++++ DEAHNI+++C +  S++I+ + +D  +  +   L+ + +   + D   + E+   ++E L      ++ D+      L  E   + +       E+   F +  L  L+  +R++  + +S+ +              P  F           +++ D    S I L+        T    F+I+I       EP  +K  +                N VL+  CM+P I  K + +  +S+++TSGTLSP+  + + L+  F  +  A   +   +T L    +G G    AM + F T    +     G +LL+ S +VP+GI+ F +S+  +E  +  W   G++  I+++K IFIE    +E +  ++ Y +  ++  GA+LL+V RGK SEG+DF     R VI  G+PY  +     +LK      + ++  DQ  +  N++    A R   Q +GR IR + D+G MI  D R   ++    G L  WIQ+
Sbjct:    1 MLELKRTLDAKGHGVLEMPSGTGKTISLLSLIVAYQKAYPLEV---------------TKLIYCSRTVPEIEKVVEELRKLMEFYTKETGEKNNFLALALSSRKNLCIHPEVSSLRFGKEVDGKCHSLTASYIRAQHHSNPSQPVCRFYEEFDAVGRQVPIPSGIYNLDDLKDFGRKKGWCPYYLARYSILHANIVVYSYHYLLDPKIADLVSKELAKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCQTNV-DTLQNTIQRIKETDAAKLREEYRRLVEGLKEANVARETDIYLSNPVLPDEVLQEAIPGSIRTAEHFVGFLKRFLEYLKARLRIHHVVQESSPQFLKDIYEKVCIDRKPLRFCAERLRSLLRTLEIADIADFSPITLISHFATLVSTYSKGFTIII-------EPFEDKTPT--------------IANPVLHFSCMDPSIAIKPVFERFQSVVITSGTLSPLDIYPRILD--FRPVTMASFTMTLARTCLCPLIVGRGNDQVAMSSKFETREDFAVIRNYGNLLLEMSAIVPDGIVAFFTSYVYMENIVASWYEQGILENIQRNKLIFIETPDAAETSMALEKYQEACENGRGAILLSVARGKVSEGIDFVHHFGRAVIMFGVPY--VYTQSRILKA-----RLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMIFADKRYARADK--RGKLPRWIQE 675          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009331.1 (pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 gene:ENSPMAG00000008437.1 transcript:ENSPMAT00000009331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 4.164e-43
Identity = 80/232 (34.48%), Postives = 130/232 (56.03%), Query Frame = 1
Query: 1456 HVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQL------LSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 2121
            HV+   + ++  +  GP    + + +   S  ++   LG+ ++  + ++PNG+L+F  S+ ++++ +Q W N GL ++I + K +F+EP+Q     E I+ ++  + D     A   AV RGK SEG+DFAD   R VI  G+P+P   DP + LKM +    K     ++      LSG EWY  QA RA+NQA+GR IRHR D+GA+I+ D R   S+ +    L  W++
Sbjct:    9 HVIDKHQVWVGIVEKGPDSVQLNSAYRNRSCPAYMSSLGKTIVNLARIIPNGLLVFFPSYTVMDMCLQHWKNEGLSSKIEEIKPMFVEPKQKGLFTEAINGFYDKINDPRCSAAAFFAVCRGKVSEGLDFADANGRAVIITGLPFPPQMDPWIKLKMQFLDEMKAKRSTEMQCEFVGLSGQEWYTQQASRAVNQAIGRVIRHRHDYGAIILCDHRF--SSASAVAQLPSWMR 238          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Match: ercc2 (excision repair cross-complementation group 2 [Source:ZFIN;Acc:ZDB-GENE-040426-997])

HSP 1 Score: 164.466 bits (415), Expect = 1.454e-42
Identity = 173/743 (23.28%), Postives = 323/743 (43.47%), Query Frame = 1
Query:  199 LMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK-SAYSNTR---------MSILSGRNLSCLNQEV---LMSKEIDQNCKDLCKKMG------------CIYKID------NQPHPETTWDIESISMKLKKVKICPYFQFK-SWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLA-------KLRNEIRVNGEITDST---------------------SEIPSSFMQLID-------SFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFE-KELNCKFSAIFQAGHVV----QPEKTFLASI-GNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQV 2199
            ++E+P+G+GKT++LL   + + + + +++                K+ + +RT  +I +VI E+KK  AY             +S+ S +NL C++ EV      KE+D  C  L                 C +  D        P P   + ++ +    ++   CPYF  + S +  A++V   Y+Y+L+P I   +   + + ++++ DEAHNI+++C +  S++I+ + +D     +   L+ + ++  + D   + E+   ++E L      ++ DV      L    ++L++ +    N +N E+ ++        L++ +RV   +++ST                     SE   S ++ ++       S + LV        T  N F+++I       EP  +K  +             LN          N  +    ++D   S+ +  GT + +  F   ++N +F+A+     V+     P +     I   G     M + F T   ++     G +LL+ + VVP+G++ F +S+  +E  +  W   G++  I+++K IFIE +  +E +  ++ Y +  ++  GA+LL+V RGK SEG+DF     R VI  GIPY  +     +LK      +    D   +  N++    A R   Q +GR IR + D+G M+  D R   ++    G L  WIQ+   D         +L L ID   QV
Sbjct:    5 VLEMPSGTGKTVSLLALIVAYQRAFPNEVQ---------------KLVYCSRTVPEIEKVIEEMKKLVAYYEKHTKEPMKFLALSLSSRKNL-CIHPEVSALRFGKEVDGRCHSLTASYVRNRHSSDGSVPVCSFYEDFNTNGREVPMPPGIYSLDDLKEYGRQKHWCPYFLARYSQIMHANVVVYSYHYLLDPKIADLVSKEMSKKSVVVFDEAHNIDNVCIDSMSVNITRRTLDRCSTNI-ETLQTTIQKIRETDATKLKEEYRRLVEGLRDASVARETDVHLANPVLPD--EVLQDAEAVPGNSRNAEHFVSFLKRFVEYLKSRLRVTHVLSESTPAFLKETYDRICIDRKPLRFCSERLRSLLRTLEIADIADFSPLTLVCNFATLVSTYTNGFTLII-------EPFEDKTPT------------ILNPILRFRRHSKNQKLSVHMVNDTRASVNVPCGTRALLNRFPLDKVNTRFTALRCITGVLALTFSPNRGLAMKIVARGNDQVTMSSKFETREDIAVIRNYGNLLLEMTCVVPDGVVCFFTSYHYMESIVAAWYEQGILENIQRNKLIFIETQDGAETSVALEKYHEACENGRGAVLLSVARGKVSEGIDFVHHYGRAVIMFGIPY--VYTQSRILKARLEFLR----DHYQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGVMVFADKRYSRADK--RGKLPRWIQEHITD--------ANLNLTIDEALQV 693          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 148.288 bits (373), Expect = 2.610e-39
Identity = 90/283 (31.80%), Postives = 145/283 (51.24%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLL-----NSRNDECKENAKQV----------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIYKIDNQPHPETTW-----DIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSIS----LKDIDYLKMLLPHILKKSG 849
            M    +  +PV+FP  PY  Q   M ++I+ +N  +N ++E PTG+GKT+ LLC+TL W +    Q +      NS  D+ +E    V          KI + +RTH Q+ Q + ELK ++Y   R+ +L  R   C++ +V+  +E +     LC+       C Y  +N    +T +     D+E +  K KK ++CPYF  +     ADI+F PYNY+L+   R++  ++L   I+I DEAHN+E +C   AS  ++       ID +   L   +K+ G
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQHVRQREQQNSWGDDGREAEAAVTYPGGVGNIPKIIYSSRTHSQLSQAMNELKNASY-KPRVCVLGSREQLCIHPDVV-KQESNHAKVHLCRAKTTSRSCFY-YNNVEEKKTDFIAGIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSIDAVSHFLQMKVKEEG 280          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 147.902 bits (372), Expect = 2.979e-39
Identity = 90/286 (31.47%), Postives = 143/286 (50.00%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLL-----NSRNDECKENAKQV----------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKK----MGCIY--------KIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSIS----LKDIDYLKMLLPHILKKSG 849
            M    +  +PV+FP  PY  Q   M ++I+ +N  +N ++E PTG+GKT+ LLC+TL W +    Q +      NS  D+ +E    V          KI + +RTH Q+ Q + ELK ++Y   R+ +L  R   C++ +V+  +E +     LC+       C Y         +   P P    D+E +  K KK ++CPYF  +     ADI+F PYNY+L+   R++  ++L   I+I DEAHN+E +C   AS  ++       ID +   L   +K+ G
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQHVRQREQQNSWGDDGREAEAAVTYPGGVGNIPKIIYSSRTHSQLSQAMNELKNASY-KPRVCVLGSREQLCIHPDVV-KQESNHAKVHLCRAKTTSRSCFYYNNVEGECAVHLTPTP-GIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSIDAVSHFLQMKVKEEG 283          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Match: RTEL1-TNFRSF6B (RTEL1-TNFRSF6B readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:44095])

HSP 1 Score: 135.961 bits (341), Expect = 2.025e-35
Identity = 93/325 (28.62%), Postives = 154/325 (47.38%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQV-------------------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVL-----MSKEIDQNCKDLCKK----MGCIYKID---------NQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILK-KSGKEDCQHD-----------LLTMLEKMHEVIEL 912
            M    +  +PV+FP  PY  Q   M ++I+ +N  +N ++E PTG+GKT+ LLC+TL W +    Q   + R  E + +   +                   KI + +RTH Q+ Q + ELK ++Y   R+ +L  R   C++ +V+      +K  +     LC+       C Y  +         +Q       D+E +  K KK ++CPYF  +     ADI+F PYNY+L+   R++  ++L   I+I DEAHN+E +C   AS  ++  ++      + H L+ KS  +   HD           LL  LE+  +++EL
Sbjct:    1 MPVLTIGGIPVSFPFTPYKCQEDYMAQVIDCLNLGKNGILESPTGTGKTLCLLCATLAWREHQVGQ---HVRQREQQNSCTAISWSPRNQTLPVTGGVGNIPKIIYSSRTHSQLSQAMNELKNASY-KPRVCVLGSREQLCIHPDVVKQESNHAKVWNNRLVHLCRAKTTSRSCFYYNNVEVYCSLRASQRLAGRIMDVEELVKKGKKHQVCPYFMTQELKHDADIIFMPYNYLLDTKSRRAHSIDLSGKIVIFDEAHNVERLCENAASFDLTPFELASSIDAVSHFLQMKSRTQTVLHDVSIEDVANIKQLLLNLEREIDLVEL 321          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Yeast
Match: RAD3 (5' to 3' DNA helicase; involved in nucleotide excision repair and transcription; subunit of RNA polII initiation factor TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein; mutant has aneuploidy tolerance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000973])

HSP 1 Score: 209.149 bits (531), Expect = 8.537e-58
Identity = 172/722 (23.82%), Postives = 338/722 (46.81%), Query Frame = 1
Query:   88 VEFKLSDVPVTFPIEP-YPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTR----------MSILSGRNLSCLNQEVLMSKE-----IDQNCK-------------------DLCKKMGCIYKIDNQPH-PETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNL-ENNIIILDEAHNIEDICREGASMSISL-------KDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLID--SFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRK----------ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQ-PEKTFLASI-GNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRL 2073
            ++F + D+PV FP    YP+Q   M  I  +++   N ++E+P+G+GKT++LL  T+ +   Y                 +  KI + +RT  +I + + EL+      T+          + + S +NL CL+ EV  SKE     +D+ C+                   +LC+    +Y I+ + + P+  +  E +    ++  +CPYF  +  +   +I+   Y+Y+L+P I + +   + +++I+I DEAHNI+++C E  S+ ++        +  + L   +  + +K   +  Q +   +++ +H    L   +  + +  VL +  DL     L +    ++   ++F + L +L   ++   ++    SE P SF+Q +   +FI    L   S++      ++ +TE E +   + +       IS  +             +A   N ++   C++  I  K + +   S+I+TSGT+SP+  + + LN  F  + Q  + +   +K+FL  I   G    A+ + F   +  S     G ML++ +++ P+G+++F  S+  +E  +  W   G+++E+ KHK I +E     E +  ++ Y K   +  GA+LL+V RGK SEG+DF  +  R V+ +GIP+       +  ++ +     +      +  N++ +  A R   Q LGR +R ++D+G M++ D R 
Sbjct:    1 MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQMHY----------------PEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNL-CLHPEV--SKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRATRGANALDERISEV-RKVDSQKLQDEYEKLVQGLHSADILTDQEEPFVETPVLPQ--DL-----LTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFT-ALKDIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVFERFSSVIITSGTISPLDMYPRMLN--FKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYR------IRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRF 686          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Yeast
Match: CHL1 (Probable DNA helicase; involved in sister-chromatid cohesion and genome integrity and interstrand cross-link repair; interacts with ECO1 and CTF18; mutants are defective in silencing, rDNA recombination, aging and the heat shock response; FANCJ-like helicase family member; mutations in the human homolog, DDX11/ChLR1, cause Warsaw breakage syndrome [Source:SGD;Acc:S000005929])

HSP 1 Score: 161.384 bits (407), Expect = 1.688e-41
Identity = 165/666 (24.77%), Postives = 294/666 (44.14%), Query Frame = 1
Query:  319 NAKQVKIFFGTRTHKQIGQVIRELKKSAYSNT----------RMSILSGRNLSCLNQEVLMSK---EIDQNCKDL-CKKMGCI-YKIDNQ-PH-PET----------TWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDE-DVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINE----KVAS-------GEWISCKKRKADA----LNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSA----IFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLS---FQDELGQMLLKCSEVVP--NGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDG--ALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLL--SGNEWYNIQA---------FRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 2121
            N   VKI++ +RT+ Q+GQ   +L+  ++ ++          +   L+ +   C+N +V+  K    I+  C DL   K GCI Y+  N+  H P+T            DIE +    K + ICPY+  +  +  A++V  PY Y+L+   R S+ +NLEN+I+I+DEAHN+ +      S  ISL+D+                ++C   ++T   K         S+L   +  ++LK    L + +Q +         +KNF+    K+  EI  N   T S   I +  +  +  +I + K+    D   Q   ++   E  K   PI E     V+S        +++ C              N+ +    + P   F+ I + ++ ++L  GT+ P+  F   L  +  +         HV+ P++     I N P     +  F+   ++S     + L Q  +  S+ VP   GI+ F  S+  +   +Q W        +   + IF E +   + ++ +  Y   V +G  +LLLA+  GK SEG++F D+  R V+ VG+P+P+I   ++++       K+KH   +++   G E    +A          +A+NQ++GR IRH  D+  + ++D R +   P +   L  W+Q
Sbjct:  227 NQNPVKIYYASRTYSQLGQFTSQLRLPSFPSSFRDKVPDEKVKYLPLASKKQLCINPKVMKWKTLEAINDACADLRHSKEGCIFYQNTNEWRHCPDTLALRDMIFSEIQDIEDLVPLGKSLGICPYYASREALPIAEVVTLPYQYLLSESTRSSLQINLENSIVIIDEAHNLIETINSIYSSQISLEDL----------------KNCHKGIVTYFNK-------FKSRLNPGNRVNLLKLNSLLMTLIQFI---------VKNFK----KIGQEIDPNDMFTGSN--IDTLNIHKLLRYIKVSKIAYKIDTYNQ---ALKEEESSKNENPIKETHKKSVSSQPLLFKVSQFLYCLTNLTSEGQFFFEKNYSIKYMLLEPSKPFESILNQAKCVVLAGGTMEPMSEFLSNLLPEVPSEDITTLSCNHVI-PKENLQTYITNQP-----ELEFTFEKRMSPSLVNNHLFQFFVDLSKAVPKKGGIVAFFPSYQYLAHVIQCWKQNDRFATLNNVRKIFYEAK---DGDDILSGYSDSVAEGRGSLLLAIVGGKLSEGINFQDDLCRAVVMVGLPFPNIFSGELIV-------KRKHLAAKIMKSGGTEEEASRATKEFMENICMKAVNQSVGRAIRHANDYANIYLLDVRYN--RPNFRKKLSRWVQ 833          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Nematostella
Match: EDO39388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA32])

HSP 1 Score: 316.235 bits (809), Expect = 5.052e-94
Identity = 214/769 (27.83%), Postives = 356/769 (46.29%), Query Frame = 1
Query:  109 VPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSR----------------------------NDECK---ENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQN------CKDLCKKMGCIYKID---NQPHPETT---WDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFM---------------QLIDSFIMLVKLMMDSDKTKQ-------NDFSIVITEGEK------------YAEPINEKVASGE--WISCKKRKADALNNNF----------VLNIWCMNPGIVFKQI-SDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNY--NTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKR 2127
            V V FP +PY  Q+  M ++I  +   +N ++E PTG+GKT+ LLC+TL W + Y + L L  R                            +D C     N +  KI + +RTH Q+ Q ++ELK + Y   R+SI+  R   C+N +VL     D N      C+       C +  +   N+ +P  T    DIE +    +K K+CPY+  +    SADI+F PYNY+L+P  RK+  +++  +I++ DEAHN+E +C E  S  ++  DI                  C  D+L  +E +    +         D D+ +   D+            D E++K  +   +KL  EI      +D +   P  FM               +++++   +  L+ +  + K        +   IV  + +K              EP ++K   G   W S  K      ++ +          +++ WC +PG   K + S    S+ILTSGTLSP+ SF  E+   F    +  HV++  +  +A +   P G  + + +   S   +   LG  +   +  +PNG+L+F  S+ ++   ++ W NTG+   + ++K +F EPR   +  + ++ ++  + D    GA   AV RGK SEG+DF+D   R V+  G+P+P + D KV LKM++    ++K     + L+G EWY  QA RA+NQA+GR IRHR+D+GA+++ D R   + P     L  W++ +
Sbjct:    7 VDVDFPFKPYDCQVAYMEKVIECLQTRKNAVLESPTGTGKTLCLLCATLAWRQSYVANLQLQQRGLCAAKEEEDGFQKSLGNKLAEAASGTWDDSCSNKGSNFEIPKIIYASRTHSQLSQAVQELKATVY-RPRVSIIGSREQLCINSDVLKQ---DSNSAKVHMCRAKVTARTCHFYNNLEGNKSNPAFTTEILDIEDLVRLGQKHKVCPYYMARELKTSADIIFMPYNYLLDPKSRKAHNLDISGSIVVFDEAHNLEKVCEETVSFDLTSFDI----------------ASCVEDVLLCMEYVANAED---------DPDIGEGGTDI------------DPEDLKVLKALFSKLEEEIDQIQLPSDGSKSFPGDFMFELLGNVGIKPNTKDRVLETLEKINTLLANGLRGKHFALQKFTDALQIVFNKTDKGPKSGNSFKVHVQVEPDSKKKQKGLDIWTSGSKLSKKGTSSLYFYSFFMRTMIMIHYWCFSPGHAMKDLMSQGVSSVILTSGTLSPLNSFTAEMQIPFPIRLENPHVIEKHQMMVAVVTKAPDGATLNSSYEFRSTPGYMTGLGNTIANFARTIPNGLLVFFPSYPVMNKCLEHWQNTGIWARLSQYKPMFAEPRGKGDFVQTMEDFYAKINDPSLNGATFFAVCRGKVSEGLDFSDINGRAVVITGLPFPPMMDAKVKLKMSFLDEMSRKDKSAIKGLTGREWYRQQASRAVNQAVGRVIRHRQDFGAILLCDVRF--TYPDALRELPSWVKPQ 732          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Nematostella
Match: EDO46754 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX6])

HSP 1 Score: 200.675 bits (509), Expect = 1.112e-54
Identity = 175/706 (24.79%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  157 MRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKK-SAY--------SNTRMSILSGRNLSCLNQEVLMSKE---IDQNCKDLCKKMG------------CIYKID------NQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENN-IIILDEAHNIEDICREGASMSISLKDIDYLKM---LLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVK--LMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNF----------VLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLAS--IGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD--GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQK 2124
            M  +  +++   +CL+E+P+G+GKT++LL   + +LK    +L                K+ + +RT  +I +V+ ELKK + Y         N     LS R   C++ EV   +E   +D  C  +                 C +  D      ++  P  +++++ +    +K   CPYF  +  +  A+++   Y+Y+L+P I   +   L+   +++ DEAHNI+++C +  S++IS + +D        L  ++ +    D Q     + E+ + ++E L      +D D++     L   V L ++   ++   ++F   + +    ++    I     E P SF+Q I   + + +  L   +++      ++ I E + Y  P+         +S   +  + +   F          +L+  CM+  I  K + D  +S+++TSGTLSP+  + K L+  F  +  A   +   +T L    +  G    AM   F     L+     G +L + S VVP+GI+ F +S+  +E  +  W + G+I+ I+K+K +FIE    +E +  +  Y K  ++  GA+LL+V RGK SEG+DF     R VI  GIPY       +  ++ Y    ++ F+   +  N++    A R   Q +GR IR + D+G M+  D R   S     G L  WIQ+
Sbjct:    1 MLELKRTLDAKGHCLLEMPSGTGKTVSLLSLIVAYLKNKPLEL---------------TKLIYCSRTVPEIEKVMEELKKLTEYYESETGEKPNILALALSSRKNLCIHPEVAGEREGKKVDGKCLSMTASFVRLKHKEDSSVPVCNFYEDFDSLGRDEKMPPGSYNLDDLRQFGRKKGWCPYFLARRAIYHANVIVYSYHYMLDPKIADLVSKELDKKAVVVFDEAHNIDNVCIDSMSVTISRRTLDRSHANVESLASVIDRIKATDAQK----LREEYNRLVEGLRQASEARDTDIVLSNPVLPDEV-LQESVPGNIRKAEHFVGFMRRFIEYLKTRLRIQHVVQESPMSFLQHIYQQVCIERKPLRFCAERLSSLLRTLEIPEMQDYG-PLVLIANFATLVSTYNKGFNIIIEPFDDRTPTIPNPILHFSCMDASIAVKPVFDRFQSVVITSGTLSPIDMYPKILD--FRPVTMATFTMTLARTCLCPMIVSRGSDQVAMTTKFEMREDLAVIRNYGNLLTEMSAVVPDGIVCFFTSYLYMESVVSLWHDQGIISNIQKNKLLFIETTDAAETSLALHNYQKACENGRGAILLSVARGKVSEGIDFDHHYGRAVIMFGIPYVYTQSRILKARLEY---LREQFN---IRENDFLTFDAMRHAAQCVGRAIRGKTDYGIMVFADKRF--SKVDKRGKLPKWIQE 675          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 403.675 bits (1036), Expect = 4.291e-123
Identity = 233/652 (35.74%), Postives = 356/652 (54.60%), Query Frame = 1
Query:  295 SRNDECKENAKQ-----VKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHP-------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSI---SLKDI-DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKV--ASGEWISCKKRK---ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS--EMNECIDAYFKHVK-----DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPT-YSGGLCGWIQK 2124
            S  D  KE AK       KIFFGTRTHKQI Q+  ELK++ YS+  M+ILS R+ +C+N EV+     ++ CKDL        C+    + K+ +  H           WD+E +    K+++ C Y+  +  M+ A I+FCPYNY+L+P IR+SM ++L   I++LDEAHNIED  RE  S ++   SLK   + L  ++ + +++S  E  +     ++  + E   LLS + +    +   K W  +  + +     +  +  +  + +LA  L  E RV      E       I S    ++ +  M++  +   +     D+ + +     +   +   V  A G  +  + R+   A        L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T   +FQDE+G +LL   +V+  G+L FL S+ L++    RW+NTGL  ++ + K++  EPR  +  + +E +  Y+  +K     DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G+ WY IQA+RALNQALGRCIRH+ DWGA+I++D R  G+NP  Y  GL  W+++
Sbjct:  243 STKDTVKEKAKDDKKRIPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDH-HTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGY----ESASKVWSGKDILGIFYGLGITADTFRILKQNLAAVLEKEERVGLVHGKEDMVQVPTISSMTSTVLKNLFMVLDFLYRDNCRFAEDYKVALQRSYSWTNQVPPDVPDAQGFLVRPRPRRRQTARVKTEILTLSFWCLNPAVAFSDLSGSVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCK--SRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRY-GNNPNKYITGLSKWVRQ 886          

HSP 2 Score: 73.559 bits (179), Expect = 6.033e-13
Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            ++ VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCSTL W +
Sbjct:    3 SSAVEYTIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQR 65          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 403.29 bits (1035), Expect = 5.691e-123
Identity = 233/652 (35.74%), Postives = 356/652 (54.60%), Query Frame = 1
Query:  295 SRNDECKENAKQ-----VKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHP-------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSI---SLKDI-DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKV--ASGEWISCKKRK---ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS--EMNECIDAYFKHVK-----DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPT-YSGGLCGWIQK 2124
            S  D  KE AK       KIFFGTRTHKQI Q+  ELK++ YS+  M+ILS R+ +C+N EV+     ++ CKDL        C+    + K+ +  H           WD+E +    K+++ C Y+  +  M+ A I+FCPYNY+L+P IR+SM ++L   I++LDEAHNIED  RE  S ++   SLK   + L  ++ + +++S  E  +     ++  + E   LLS + +    +   K W  +  + +     +  +  +  + +LA  L  E RV      E       I S    ++ +  M++  +   +     D+ + +     +   +   V  A G  +  + R+   A        L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T   +FQDE+G +LL   +V+  G+L FL S+ L++    RW+NTGL  ++ + K++  EPR  +  + +E +  Y+  +K     DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G+ WY IQA+RALNQALGRCIRH+ DWGA+I++D R  G+NP  Y  GL  W+++
Sbjct:  243 STKDTVKEKAKDDKKRIPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDH-HTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGY----ESASKVWSGKDILGIFYGLGITADTFRILKQNLAAVLEKEERVGLVHGKEDMVQVPTISSMTSTVLKNLFMVLDFLYRDNCRFAEDYKVALQRSYSWTNQVPPDVPDAQGFLVRPRPRRRQTARVKTEILTLSFWCLNPAVAFSDLSGSVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCK--SRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRY-GNNPNKYITGLSKWVRQ 886          

HSP 2 Score: 73.559 bits (179), Expect = 6.285e-13
Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            ++ VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCSTL W +
Sbjct:    3 SSAVEYTIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQR 65          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 402.905 bits (1034), Expect = 5.705e-123
Identity = 233/652 (35.74%), Postives = 356/652 (54.60%), Query Frame = 1
Query:  295 SRNDECKENAKQ-----VKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHP-------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSI---SLKDI-DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKV--ASGEWISCKKRK---ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS--EMNECIDAYFKHVK-----DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPT-YSGGLCGWIQK 2124
            S  D  KE AK       KIFFGTRTHKQI Q+  ELK++ YS+  M+ILS R+ +C+N EV+     ++ CKDL        C+    + K+ +  H           WD+E +    K+++ C Y+  +  M+ A I+FCPYNY+L+P IR+SM ++L   I++LDEAHNIED  RE  S ++   SLK   + L  ++ + +++S  E  +     ++  + E   LLS + +    +   K W  +  + +     +  +  +  + +LA  L  E RV      E       I S    ++ +  M++  +   +     D+ + +     +   +   V  A G  +  + R+   A        L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T   +FQDE+G +LL   +V+  G+L FL S+ L++    RW+NTGL  ++ + K++  EPR  +  + +E +  Y+  +K     DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G+ WY IQA+RALNQALGRCIRH+ DWGA+I++D R  G+NP  Y  GL  W+++
Sbjct:  243 STKDTVKEKAKDDKKRIPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDH-HTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGY----ESASKVWSGKDILGIFYGLGITADTFRILKQNLAAVLEKEERVGLVHGKEDMVQVPTISSMTSTVLKNLFMVLDFLYRDNCRFAEDYKVALQRSYSWTNQVPPDVPDAQGFLVRPRPRRRQTARVKTEILTLSFWCLNPAVAFSDLSGSVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCK--SRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRY-GNNPNKYITGLSKWVRQ 886          

HSP 2 Score: 73.559 bits (179), Expect = 6.454e-13
Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            ++ VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCSTL W +
Sbjct:    3 SSAVEYTIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQR 65          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 403.29 bits (1035), Expect = 6.119e-123
Identity = 233/652 (35.74%), Postives = 356/652 (54.60%), Query Frame = 1
Query:  295 SRNDECKENAKQ-----VKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHP-------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSI---SLKDI-DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKV--ASGEWISCKKRK---ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS--EMNECIDAYFKHVK-----DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPT-YSGGLCGWIQK 2124
            S  D  KE AK       KIFFGTRTHKQI Q+  ELK++ YS+  M+ILS R+ +C+N EV+     ++ CKDL        C+    + K+ +  H           WD+E +    K+++ C Y+  +  M+ A I+FCPYNY+L+P IR+SM ++L   I++LDEAHNIED  RE  S ++   SLK   + L  ++ + +++S  E  +     ++  + E   LLS + +    +   K W  +  + +     +  +  +  + +LA  L  E RV      E       I S    ++ +  M++  +   +     D+ + +     +   +   V  A G  +  + R+   A        L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T   +FQDE+G +LL   +V+  G+L FL S+ L++    RW+NTGL  ++ + K++  EPR  +  + +E +  Y+  +K     DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G+ WY IQA+RALNQALGRCIRH+ DWGA+I++D R  G+NP  Y  GL  W+++
Sbjct:  243 STKDTVKEKAKDDKKRIPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDH-HTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGY----ESASKVWSGKDILGIFYGLGITADTFRILKQNLAAVLEKEERVGLVHGKEDMVQVPTISSMTSTVLKNLFMVLDFLYRDNCRFAEDYKVALQRSYSWTNQVPPDVPDAQGFLVRPRPRRRQTARVKTEILTLSFWCLNPAVAFSDLSGSVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCK--SRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRY-GNNPNKYITGLSKWVRQ 886          

HSP 2 Score: 73.559 bits (179), Expect = 6.954e-13
Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            ++ VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCSTL W +
Sbjct:    3 SSAVEYTIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQR 65          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Match: brip1 (BRCA1 interacting protein C-terminal helicase 1 [Source:NCBI gene;Acc:101173242])

HSP 1 Score: 402.905 bits (1034), Expect = 7.402e-123
Identity = 233/652 (35.74%), Postives = 356/652 (54.60%), Query Frame = 1
Query:  295 SRNDECKENAKQ-----VKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDL--------CKKMGCIYKIDNQPHP-------ETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSI---SLKDI-DYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAK-LRNEIRVN----GEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKV--ASGEWISCKKRK---ADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS--EMNECIDAYFKHVK-----DGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPT-YSGGLCGWIQK 2124
            S  D  KE AK       KIFFGTRTHKQI Q+  ELK++ YS+  M+ILS R+ +C+N EV+     ++ CKDL        C+    + K+ +  H           WD+E +    K+++ C Y+  +  M+ A I+FCPYNY+L+P IR+SM ++L   I++LDEAHNIED  RE  S ++   SLK   + L  ++ + +++S  E  +     ++  + E   LLS + +    +   K W  +  + +     +  +  +  + +LA  L  E RV      E       I S    ++ +  M++  +   +     D+ + +     +   +   V  A G  +  + R+   A        L+ WC+NP + F  +S   RSI+LTSGTLSP+ SF  EL  KFS   +A HV+   + ++ ++G GP G  + A F  T   +FQDE+G +LL   +V+  G+L FL S+ L++    RW+NTGL  ++ + K++  EPR  +  + +E +  Y+  +K     DGALL+AV RGK SEG+DF D+ AR V+T+GIP+P+I D +V LKM YN    K     LL G+ WY IQA+RALNQALGRCIRH+ DWGA+I++D R  G+NP  Y  GL  W+++
Sbjct:  243 STKDTVKEKAKDDKKRIPKIFFGTRTHKQITQIAHELKRTVYSSVHMTILSSRDHTCVNPEVVPHFNRNERCKDLLEAKNGKSCRFYHGVQKMRDH-HTLQRVHGLHEAWDVEDLVTVAKRLRSCSYYAARELMQGASIIFCPYNYLLDPMIRESMEIDLAGQILVLDEAHNIEDCARESTSFTLDESSLKTCREELDSMVKNNIRRSQHEPLRDFCYALINWIQECQVLLSERGY----ESASKVWSGKDILGIFYGLGITADTFRILKQNLAAVLEKEERVGLVHGKEDMVQVPTISSMTSTVLKNLFMVLDFLYRDNCRFAEDYKVALQRSYSWTNQVPPDVPDAQGFLVRPRPRRRQTARVKTEILTLSFWCLNPAVAFSDLSGSVRSIVLTSGTLSPMGSFSSELGVKFSIQLEANHVINKSQVWVGTVGAGPQGKKLCATFQHTETYAFQDEVGDLLLHICKVIAKGVLCFLPSYKLLDKLRDRWSNTGLWEKLEQQKTVITEPRGGAKGDFDELLQTYYDAIKCCDERDGALLIAVCRGKVSEGLDFTDDNARAVVTIGIPFPNIKDLQVELKMKYNDQHCK--SRGLLPGHRWYEIQAYRALNQALGRCIRHKNDWGALILVDDRY-GNNPNKYITGLSKWVRQ 886          

HSP 2 Score: 73.559 bits (179), Expect = 6.486e-13
Identity = 30/63 (47.62%), Postives = 44/63 (69.84%), Query Frame = 1
Query:   79 TNMVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLK 267
            ++ VE+ +  V + FP + YP QL MM  I+  +N  ++CL+E PTGSGK++ALLCSTL W +
Sbjct:    3 SSAVEYTIGGVKIHFPCKAYPSQLSMMNSIVRGLNYGQHCLLESPTGSGKSLALLCSTLAWQR 65          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 1469.14 bits (3802), Expect = 0.000e+0
Identity = 711/713 (99.72%), Postives = 711/713 (99.72%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 2223
            MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVN EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKAD LNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID
Sbjct:    1 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 713          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 568/570 (99.65%), Postives = 568/570 (99.65%), Query Frame = 1
Query:  514 MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 2223
            MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVN EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKAD LNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID
Sbjct:    1 MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 570          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Match: SMESG000018012.1 (SMESG000018012.1)

HSP 1 Score: 1100.12 bits (2844), Expect = 0.000e+0
Identity = 539/570 (94.56%), Postives = 539/570 (94.56%), Query Frame = 1
Query:  514 MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 2223
            MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVN EITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKAD LNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPK                             AFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID
Sbjct:    1 MGCIYKIDNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNEEITDSTSEIPSSFMQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADVLNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPK-----------------------------AFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFIDLHCQVDIDKLPID 541          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Match: SMESG000032754.1 (SMESG000032754.1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 353/781 (45.20%), Postives = 479/781 (61.33%), Query Frame = 1
Query:   85 MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKM---GCIYKI-------DNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHILKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRV--------------------NGEITDS------------------------------------TSEIPSSF------MQLIDSFIMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHF---------DDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFID 2184
            MV   +S VPV FP EPY  QL+MM RIINS+ K +NCL+ELPTGSGKT+ LLCSTL W       L ++       E     KIF+GTRTHKQI QV+REL K+AY N RM+ILSGRN SCLN+EV    +I+++C+D+C+ +    C Y+        +       TWD+ SI  KL+++  CPY+Q K W+ SADIVFCPYNYILNPFIR+ + V+L+  ++ILDEAHNIEDICRE  S+++S  +I+   + L  I+    +      L+ ML  +  +I+ LS K F   E+VLKK W+   F+++LK  +L +ENI  ++  L +L N +R                     NGE  +                                     T E P  F      + L+++ +M+ +L+ D  +   +DFS+V+TE                W          L    VLN+WCMNPGI FK I+D   SIILTSGTL+P  SF+KEL C F ++F+A HVV  ++TF+AS+  GP+   ++AVFS      F+DELG+++L+CS+VVPNG+L FLSSFAL++  +QR  +TGL+N+IR+HK +  EP+ + EM  C+  ++  +K GALL AV+RGKASEG+DFADEAARLVITVGIPYPS ADPKVVLK +YN NK+K+          + Q LSG++WY IQAFRALNQA+GRCIRHR DWGAM+M+DSR DG +P+ + GLC WI++RK  + +  DL+  L  FI+
Sbjct:    1 MVINDISGVPVDFPNEPYSSQLFMMHRIINSLIKGQNCLLELPTGSGKTMGLLCSTLAWYTN--GALAVDPATG--TEAGITTKIFYGTRTHKQIQQVVRELSKTAYCNVRMNILSGRNQSCLNEEVKRKPDINKSCRDICRALEDSQCRYRKKKNIKANEKMALSPGTWDLTSIKDKLQRIDCCPYYQMKCWLPSADIVFCPYNYILNPFIRRVLKVDLKRAVVILDEAHNIEDICRESTSLAVSSTEIELCLIQLHLIVNHGAQNGFLKQLIKMLVAVQALIKSLSVKTFATGEEVLKKCWNPLRFIEILKEKELAMENIIEYQGCLEQLNNFLRTSHSQAELEDIEDFRMIPETDNGEEEEDECDHQADRGDYNNCYHGDDMDVYMEAQSTADKKPKKTMESPKYFSMSAESLNLMETLLMICRLIQDEKRNCSDDFSVVVTEC---------------WHKASMDTESKLE--LVLNLWCMNPGIAFKDIADNCHSIILTSGTLNPTASFQKELQCCFQSVFEAPHVVSADRTFMASLSRGPTNKEIQAVFSNIETFEFKDELGRLILECSKVVPNGVLCFLSSFALMDGLLQRLEDTGLMNQIRQHKFVTKEPKSSMEMENCMAKFYSKIKTGALLFAVYRGKASEGIDFADEAARLVITVGIPYPSAADPKVVLKRHYNDNKRKNLGTNEAAAGENQQGLSGHQWYKIQAFRALNQAIGRCIRHRSDWGAMLMVDSRFDGFDPSNTNGLCKWIKRRKNHYEDFNDLFYYLVRFIE 760          
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Match: SMESG000064419.1 (SMESG000064419.1)

HSP 1 Score: 326.25 bits (835), Expect = 1.670e-97
Identity = 220/736 (29.89%), Postives = 371/736 (50.41%), Query Frame = 1
Query:  109 VPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTIALLCSTLGW---LKQYQSQ------LLLNSRNDECKENAKQV-----------KIFFGTRTHKQIGQVIRELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQN------CKDLCKKMGCIY-----KIDNQPHPET-TWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNPFIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDI----DYLKML---------LPHILKKSGKEDCQHDL--LTMLEKMHEVIELLSSKLFYKD---EDVLKKTWDLESFVQLLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPS-----SFMQLIDSFIMLVKLMMDS----DKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKADALNNNFVLNIWCMNPGIVFKQISDIS-RSIILTSGTLSPVVSFEKELNCKFSAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLLKCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTSEMNECIDAYFKHVKD-----GALLLAVFRGKASEGVDFADEAARLVITVGIPYPSIADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHREDWGAMIMIDSRLDGSNPTYSGGLCGWIQ 2121
            V + FP EPY  Q+  M ++I S+   +N ++E PTG+GKT+ LLC+ L W   +K+  +       L LNS  ++     K+            KI + +RTH Q+ Q I  LK++ Y + ++ +++ R   C+N +V+    ++ N      CK   K   C +     K       ET   DIE +    KK  +CPYF  +    SADI F PYNY+L+  IR+   +NL+ NI+I DEAHNIE +C + AS+ ++  +I    + LK+L            I+ ++  E    ++  LT +  + + + +L S+    D         T ++    QLL  C  +  N  +F + L K  + I ++ E T +   I        FM+ +  F   +    DS    +K     + + I E E      N K+    W S K +  +  + N VL+ WCM  G   K ++    RSIILTSGTL P+ + + +++ KF    +  HV+  ++  ++    G  G  + + + T  K+S+ + LG  +L  S+++P G+L+   S+ ++   ++RW +  + N + +HK + +EP+  ++    ++ ++    D     G++LL+V RGK SEG+D +D   R VI VG+PYPS+ DP++ LKM++  ++ K F    + G  WY  QA+RA+NQ++GR IRH  D+GA+ + D R   ++  +   L  W+Q
Sbjct:    9 VSIDFPFEPYACQIIYMEKVIESLKDGKNAILESPTGTGKTLCLLCAALAWQDHVKKVTTNSEDEILLHLNSNGNQYWNKVKKSQLNISKINVVPKIIYSSRTHSQLSQCINALKRTQYCDRKVGMIASREQLCINPKVM---NLESNTAKIYGCKSRVKTRKCFFYNQFEKAKEILSSETKIADIEDLLTIGKKKSVCPYFLSREMFDSADITFMPYNYLLDSKIRRLYNINLKGNIVIFDEAHNIEQVCEDSASVQLTSINIASCIEELKVLGEFIYSIQSTDAIIDEADNESRSDEIPDLTQIIHLKQNLCILESEFHSIDLGNNANAGLTVEVNILFQLLNRCGFNHSNKLHFIDLLEKCSSFIGMSSEPTLTKHGIKGLEKVQEFMKTV--FFDEIGEEFDSIDNLEKKLSACYRVFIQENEIATSNRNNKI---NWGSNKNQAVNG-DKNRVLSFWCMTAGRTMKSLAGCEVRSIILTSGTLYPIETLKLDMDIKFEVELRNSHVINADQMMVSVCTKGADGEPLNSSYLTREKISYTNSLGNSILNLSKIIPRGLLVVFPSYGMMRKCIERWESCDIYNSMMQHKQLIVEPQDKTKFTLAMEQFYSKNSDPLSNKGSILLSVARGKISEGLDLSDHQGRGVIVVGLPYPSMMDPRIRLKMSFLDDRLKLFKFG-IDGRCWYKQQAYRAVNQSIGRVIRHSRDFGAIYLFDERFATADSRFQLPL--WLQ 732          
The following BLAST results are available for this feature:
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRIP11.582e-12935.05BRCA1 interacting protein C-terminal helicase 1 [S... [more]
BRIP11.127e-12635.05BRCA1 interacting protein C-terminal helicase 1 [S... [more]
RTEL11.185e-9130.08regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL13.797e-9030.08regulator of telomere elongation helicase 1 [Sourc... [more]
RTEL18.418e-9029.95regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtel-11.076e-8228.73Regulator of telomere elongation helicase 1 homolo... [more]
rtel-11.076e-8228.73Regulator of telomere elongation helicase 1 homolo... [more]
dog-13.366e-5936.68Deletions Of G-rich DNA [Source:UniProtKB/TrEMBL;... [more]
chl-11.856e-3824.44ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
chl-11.856e-3824.44ATP-dependent DNA helicase chl-1 [Source:UniProtK... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG40787.457e-11532.35gene:FBgn0029798 transcript:FBtr0070807[more]
CG40787.457e-11532.35gene:FBgn0029798 transcript:FBtr0332398[more]
Xpd2.551e-5023.64gene:FBgn0261850 transcript:FBtr0071576[more]
CG114032.369e-3229.62gene:FBgn0026876 transcript:FBtr0070245[more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brip13.070e-12735.61BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip14.304e-12735.61BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip14.522e-12735.61BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip14.690e-12735.61BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip14.690e-12735.61BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phlpp25.438e-12735.82PH domain and leucine rich repeat protein phosphat... [more]
phlpp24.679e-12635.53PH domain and leucine rich repeat protein phosphat... [more]
phlpp21.582e-12435.96PH domain and leucine rich repeat protein phosphat... [more]
ephx33.367e-5424.63epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-59... [more]
ephx31.004e-5324.86epoxide hydrolase 3 [Source:Xenbase;Acc:XB-GENE-59... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brip11.816e-12535.90BRCA1 interacting protein C-terminal helicase 1 [S... [more]
Rtel11.770e-10030.70regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel12.585e-10030.70regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel13.574e-10030.70regulator of telomere elongation helicase 1 [Sourc... [more]
Rtel13.692e-10030.70regulator of telomere elongation helicase 1 [Sourc... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3YK19|FANCJ_CHICK1.649e-12636.49Fanconi anemia group J protein homolog OS=Gallus g... [more]
sp|Q9BX63|FANCJ_HUMAN5.415e-12635.05Fanconi anemia group J protein OS=Homo sapiens OX=... [more]
sp|Q5SXJ3|FANCJ_MOUSE1.270e-12435.90Fanconi anemia group J protein homolog OS=Mus musc... [more]
sp|B3MSG8|RTEL1_DROAN4.997e-11831.95Regulator of telomere elongation helicase 1 homolo... [more]
sp|B4PZB4|RTEL1_DROYA1.792e-11631.51Regulator of telomere elongation helicase 1 homolo... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RUG02.675e-15132.61Fanconi anemia group J protein OS=Fasciola hepatic... [more]
A0A4S2MG601.623e-14531.75Helicase ATP-binding domain-containing protein OS=... [more]
A0A1W2W4U15.487e-14136.50Fanconi anemia group J protein homolog OS=Ciona in... [more]
A0A0X3Q5H27.714e-14031.95Fanconi anemia group J protein homolog (Fragment) ... [more]
A0A0L7R3883.131e-13735.43Fanconi anemia group J protein OS=Habropoda labori... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brip11.593e-11033.79BRCA1 interacting protein C-terminal helicase 1 [S... [more]
rtel11.638e-10029.82regulator of telomere elongation helicase 1 [Sourc... [more]
rtel13.028e-10029.82regulator of telomere elongation helicase 1 [Sourc... [more]
ercc21.658e-5524.66ERCC excision repair 2, TFIIH core complex helicas... [more]
ercc25.322e-5324.34ERCC excision repair 2, TFIIH core complex helicas... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009331.14.164e-4334.48pep scaffold:Pmarinus_7.0:GL478127:7852:42501:1 ge... [more]
ercc21.454e-4223.28excision repair cross-complementation group 2 [Sou... [more]
RTEL1-TNFRSF6B2.610e-3931.80RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
RTEL1-TNFRSF6B2.979e-3931.47RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
RTEL1-TNFRSF6B2.025e-3528.62RTEL1-TNFRSF6B readthrough (NMD candidate) [Source... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RAD38.537e-5823.825' to 3' DNA helicase; involved in nucleotide exci... [more]
CHL11.688e-4124.77Probable DNA helicase; involved in sister-chromati... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO393885.052e-9427.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467541.112e-5424.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brip14.291e-12335.74BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip15.691e-12335.74BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip15.705e-12335.74BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip16.119e-12335.74BRCA1 interacting protein C-terminal helicase 1 [S... [more]
brip17.402e-12335.74BRCA1 interacting protein C-terminal helicase 1 [S... [more]
back to top
BLAST of Regulator of telomere elongation helicase 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018012.10.000e+099.72SMESG000018012.1[more]
SMESG000018012.10.000e+099.65SMESG000018012.1[more]
SMESG000018012.10.000e+094.56SMESG000018012.1[more]
SMESG000032754.10.000e+045.20SMESG000032754.1[more]
SMESG000064419.11.670e-9729.89SMESG000064419.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018649 ID=SMED30018649|Name=Regulator of telomere elongation helicase 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2327bp
GAAATAGTTATTTAATTTTTATTTAAATATTGACTTTTGTAAGTAGCCAA
ATAAAATTTTTAATAATACGAATTGTAAACTAATATGGTTGAATTTAAAT
TATCTGATGTACCAGTTACATTCCCTATTGAACCATATCCACAGCAGCTT
TACATGATGAGACGCATAATTAATTCCATAAATAAGAGCGAGAATTGCCT
CATGGAGTTGCCAACTGGAAGTGGTAAAACTATAGCATTGTTGTGCTCTA
CTTTAGGATGGCTTAAACAGTATCAATCCCAACTTTTATTGAATTCTAGA
AATGATGAGTGTAAAGAAAATGCAAAGCAAGTAAAAATATTTTTTGGAAC
AAGAACTCACAAGCAGATTGGGCAGGTTATTCGTGAGTTAAAGAAATCCG
CTTATTCGAATACTAGAATGAGCATTCTCAGTGGAAGAAATCTGTCTTGT
CTAAATCAGGAAGTTTTGATGTCGAAAGAAATTGATCAAAATTGTAAGGA
TCTGTGTAAGAAAATGGGCTGTATATATAAAATAGACAATCAGCCACACC
CGGAAACCACTTGGGATATTGAATCTATCTCAATGAAATTAAAGAAGGTC
AAAATATGTCCATATTTTCAGTTTAAATCATGGATGAAAAGTGCCGACAT
CGTGTTCTGTCCGTATAACTATATTTTAAATCCATTTATACGGAAATCGA
TGGGCGTCAATTTAGAAAATAATATCATAATTTTGGATGAAGCGCATAAT
ATTGAGGATATCTGTCGTGAGGGAGCTTCAATGTCGATCAGTCTTAAAGA
TATCGATTATTTAAAGATGCTTCTGCCTCATATATTAAAAAAAAGCGGAA
AGGAAGACTGTCAACACGATTTATTAACAATGCTAGAAAAAATGCATGAG
GTCATTGAATTACTTTCTAGTAAGTTGTTTTACAAAGATGAAGATGTATT
GAAAAAGACCTGGGATTTGGAGAGTTTTGTTCAGCTACTGAAAAATTGTC
AATTAGATTTGGAAAATATCAAAAATTTCGAAAACCATCTGGCAAAACTT
CGAAATGAGATTAGAGTTAATGGAGAAATAACTGATTCAACTTCTGAAAT
TCCTTCTTCATTTATGCAGCTAATAGATTCATTTATAATGCTTGTAAAAT
TAATGATGGATAGTGACAAAACGAAACAAAATGATTTCAGTATCGTTATT
ACTGAAGGTGAAAAATATGCTGAACCGATTAATGAAAAAGTTGCATCGGG
TGAATGGATATCGTGTAAAAAGCGAAAGGCTGATGCTTTGAATAACAATT
TCGTTTTGAATATTTGGTGTATGAATCCAGGAATTGTTTTTAAACAAATA
TCCGATATTTCCCGATCAATAATTCTCACCAGTGGAACCTTATCTCCTGT
TGTATCATTTGAGAAGGAATTAAACTGTAAATTTAGTGCAATATTTCAAG
CTGGTCATGTTGTTCAGCCTGAGAAAACGTTTTTAGCTAGCATCGGAAAC
GGACCGTCCGGTAACGCAATGAAGGCTGTATTCAGCACAACTTCTAAACT
TTCTTTTCAAGATGAGTTAGGTCAAATGTTACTGAAGTGCAGTGAAGTCG
TGCCTAATGGAATATTGATTTTTCTATCATCATTTGCATTAATTGAGTTG
TTTATGCAACGTTGGACGAACACAGGATTGATAAACGAAATCAGAAAACA
CAAATCAATTTTTATAGAGCCCCGTCAAACATCAGAAATGAATGAATGTA
TAGACGCCTATTTCAAACATGTTAAAGATGGCGCCTTATTGCTAGCGGTT
TTTCGTGGTAAGGCCAGTGAAGGTGTAGATTTTGCTGATGAAGCAGCCCG
CCTTGTTATTACTGTTGGAATACCGTATCCATCAATCGCAGATCCCAAAG
TCGTATTAAAAATGAATTATAATACGAATAAAAAGAAGCATTTTGACGAT
CAACTTTTATCGGGTAATGAATGGTATAATATTCAGGCTTTTAGGGCTCT
AAATCAAGCACTCGGACGTTGTATTCGACATCGTGAAGATTGGGGAGCGA
TGATAATGATTGACTCCAGGTTAGACGGGTCTAATCCCACATATTCGGGT
GGGCTTTGTGGGTGGATCCAGAAACGGAAAATTGATTTTAGAAATTGCGA
AGATCTCTATGTTTCTCTGCAATTGTTTATCGATTTGCATTGTCAAGTAG
ATATAGACAAATTGCCTATTGATTAGATATTATCTATTCATCGATATAAA
GCGCATATATGTATTATAGATTTTTATAAAAAAAGTTTATTGATATTTTC
AAATTTTTCCTATTCCAAAAAGGCAAC
back to top

protein sequence of SMED30018649-orf-1

>SMED30018649-orf-1 ID=SMED30018649-orf-1|Name=SMED30018649-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=714bp
MVEFKLSDVPVTFPIEPYPQQLYMMRRIINSINKSENCLMELPTGSGKTI
ALLCSTLGWLKQYQSQLLLNSRNDECKENAKQVKIFFGTRTHKQIGQVIR
ELKKSAYSNTRMSILSGRNLSCLNQEVLMSKEIDQNCKDLCKKMGCIYKI
DNQPHPETTWDIESISMKLKKVKICPYFQFKSWMKSADIVFCPYNYILNP
FIRKSMGVNLENNIIILDEAHNIEDICREGASMSISLKDIDYLKMLLPHI
LKKSGKEDCQHDLLTMLEKMHEVIELLSSKLFYKDEDVLKKTWDLESFVQ
LLKNCQLDLENIKNFENHLAKLRNEIRVNGEITDSTSEIPSSFMQLIDSF
IMLVKLMMDSDKTKQNDFSIVITEGEKYAEPINEKVASGEWISCKKRKAD
ALNNNFVLNIWCMNPGIVFKQISDISRSIILTSGTLSPVVSFEKELNCKF
SAIFQAGHVVQPEKTFLASIGNGPSGNAMKAVFSTTSKLSFQDELGQMLL
KCSEVVPNGILIFLSSFALIELFMQRWTNTGLINEIRKHKSIFIEPRQTS
EMNECIDAYFKHVKDGALLLAVFRGKASEGVDFADEAARLVITVGIPYPS
IADPKVVLKMNYNTNKKKHFDDQLLSGNEWYNIQAFRALNQALGRCIRHR
EDWGAMIMIDSRLDGSNPTYSGGLCGWIQKRKIDFRNCEDLYVSLQLFID
LHCQVDIDKLPID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0016818hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
GO:0004003ATP-dependent DNA helicase activity
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000136whole organism
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013020Rad3/Chl1-like
IPR006555ATP-dep_Helicase_C
IPR006554Helicase-like_DEXD_c2
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR010614DEAD_2
IPR014013Helic_SF1/SF2_ATP-bd_DinG/Rad3
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0000723telomere maintenance
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0010569regulation of double-strand break repair via homologous recombination
GO:0032508DNA duplex unwinding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 305..332
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 15..306
e-value: 4.4E-61
score: 208.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 477..671
e-value: 2.7E-43
score: 149.7
NoneNo IPR availablePANTHERPTHR11472DNA REPAIR DEAD HELICASE RAD3/XP-D SUBFAMILY MEMBERcoord: 9..692
NoneNo IPR availablePANTHERPTHR11472:SF47FANCONI ANEMIA GROUP J PROTEINcoord: 9..692
NoneNo IPR availableCDDcd18788SF2_C_XPDcoord: 470..662
e-value: 6.01694E-52
score: 175.1
NoneNo IPR availableCDDcd17970DEAHc_FancJcoord: 36..224
e-value: 1.64102E-51
score: 174.843
NoneNo IPR availableCDDcd17915DEAHc_XPD-likecoord: 427..451
e-value: 0.00138094
score: 37.4105
IPR006554Helicase-like, DEXD box c2 typeSMARTSM00488deadxpdcoord: 9..256
e-value: 8.1E-28
score: 108.4
IPR006555ATP-dependent helicase, C-terminalSMARTSM00491Cxpdneu3coord: 517..665
e-value: 3.0E-49
score: 179.6
IPR006555ATP-dependent helicase, C-terminalPFAMPF13307Helicase_C_2coord: 499..680
e-value: 2.8E-48
score: 164.3
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 13..301
e-value: 0.0053
score: 19.0
IPR010614DEAD2PFAMPF06733DEAD_2coord: 87..239
e-value: 4.2E-41
score: 140.5
IPR013020ATP-dependent helicase Rad3/Chl1-likeTIGRFAMTIGR00604TIGR00604coord: 10..681
e-value: 9.3E-120
score: 399.3
IPR014013Helicase superfamily 1/2, ATP-binding domain, DinG/Rad3-typePROSITEPS51193HELICASE_ATP_BIND_2coord: 7..267
score: 22.421
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 28..659