Protein kinase

Overview
NameProtein kinase
Smed IDSMED30018644
Length (bp)1736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30018644) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30018644) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30018644) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30018644) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018644

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018644SMESG000048011.1 SmedASXL_001716SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018644SMESG000048011.1 dd_Smed_v4_13113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30018644SMESG000048011.1 dd_Smed_v4_13113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018644SMESG000048011.1 dd_Smed_v6_13113_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
testis primordiumSMED30018644SMESG000048011.1 Contig5334_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 440.654 bits (1132), Expect = 1.101e-149
Identity = 200/298 (67.11%), Postives = 244/298 (81.88%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF +FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Protein kinase vs. Ensembl Human
Match: TTBK1 (tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:19140])

HSP 1 Score: 457.988 bits (1177), Expect = 8.299e-147
Identity = 199/300 (66.33%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    + +D+L A  VVKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 313          
BLAST of Protein kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 448.358 bits (1152), Expect = 9.112e-144
Identity = 199/290 (68.62%), Postives = 242/290 (83.45%), Query Frame = 3
Query:   93 DLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF +FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE
Sbjct:    9 DILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Protein kinase vs. Ensembl Human
Match: TTBK1 (tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:19140])

HSP 1 Score: 397.512 bits (1020), Expect = 1.131e-129
Identity = 175/262 (66.79%), Postives = 218/262 (83.21%), Query Frame = 3
Query:  183 FDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
             D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:    1 MDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 262          
BLAST of Protein kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 380.563 bits (976), Expect = 1.009e-126
Identity = 179/298 (60.07%), Postives = 219/298 (73.49%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LGRQIL+SIE+IH VGFLHRD+KP                                   PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF +FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKP-----------------------------------PRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 263          
BLAST of Protein kinase vs. Ensembl Celegans
Match: ttbk-7 (Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:Q22033])

HSP 1 Score: 388.652 bits (997), Expect = 5.867e-126
Identity = 171/297 (57.58%), Postives = 228/297 (76.77%), Query Frame = 3
Query:   75 SESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFD-EATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            + S   ++LQ G V+++RW++  KIGGGGFGEIYEA D +   +RVA+K+ESS+  KQVLKMEVAVL+++QG++H+C+F GCGRND+FNYLVMSLQG+NLA+LRR  P+  F++ST +++G QIL+ I  IH +GFLHRDVKPSNFAMGR  QT R VY+LDFGL+RQYLN   E+R+PR  AGFRGTVRYA+  AH N+EMGR DDLWS+FYML E + GQLPWRK+KDK++VG++K+  D  +LL   P E  LF+ H++ L Y D+PDY  L +L ++ +    +   + +DWE
Sbjct:    2 TSSSEGEILQVGQVIRERWKIKAKIGGGGFGEIYEATDVQNHHERVAIKVESSKATKQVLKMEVAVLRRLQGKKHACKFYGCGRNDKFNYLVMSLQGKNLADLRREAPKQCFNLSTAVRVGIQILNGIREIHSIGFLHRDVKPSNFAMGRTSQTMRNVYMLDFGLARQYLNAKGEIRSPRSAAGFRGTVRYAAVTAHKNKEMGRQDDLWSLFYMLTEFLQGQLPWRKIKDKDEVGKMKEEADLVVLLDDCPHEMHLFVAHLKVLGYADTPDYVYLESLLNKIVAENEISWDEPYDWE 298          
BLAST of Protein kinase vs. Ensembl Celegans
Match: C39H7.1 (pep chromosome:WBcel235:IV:5631895:5633379:1 gene:WBGene00016541.1 transcript:C39H7.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C39H7.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.337e-66
Identity = 110/289 (38.06%), Postives = 174/289 (60.21%), Query Frame = 3
Query:  123 DRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKI--QGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARI--VYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDH---TILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            +RW + +K+G GGFG +Y  FD     + A+K+E + +  QVLK+EV+VL ++  +G  H C+    GR   FNY+VM+L G++L +L +    G  S+   + +G Q L+++E +H +G+LHRDVKP N+ +GR P+   I  VYILDFG+ R++   D  +R PR  AGFRGTV+YA  + H+ RE+ R DDL +  YM VE+  G +PW+ + D  QVGQ KQ+  +   T+     P +F+  +  V ++ Y+D+P+Y  +  +  +       +E+  +DWE  
Sbjct:   15 ERWSIEKKLGEGGFGAVYRVFD--ATGKYAMKVEGANEQIQVLKLEVSVLNELSKRGNRHFCKIEDKGRFGNFNYVVMTLVGKSLQDLNKAGVGGHMSMGCSIGIGIQSLEALEDLHNIGYLHRDVKPGNYTIGR-PELNEIRKVYILDFGMCRKFTGNDGTIRKPRQAAGFRGTVKYAPISCHLQRELCRKDDLETWMYMQVELSHGTIPWQHISDMNQVGQAKQAIRNNLGTLFPPPCPQQFQDIMRMVDAMKYYDAPNYQAIYGMMRQAYGACGSNENAPYDWENG 300          
BLAST of Protein kinase vs. Ensembl Celegans
Match: Y38H8A.3 (pep chromosome:WBcel235:IV:13472497:13474005:1 gene:WBGene00012637.1 transcript:Y38H8A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38H8A.3)

HSP 1 Score: 219.164 bits (557), Expect = 1.533e-66
Identity = 110/289 (38.06%), Postives = 174/289 (60.21%), Query Frame = 3
Query:  123 DRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKI--QGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARI--VYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDH---TILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            +RW + +K+G GGFG +Y  FD     + A+K+E + +  QVLK+EV+VL K+  +G  H C+    GR   FNY+VM+L G++L +L +    G  S+   + +G Q L+++E +H +G+LHRDVKP N+ +GR P+   I  VYILDFG+ R++   D  +R PR  AGFRGTV+YA  + H+ RE+ R DDL +  YM VE+  G +PW+ + D  QVGQ KQ+  +   ++     P +F+  +  V ++ Y+D+P+Y  +  +  +       +E+  +DWE  
Sbjct:   15 ERWSIEKKLGEGGFGAVYRVFD--ATGKYAMKVEGANEQIQVLKLEVSVLNKLSKRGNRHFCKIEDKGRFGNFNYVVMTLVGKSLQDLNKAGVGGHMSMGCSIGIGIQSLEALEDLHNIGYLHRDVKPGNYTIGR-PELNEIRKVYILDFGMCRKFTGNDGTIRKPRQAAGFRGTVKYAPISCHLQRELCRKDDLETWMYMQVELSHGTIPWQYISDMNQVGQAKQAIRNNLGSLFPPPCPHQFQDIMRMVDAMKYYDAPNYQAIYGMMRQAYGACGSNENAPYDWENG 300          
BLAST of Protein kinase vs. Ensembl Celegans
Match: W03G9.5 (pep chromosome:WBcel235:I:4968007:4970245:-1 gene:WBGene00021016.1 transcript:W03G9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03G9.5)

HSP 1 Score: 218.394 bits (555), Expect = 3.591e-64
Identity = 120/298 (40.27%), Postives = 174/298 (58.39%), Query Frame = 3
Query:   99 LQAGNVVKDRWRVIRKIGGGGFGEIYE-AFDEATQDRVALKLESSR-QPKQVLKMEVAVLKKIQGRE--HSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRL-PQTARIVYILDFGLSRQYLNVDDE-----VRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            ++  +V+  ++   RK+G GG G IYE A  +    R A K E++       L ME  ++ K+  +   H    +  G++D + ++VM+L G +L  +R   P   FS  + L +G Q LDSI+ IH +GF+HRDVKP+NFA+G L     R+V++LDFG+SRQYL  D E     +R PR I  FRGT+RY S  A   +E GRHDDLWS+FYM+VE V G LPW  + ++E+V  +K+  D T L   L SE  +F +H+  L Y  +PDY +LR+L     +R+  +     DWE
Sbjct:    8 IKVASVINRKYLAFRKLGEGGCGVIYEVAMVKCPGRRFACKAETTVFDEDPTLPMEHKIISKLNEKNSIHCVELIDKGQSDNYQFIVMTLLGPSLDAIRATLPTNKFSTFSTLVMGIQALDSIKEIHDIGFVHRDVKPANFAIGALGTPKQRLVHVLDFGISRQYLVKDGENGGLRIRKPRRIVPFRGTLRYCSVAAQERKEQGRHDDLWSLFYMIVEFVKGSLPWTGIMEEEKVIVMKE--DVTELFNGLESECAMFAQHLSVLRYQTNPDYALLRDLLMNIFVRRNFNAQMKVDWE 303          
BLAST of Protein kinase vs. Ensembl Celegans
Match: R13H9.5 (pep chromosome:WBcel235:IV:5065746:5066987:-1 gene:WBGene00020071.1 transcript:R13H9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R13H9.5)

HSP 1 Score: 211.46 bits (537), Expect = 1.635e-63
Identity = 113/293 (38.57%), Postives = 171/293 (58.36%), Query Frame = 3
Query:  123 DRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKI--QGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLP-QTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHT---ILLRHLPS-EFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTN 980
            +RW + +K+G GG G +Y   D     + ALK+E   +  QVLKMEV VL ++  +G  H C+    GR   FNY+VM+L G++L +LR+ T +   S++  L +G Q L+++E +H +G+LHRDVKP N+ +GR      R VYILDFG++R++ + +  +R PR  AGFRGTVRYA    H N+E+GR DD+    YM VE+  G++PW+++ D   VGQ KQ+  +T   + +   P+ E +  ++ V S  YF  P+Y     L  + +      E   +DWE     N
Sbjct:   18 ERWSITKKLGEGGCGAVYLCTD--ATGKYALKVEGISEAMQVLKMEVLVLGELTKRGSRHFCKIEDKGRYGSFNYVVMTLVGKSLQDLRKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIGRAELNELRKVYILDFGMARKFTDNNGVIRKPRAAAGFRGTVRYAPIACHKNQELGRKDDVEVWLYMQVELTVGRVPWKEITDMNAVGQAKQTIRNTPEKMFVFPCPANELKEIMKMVDSWDYFADPNYADCYRLMKQALANCGKPEYP-YDWEPGMPLN 307          
BLAST of Protein kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0300344)

HSP 1 Score: 467.618 bits (1202), Expect = 4.912e-156
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:    3 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 299          
BLAST of Protein kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0344869)

HSP 1 Score: 468.003 bits (1203), Expect = 7.448e-153
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:    3 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 299          
BLAST of Protein kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332908)

HSP 1 Score: 468.003 bits (1203), Expect = 7.448e-153
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:    3 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 299          
BLAST of Protein kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332904)

HSP 1 Score: 468.003 bits (1203), Expect = 1.641e-152
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:  159 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 455          
BLAST of Protein kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332905)

HSP 1 Score: 468.389 bits (1204), Expect = 3.493e-152
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:    3 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 299          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: ttbk1a (tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-100609-4])

HSP 1 Score: 455.292 bits (1170), Expect = 1.730e-146
Identity = 206/331 (62.24%), Postives = 260/331 (78.55%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYV---DGRPTGSQVYV 1052
            M   ++  D+L    +VKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG+ H C+F+GCGRND+FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQIK+ +DH +LL+H+PSEF +FLEHV +L Y+  PDY +L ++F+  M  + + E++ +DWE + +    E  I  T P     + RPT + V V
Sbjct:    1 MNGTAEQQDILPPHCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFTMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTFRKCYMLDFGLARQYTNTNGEVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAAGQLPWRKIKDKEQVGQIKERYDHRMLLKHMPSEFNVFLEHVLALDYYTKPDYQLLMSVFENSMKERIITENEPYDWEKSGT----ETIISATTPTAAQQNTRPTAAMVGV 327          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: ttbk1a (tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-100609-4])

HSP 1 Score: 455.292 bits (1170), Expect = 1.730e-146
Identity = 206/331 (62.24%), Postives = 260/331 (78.55%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYV---DGRPTGSQVYV 1052
            M   ++  D+L    +VKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG+ H C+F+GCGRND+FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQIK+ +DH +LL+H+PSEF +FLEHV +L Y+  PDY +L ++F+  M  + + E++ +DWE + +    E  I  T P     + RPT + V V
Sbjct:    1 MNGTAEQQDILPPHCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFTMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTFRKCYMLDFGLARQYTNTNGEVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAAGQLPWRKIKDKEQVGQIKERYDHRMLLKHMPSEFNVFLEHVLALDYYTKPDYQLLMSVFENSMKERIITENEPYDWEKSGT----ETIISATTPTAAQQNTRPTAAMVGV 327          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: ttbk1b (tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-100609-5])

HSP 1 Score: 449.899 bits (1156), Expect = 8.154e-145
Identity = 197/302 (65.23%), Postives = 249/302 (82.45%), Query Frame = 3
Query:   63 NGMGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            NG G + D   +L +  +VKDRW+V++KIGGGGFGEIYEA+D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG+ H C+F+GCGRND+FNY+VM LQGRNLA+LRR+ PRG FS+ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQIK+ ++H +LL+H+P+EF +F +HV  L YF  PDY +L ++F+  M  + + E++ +DWE +
Sbjct:   15 NGAGEQVD---ILPSNCLVKDRWKVLKKIGGGGFGEIYEAYDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFSMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTCRKCYMLDFGLARQYTNTNGEVRPPRSVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGQIKERYEHRMLLKHMPAEFHIFYDHVLDLDYFTKPDYQLLMSVFENSMKDRVITENEPYDWEKS 313          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 442.195 bits (1136), Expect = 8.815e-145
Identity = 195/298 (65.44%), Postives = 243/298 (81.54%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            M    + +D+L  G++V++RWRV++KIGGGGFGEIYE  D   Q  VALK+ES++QPKQVLKMEVAVLK++QG++H CRFVGCGRNDRFNY+VM LQGRNLA+LRRN   G FSVST L+LGRQIL++IE+IH VGFLHRD+KPSNFAMGRL  T R  Y+LDFGL+RQ+ N   EVR PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+KDKEQVG +K++++H +LL+HLP EF +F +H+ +L Y+  PDY +L ++FD  M    V E+D +DWE
Sbjct:    1 MSGTVEQTDILAVGSMVRERWRVLKKIGGGGFGEIYEVLDHVNQVSVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRNMSHGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPSNFAMGRLNSTCRTCYMLDFGLARQFTNSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKIKDKEQVGNMKETYNHRLLLKHLPDEFSVFFDHISNLDYYTKPDYQLLMSVFDNSMKSYNVVENDPYDWE 298          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: ttbk2a (tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-120928-3])

HSP 1 Score: 442.965 bits (1138), Expect = 2.227e-143
Identity = 199/320 (62.19%), Postives = 252/320 (78.75%), Query Frame = 3
Query:   93 DLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQVYV 1052
            D+L  G +VK+RW++++KIGGGGFGEIYEA D  T+  VALK ES++QPKQVLKMEVAVLKK+QG++H CRFVGCGRNDRFNY+VM LQGRNLA+LRR+  RG F+VST L+LG QIL++IE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   EVR PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+KDKEQVG++K+++DH ++L+HLP +F +FL+H+ +L YF  PDY +LR +F+  M    V E+D +DWE   S +   +      P    R T +Q+ +
Sbjct:    9 DILSTGILVKERWKILKKIGGGGFGEIYEALDLMTRTSVALKAESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRSMNRGTFTVSTTLRLGLQILEAIESIHSVGFLHRDIKPSNFAMGRFPSTCRTCYMLDFGLARQFTNSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKDKEQVGKLKETYDHRLMLKHLPPQFTVFLDHISNLDYFTKPDYQLLRTVFENSMRTYNVVENDPYDWERISSDSPMTITATANTPQHHTRLTPAQMGI 328          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 448.358 bits (1152), Expect = 3.434e-148
Identity = 203/303 (67.00%), Postives = 246/303 (81.19%), Query Frame = 3
Query:   66 GMGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPS 974
             M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG FS+STML+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ ++H ++L+HLP EF +FLEH+  L YF  PDY +L ++FD  M    V ESD FDWE + S
Sbjct:   11 AMSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWEKSGS 313          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 450.669 bits (1158), Expect = 5.189e-145
Identity = 203/302 (67.22%), Postives = 246/302 (81.46%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPS 974
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG FS+STML+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ ++H ++L+HLP EF +FLEH+  L YF  PDY +L ++FD  M    V ESD FDWE + S
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWEKSGS 302          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 451.44 bits (1160), Expect = 1.274e-144
Identity = 203/302 (67.22%), Postives = 246/302 (81.46%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPS 974
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG FS+STML+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ ++H ++L+HLP EF +FLEH+  L YF  PDY +L ++FD  M    V ESD FDWE + S
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWEKSGS 302          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 427.172 bits (1097), Expect = 3.697e-140
Identity = 194/279 (69.53%), Postives = 232/279 (83.15%), Query Frame = 3
Query:  138 IRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPS 974
            +RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG FS+STML+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ ++H ++L+HLP EF +FLEH+  L YF  PDY +L ++FD  M    V ESD FDWE + S
Sbjct:   21 LRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWEKSGS 299          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 383.645 bits (984), Expect = 1.008e-127
Identity = 182/302 (60.26%), Postives = 221/302 (73.18%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPS 974
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG FS+STML+LGRQIL+SIE+IH VGFLHRD+KP                                   PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ ++H ++L+HLP EF +FLEH+  L YF  PDY +L ++FD  M    V ESD FDWE + S
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKP-----------------------------------PRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWEKSGS 267          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Ttbk1 (tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:2147036])

HSP 1 Score: 451.055 bits (1159), Expect = 4.800e-150
Identity = 199/300 (66.33%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    + +D+L A  VVKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 313          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Ttbk1 (tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:2147036])

HSP 1 Score: 458.373 bits (1178), Expect = 3.273e-147
Identity = 199/300 (66.33%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    + +D+L A  VVKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 313          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 443.351 bits (1139), Expect = 1.106e-145
Identity = 198/300 (66.00%), Postives = 244/300 (81.33%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LG+QIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  ++LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF  FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE +
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKS 300          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 445.277 bits (1144), Expect = 7.172e-143
Identity = 198/300 (66.00%), Postives = 244/300 (81.33%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LG+QIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  ++LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF  FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE +
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKS 300          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 445.277 bits (1144), Expect = 7.172e-143
Identity = 198/300 (66.00%), Postives = 244/300 (81.33%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LG+QIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  ++LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF  FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE +
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKS 300          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q8IMC6|ASATR_DROME (Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2)

HSP 1 Score: 467.618 bits (1202), Expect = 2.789e-150
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:  159 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 455          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6PCN3|TTBK1_MOUSE (Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3)

HSP 1 Score: 458.373 bits (1178), Expect = 2.289e-146
Identity = 199/300 (66.33%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    + +D+L A  VVKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 313          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q5TCY1|TTBK1_HUMAN (Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2)

HSP 1 Score: 457.988 bits (1177), Expect = 3.986e-146
Identity = 199/300 (66.33%), Postives = 248/300 (82.67%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    + +D+L A  VVKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRN++FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ ++H +LL+H+PSEF LFL+H+ SL YF  PDY ++ ++F+  M  + + E++ FDWE A
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKA 313          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6IQ55|TTBK2_HUMAN (Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 4.376e-143
Identity = 199/290 (68.62%), Postives = 242/290 (83.45%), Query Frame = 3
Query:   93 DLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LGRQIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  Y+LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF +FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE
Sbjct:    9 DILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q3UVR3|TTBK2_MOUSE (Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 5.017e-142
Identity = 198/300 (66.00%), Postives = 244/300 (81.33%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    +  D+L  G +VK+RW+V+RKIGGGGFGEIY+A D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG++H CRF+GCGRNDRFNY+VM LQGRNLA+LRR+  RG F++ST L+LG+QIL+SIE+IH VGFLHRD+KPSNFAMGR P T R  ++LDFGL+RQ+ N   +VR PR +AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG IK+ +DH ++L+HLP EF  FL+H+ SL YF  PDY +L ++FD  +    V ESD FDWE +
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFTNSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKS 300          
BLAST of Protein kinase vs. TrEMBL
Match: A0A1I8P1Y9 (Protein kinase domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106086207 PE=4 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 1.687e-158
Identity = 214/292 (73.29%), Postives = 249/292 (85.27%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            S DLLQAG+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR+ P+G FSVST L+LG QIL +IE+IH VGFLHRD+KPSNF+MGRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+F+ FLEH+QSLTY D PDY ML +LF+ CM R+ V ESD +DWE
Sbjct:    3 SEDLLQAGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRSQPKGAFSVSTTLRLGLQILRAIESIHSVGFLHRDIKPSNFSMGRLPLNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDFKQFLEHIQSLTYADRPDYAMLTSLFERCMKRRGVKESDPYDWE 294          
BLAST of Protein kinase vs. TrEMBL
Match: T1PJ51 (Protein kinase OS=Musca domestica OX=7370 GN=101890779 PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 1.861e-158
Identity = 214/292 (73.29%), Postives = 249/292 (85.27%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            S DLLQAG+VVK+RW+VIRKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR+ P+G FSVST L+LG QIL +IE+IH VGFLHRD+KPSNF+MGRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH +LL+HLPS+F+ FLEH+QSLTY D PDY ML N+F+ CM R+ V ESD +DWE
Sbjct:    3 SEDLLQAGHVVKERWKVIRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRSQPKGAFSVSTTLRLGLQILRAIESIHSVGFLHRDIKPSNFSMGRLPLNCRKVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRMLLKHLPSDFKQFLEHIQSLTYADRPDYAMLTNIFERCMKRRGVKESDPYDWE 294          
BLAST of Protein kinase vs. TrEMBL
Match: Q4V5D7 (RE74626p OS=Drosophila melanogaster OX=7227 GN=CG11533 PE=2 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.865e-156
Identity = 213/297 (71.72%), Postives = 247/297 (83.16%), Query Frame = 3
Query:   87 SSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPST 977
            S DLLQ G+VVK+RW+V+RKIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR  PRG FS+ST L+LG QIL +IE+IH VGFLHRD+KPSNF++GRLP   R VY+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGRHDDLWS+FYMLVE V GQLPWRK+KDKEQVG  K+ +DH ILL+HLPS+ + FLEH+QSLTY D PDY ML  LF+ CM R+ V ESD +DWE   ST
Sbjct:    3 SEDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDST 299          
BLAST of Protein kinase vs. TrEMBL
Match: A0A182SPC2 (Protein kinase domain-containing protein OS=Anopheles maculatus OX=74869 PE=4 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 1.073e-155
Identity = 212/305 (69.51%), Postives = 253/305 (82.95%), Query Frame = 3
Query:   93 DLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNT 1007
            DLLQAG+VVK+RW+V++KIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR+  RG FS+ST L++G QIL SIE+IH VGFLHRD+KPSNFA+GRLP T+R +Y+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGR DDLWS+FYMLVE VTGQLPWRK+KDKEQVG +K+ +DH +LL+HLPS+F+ FLEH+QSL Y D PDY ML +LF+ CM R+ V E+D FDWE     N  E +  N 
Sbjct:    3 DLLQAGHVVKERWKVLKKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHICRFIGCGRNDRFNYVVMQLQGKNLAELRRSQARGAFSLSTTLRIGLQILKSIESIHSVGFLHRDIKPSNFAIGRLPLTSRRIYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASLNAHKNREMGRQDDLWSLFYMLVEFVTGQLPWRKIKDKEQVGMLKEKYDHRLLLKHLPSDFKYFLEHIQSLNYADKPDYAMLISLFERCMKRRGVKETDPFDWENNADYNAGEAKAINA 307          
BLAST of Protein kinase vs. TrEMBL
Match: A0A2M4BIH7 (Putative discs overgrown protein kinase (Fragment) OS=Anopheles marajoara OX=58244 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 4.624e-155
Identity = 212/305 (69.51%), Postives = 255/305 (83.61%), Query Frame = 3
Query:   93 DLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNT 1007
            DLLQAG+VVK+RW+V++KIGGGGFGEIYE  D  T+++VALK+ES+RQPKQVLKMEVAVLKK+QG+EH CRF+GCGRNDRFNY+VM LQG+NLAELRR+  RG FS+ST L++G QIL SIE+IH VGFLHRD+KPSNFA+GRLP T+R +Y+LDFGL+RQY     EVR PR  AGFRGTVRYAS NAH NREMGR DDLWS+FYMLVE VTGQLPWRK+KDKEQVG +K+ +DH +LL+HLPS+F+ FLEH+QSL Y D PDY ML +LF+ CM R+ V E+D FDWE     +  E ++ NT
Sbjct:    3 DLLQAGHVVKERWKVLKKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHICRFIGCGRNDRFNYVVMQLQGKNLAELRRSQARGAFSLSTTLRIGLQILKSIESIHSVGFLHRDIKPSNFAIGRLPLTSRRIYMLDFGLARQYTTGTGEVRCPRAAAGFRGTVRYASLNAHKNREMGRQDDLWSLFYMLVEFVTGQLPWRKIKDKEQVGMLKEKYDHRLLLKHLPSDFKYFLEHIQSLNYADKPDYAMLVSLFERCMKRRGVKETDPFDWENNADYSAGEAKVLNT 307          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ttbk1a (tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-100609-4])

HSP 1 Score: 450.669 bits (1158), Expect = 1.528e-150
Identity = 202/326 (61.96%), Postives = 258/326 (79.14%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQV 1046
            M   S+  D+L    +VKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG+ H C+F+GCGRND+FNY+VM LQGRNLA+LRR+ PRG F++ST L+LG+QIL++IE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQ+K+ +DH +LL+H+PSEF +FL+HV +L Y+  PDY +L ++F+  M  + + E++L+DWE    T  + +   N+      RPT + V
Sbjct:   30 MNGSSEQQDILPPNCMVKDRWKVLKKIGGGGFGEIYEAVDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFTMSTTLRLGKQILEAIEAIHSVGFLHRDIKPSNFAMGRLPSTVRKCYMLDFGLARQYTNTNGEVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGQVKERYDHRMLLKHMPSEFHVFLDHVLALDYYTKPDYQLLMSVFENSMKERIITENELYDWE---KTGTDTMLTSNSATQQHTRPTAAMV 352          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ttbk1b (tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-100609-5])

HSP 1 Score: 442.195 bits (1136), Expect = 4.288e-147
Identity = 196/300 (65.33%), Postives = 246/300 (82.00%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M    +  D+L    +VK+RW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG+ H C+F+GCGRN++FNY+VM LQGRNLA+LRR+ PRG FS+ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQIK+ ++H +LL+H+PSEF +FL+HV  L Y+  PDY +L ++F+  M  + + E++ FDWE A
Sbjct:   14 MNGAGEQVDILPPNCMVKERWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFSMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTNGEVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGQIKERYEHKMLLKHMPSEFYIFLDHVLGLDYYTKPDYLLLMSVFENSMKEREITENEPFDWEKA 313          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 437.958 bits (1125), Expect = 3.953e-143
Identity = 198/298 (66.44%), Postives = 245/298 (82.21%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            M   ++ +D+L  GNVV++RWRV  KIGGGGFGEIYE  D+  Q  VALK+ES++QPKQVLKMEVAVLK++Q ++H CRFVGCGRNDRFNY+VM LQGRNLA+LRR   +G FSVST L+LGRQIL++IE+IH VGFLHRD+KPSNFAMGRL  T R  Y+LDFGL+RQ+ N   EVR PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+KDKEQVG +K+++DH ++L+HLPSEF +FLEH+ +L YF  PDY +L ++F++ M    V E+D +DWE
Sbjct:    1 MSGAAEQADILSVGNVVRERWRV--KIGGGGFGEIYEVLDQLNQCNVALKVESAQQPKQVLKMEVAVLKRLQ-KDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSQGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPSNFAMGRLSSTCRTCYMLDFGLARQFTNSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKVKDKEQVGNLKETYDHHLMLKHLPSEFIVFLEHISNLDYFTKPDYQLLMSVFEKSMKSYNVMENDPYDWE 295          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 372.089 bits (954), Expect = 7.854e-124
Identity = 179/304 (58.88%), Postives = 225/304 (74.01%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTN 980
            M   ++ +D+L  GNVV++RWRVI+KIGGGGFGEIYE  D+  Q  VALK+ES++QPKQVLKMEVAVLK++QG++H CRFVGCGRNDRFNY+VM LQGRNLA+LRR   +G FSVST L+LGRQIL++IE+IH VGFLHRD+KP                                   PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+KDKEQVG +K+++DH ++L+HLPSEF +FLEH+ +L YF  PDY +L ++F++ M    V E+D +DWE   S +
Sbjct:    1 MSGAAEQADILSVGNVVRERWRVIKKIGGGGFGEIYEVLDQLNQCNVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSQGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKP-----------------------------------PRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKVKDKEQVGNLKETYDHHLMLKHLPSEFIVFLEHISNLDYFTKPDYQLLMSVFEKSMKSYNVMENDPYDWERTDSED 269          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000001347.2 (casein kinase I [Source:NCBI gene;Acc:103041322])

HSP 1 Score: 187.578 bits (475), Expect = 2.306e-53
Identity = 119/326 (36.50%), Postives = 166/326 (50.92%), Query Frame = 3
Query:  117 VKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQVYVGTGGHAS 1073
            V  ++R+ RKIG G FG+IY   + AT + VA+KLE  +     L +E    K +QG         CG    +N +VM L G +L +L     R  FS+ T+L L  Q++  IE IH   F+HRDVKP NF MG L +   +VYI+DFGL+++Y +       P R      GT RYAS N H+  E  R DDL S+ Y+L+    G LPW+ LK        E++ + K S    +L +  PSEF  +L   +SL + D PDY+ LR LF     R+      +FDW          V+ G+ +   + R +G     G  GHAS
Sbjct:    5 VGSKYRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRK-FSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMG-LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAVDEGDRERRGEERDSGVVRGSGVRGHAS 328          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 324.709 bits (831), Expect = 9.271e-109
Identity = 142/225 (63.11%), Postives = 181/225 (80.44%), Query Frame = 3
Query:  288 REHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            ++H CRF+GCGRND+FNY+VM LQGRNLA+LRR+ PRG FS+ST L+LGRQ+L++IE+IH VGFLHRD+KPSNFAMGRLP T    ++LD+GL+RQY N   EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVG IK+ +DH +LLRH+P++F +FL+HV +L Y   P+Y  + +     M  + + E++ +DWE
Sbjct:    1 KDHVCRFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSNFAMGRLPSTTHKCFMLDYGLARQYTNSSGEVRPPRAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGLIKERYDHRLLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDWE 225          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 3.529e-49
Identity = 106/291 (36.43%), Postives = 154/291 (52.92%), Query Frame = 3
Query:  117 VKDRWRVIRKIGGGGFGEIY-EAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWET 965
            + +++R+ RKIG G FG+IY    + AT + VA+KLE  +     L +E  + K +QG         CG    +N +VM L G ++ +L     R  FS+ T+L L  Q++  IE +H   F+HRD+KP NF MG L +   +VYI+D GL+++Y +       P R      GT RYAS N H+  E  R DDL S+ Y+L+    G LPW+ LK        E++ + K S    +L +  PSEF  +L   +SL + D PDY+ LR LF     R+      +FDW T
Sbjct:    5 IGNKYRLGRKIGSGSFGDIYLVGTNIATGEEVAIKLECVKTKHPQLHIESKIYKLLQGGVGIPVIKWCGAEGDYNVMVMELLGPSMEDLFNFCSRK-FSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMG-LGKKGNLVYIIDLGLAKKYRDSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNT 293          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 155.992 bits (393), Expect = 2.613e-42
Identity = 93/290 (32.07%), Postives = 154/290 (53.10%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTAR-IVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            +V   +RV +KIG G FGE+    +  T + VA+KLE  +     L +E    K++   E   +    G   ++N +V+ L G +L +L     R  F++ T+L +  Q+L  +E +H    ++RDVKP NF +GR     + I++I+DFGL+++Y++ + +   P R      GT RY S N H+ +E  R DDL ++ +M +  + G LPW+ LK        +++G  K++    +L  + P E   +L +V+ L +F+ PDY  +RNLF +   RK       FDW
Sbjct:   33 MVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCNR-TFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIGRQSTNKQHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDYEYMRNLFMDLFERKGYSFDYEFDW 321          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 122.479 bits (306), Expect = 5.409e-32
Identity = 76/231 (32.90%), Postives = 124/231 (53.68%), Query Frame = 3
Query:   72 GSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARI-VYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLK 758
            GS + SS +L  G      +RV +KIG G FGE+    +  T + VA+KLE  +     L +E    K++   E   +    G   ++N +V+ L G +L +L     R  FS+ T+L +  Q++  +E +H    ++RDVKP NF +GR   +    ++I+DFGL+++Y++ + +   P R      GT RY S N H+ +E  R DDL ++ +M +  + G LPW+ LK
Sbjct:   17 GSGAPSSGVLMVG----PNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDR-TFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHNIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 1.255e-28
Identity = 68/188 (36.17%), Postives = 103/188 (54.79%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNRE 674
            +V  ++R++RKIG G FG+IY A +    + VA+KLES +     L  E  + K +QG          G+   +N LVM L G +L +L     R  F++ T+L L  Q++  IE +H   F+HRD+KP NF MG + +    ++++DFGL+++Y +       P R      GT RYAS NAH+  E
Sbjct:   12 IVGGKYRLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRR-FTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMG-IGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIE 197          
BLAST of Protein kinase vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 161.77 bits (408), Expect = 5.169e-44
Identity = 100/292 (34.25%), Postives = 149/292 (51.03%), Query Frame = 3
Query:  117 VKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTI----------LLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            V  ++R+ RKIG G FG+IY   +  + + VA+KLES R     L  E  V + + G          GR   +N +V+ L G +L +L     R  FS  T++ L  Q+   I+ IH   F+HRD+KP NF MG + +    V+++DFGLS++Y + +     P R      GT RYAS N H+  E  R DDL S+ Y+L+    G LPW+ LK   +    KQ +D  +          L   LP EF+ ++ + ++L + + PDY  L  LF +  ++   H   LFDW
Sbjct:    5 VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRR-FSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMG-VGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTK----KQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDW 290          
BLAST of Protein kinase vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 136.346 bits (342), Expect = 8.250e-35
Identity = 88/290 (30.34%), Postives = 147/290 (50.69%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQT-ARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLK------DKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            +V   +++ +KIG G FG ++E  +      VA+K E  +     L+ E    K + G  +       G+    N LV+ L G +L +L     R  FSV T++++  Q++  IE +H    ++RD+KP NF +GR  Q  A  ++++DFG+++QY +   +   P R      GT RY S N H+ RE  R DD+ ++ ++    + G LPW+ LK        E++G+ K+S +   L + LP +F  +LE V+SL++ + PDY   R L    +          +DW
Sbjct:   64 IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRK-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDW 352          
BLAST of Protein kinase vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 135.191 bits (339), Expect = 2.020e-34
Identity = 90/290 (31.03%), Postives = 148/290 (51.03%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQT-ARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLK------DKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            +V   +++ +KIG G FG ++E  +      VA+K E  +     LK E    K + G     +    G+    N LV+ L G +L +L     R  FSV T++++  Q++  IE +H    ++RD+KP NF +GR  Q  A  V+++DFG+++QY +   +   P R      GT RY S N H+ RE  R DD+ +M ++    + GQLPW+ LK        E++G+ K+  +   L + LP +F  +LE V++L++ ++PDY   R L    +          +DW
Sbjct:   71 IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDW 359          
BLAST of Protein kinase vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 121.709 bits (304), Expect = 7.522e-30
Identity = 89/328 (27.13%), Postives = 146/328 (44.51%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDE-----------------ATQDRVALKLESSRQPKQVLKMEVA---VLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTA-----------------RIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLK------DKEQVGQIKQSF--DHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            +V   + V  KIG G FG I+E  +                     + VA+K E        L+ E     +L    G  H+  F   G+    N L++ L G +L +L     R  FSV T   + +Q++D +  IH    ++RD+KP NF + +  + +                  ++Y++DFG+++QY +   +   P R      GT RY S N H  RE  R DDL S+ ++    + G LPW+ LK        E++G  KQ    D  +L   +P +F  +L++ +SL + + PDY  L +L D+ +    + +   +DW
Sbjct:    9 IVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYF---GQEGMHNILIIDLLGPSLEDLFEWCGRK-FSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDW 332          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 63.1586 bits (152), Expect = 7.350e-11
Identity = 54/212 (25.47%), Postives = 100/212 (47.17%), Query Frame = 3
Query:  126 RWRVIRKIGGGGFGEIYEAFDEATQDRVALK-LESSRQPKQVLKM-EVAVLKKIQGREHS--CRFVGCGRNDRFNYLVMS-LQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPW 746
            ++  + KIG G  G +Y A++  T   VA+K +   +QPK+ L + E+ V+K   G +H     F+         +++M  ++G +L ++  +    I +   +  + R+ L  +E +H  G LHRD+K  N  +         + + DFG   Q     +E+   R      GT  + +      +E G   D+WS+  M++EM+ G+ P+
Sbjct:  619 KYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMK---GSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHC---ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSM----EGDIKLTDFGFCAQI----NELNLKR--TTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 814          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 395.201 bits (1014), Expect = 4.287e-135
Identity = 187/294 (63.61%), Postives = 233/294 (79.25%), Query Frame = 3
Query:   90 SDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAP 971
            +DLL+ G+VV+ RW++I+KIGGGGFGEIY   D+ T+D VA+KLES  Q KQVLKMEVAVLKK+QG +H C+F+ CGRN+ FNYLVMSLQG NLAELRR+ P+G+FS STML+LG QIL S+++IH  GFLHRD+KPSNFAMG  P T  I Y+LDFGLSRQ+   + EVR PR  AGFRGTVRYAS NAH N+EMGRHDDLWS FY++VE   GQLPWRK+KDKEQVG++K+++D   LL+ +P EF+ F++H+  L Y D PDY ML  L ++ + RK + ESD +DWET P
Sbjct:    2 ADLLKPGDVVRQRWKIIKKIGGGGFGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQGVDHICKFISCGRNESFNYLVMSLQGSNLAELRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSNFAMGNTPDTVHICYMLDFGLSRQFTKANGEVRPPRNTAGFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDKEQVGKMKKTYDIANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDWETTP 295          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 178.333 bits (451), Expect = 2.612e-50
Identity = 108/288 (37.50%), Postives = 152/288 (52.78%), Query Frame = 3
Query:  117 VKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            V +++R+ RKIG G FG+IY     +T + VA+KLE  +     L +E    K +QG         CG    +N LVM L G +L +L     R  FS+ T+L L  Q +  IE +H   F+HRD+KP NF MG L +   +VYI+DFGL+++Y +       P R      GT RYAS N H+  E  R DDL S+ Y+L+    G LPW+ LK        E++ + K S    +L +  PSEF  +L + +SL + D PDY+ LR LF     R+      +FDW
Sbjct:    5 VGNKYRLGRKIGSGSFGDIYLGTSISTGEEVAIKLECVKTKHPQLHIEAKFYKMMQGGVGIPTIKWCGTEGDYNVLVMELLGPSLEDLFNFCNRK-FSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMG-LGKKGNLVYIIDFGLAKKYRDPRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDW 290          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 166.007 bits (419), Expect = 1.964e-46
Identity = 107/307 (34.85%), Postives = 168/307 (54.72%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREH--SCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESD-LFDW 959
            M S S S++  ++   V  ++R++RKIG G FG+IY A +    + VA+KLES +     L  E  + K +QG     S R+ G  R+  +N LVM L G +L +L     R  F++ T+L L  Q++  IE +H   F+HRD+KP NF MG + +    ++++DFGL+++Y +       P R      GT RYAS NAH+  E  R DD+ S+ Y+L+      LPW+ LK        E++ + K S    +L +  P+EF ++L + + L + ++PDY  LR LF   + R   ++ D +FDW
Sbjct:    1 MASSSGSAN--RSEFEVGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPSVRYYGQERD--YNVLVMELLGPSLEDLFNFCSRR-FTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMG-VGKHCNKLFLIDFGLAKKYRDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLF-RILFRTLNYQYDYIFDW 300          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 160.614 bits (405), Expect = 1.519e-44
Identity = 100/296 (33.78%), Postives = 158/296 (53.38%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIA-----GFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLK------DKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESD-LFDWET 965
            +V+ ++R++RKIG G FG+IY        +  A+KLES +     L  E  + K + G           + + +N LVM L G +L +L     R  F++ T+L L  Q++  IE +H   F+HRD+KP NF MG + +    +Y++DFGL+++Y     + RT + I+        GT RYAS NAH+  E  R DD+ S+ Y+L+      LPW+ LK        E++ + K S    +L +  P+EF ++L + + L + ++PDY  LR LF   + R   H+ D +FDW T
Sbjct:    9 IVQGKYRLVRKIGSGSFGDIYLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAGGSGIPAIRHFSQENDYNVLVMDLLGPSLEDLFNFCNRK-FNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMG-IGRHCNKLYLIDFGLAKKY----RDSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLF-RILFRTLNHQYDYIFDWTT 297          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 157.147 bits (396), Expect = 4.294e-42
Identity = 97/293 (33.11%), Postives = 154/293 (52.56%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKI---QGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQ-TARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
            +V   +RV +KIG G FGE+    +    + VA+KLE  +     L +E    K +   +G      F  CG+   +N LVM L G +L +L     R  FS+ T+L +  Q++  IE +H    ++RD+KP NF +GR      + + I+DFGL+++Y++ + +   P R      GT RY S N H+ +E  R DDL ++ +M +  + G LPW+ LK        +++G  K++    +L  + P E   +L +V+ L +F++PDY  LR LF + M RK   E   FDW
Sbjct:   41 MVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKALGNAEGIPQVHYFGPCGK---YNALVMELLGPSLEDLFDLCNRQ-FSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDYEYLRKLFRDLMERKGYVEDFEFDW 329          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ttbk2a (tau tubulin kinase 2 [Source:NCBI gene;Acc:101174145])

HSP 1 Score: 436.802 bits (1122), Expect = 1.592e-140
Identity = 198/312 (63.46%), Postives = 250/312 (80.13%), Query Frame = 3
Query:   84 DSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQ-GRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKP-SNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQP 1013
            + +D+L   ++VK+RW+V+RKIGGGGFGEIYEA D  T+  VALK+ES++QPKQVLKMEVAVLKK+Q ++H CRFVGCGRNDRFNY+VM LQ GRNLA+LRR+ PRG FS+ST L+LG QIL++IE+IH VGFLHRD+KP SNFAMGR P T R  Y+LDFGL+RQ+ N   EVR PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+K+KEQVG++K+++DH ++LRHLP+EF +FL+H+ +L YF  PDY +L ++FD  M    V E+D +DWE   +     +    T P
Sbjct:    6 EPADILSVLSLVKERWKVVRKIGGGGFGEIYEAMDLLTRASVALKVESAQQPKQVLKMEVAVLKKLQ-KDHICRFVGCGRNDRFNYVVMELQQGRNLADLRRSMPRGTFSISTTLRLGHQILEAIESIHSVGFLHRDIKPQSNFAMGRFPSTCRTCYMLDFGLARQFTNSCQEVRPPRPVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKEKEQVGKLKETYDHCLMLRHLPAEFGVFLDHISNLDYFTKPDYQLLMSVFDNSMKTYNVVENDPYDWERTSTDGTVTISASTTTP 316          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ttbk1a (tau tubulin kinase 1 [Source:NCBI gene;Acc:105354132])

HSP 1 Score: 410.223 bits (1053), Expect = 1.051e-134
Identity = 198/330 (60.00%), Postives = 246/330 (74.55%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGR----EHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQV 1046
            M   S+ +D+L    +VKDRW+V++KIGGGGFGEIYEA D  T++ VALK+ES++QPKQVLKMEVAVLKK+QG     EH    V    N  F + V   QGRNLA+LRR+ PRG F++ST L+LG+QIL+SIE IH VGFLHRD+KPSNFAMGRLP T R  Y+LDFGL+RQY N + EVR PR +AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE   GQLPWRK+KDKEQVGQIK+ FDH +LL+H+PSEF +FL+HV +L Y+  PDY +L ++F+  M  + + E++ FDWE   S         +TQP  + RPT + V
Sbjct:   14 MNGTSEQADILPPNCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGETLLHEHEDPVVSFLGNKLF-FFVWLAQGRNLADLRRSQPRGTFTMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTNGEVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGQIKERFDHKMLLKHMPSEFSIFLDHVLALDYYTKPDYQLLMSVFENSMKERIITENEPFDWEKGGSDVTLSTS-ASTQPLQNTRPTAAMV 341          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ttbk2b (tau-tubulin kinase 2 [Source:NCBI gene;Acc:101157747])

HSP 1 Score: 391.349 bits (1004), Expect = 2.982e-131
Identity = 181/304 (59.54%), Postives = 222/304 (73.03%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTN 980
            M    D +D+L  G+VV+DRW+VIRKIGGGGFGEIYE  D+ +Q  VALK+ES++QPKQVLKMEVAVLKK+QG+ H CRFVGCGRNDRFNY+VM LQGRNLA+LRR   RG FSVST L+LG+QIL++IE+IH VGFLHRD+KP                                   PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+KDKEQVG +K+++DH ++L+HLPSEF  FL+H+ +L YF  PDY +L ++FD  M    V E+D +DWE   S +
Sbjct:    1 MNGGVDHTDILTVGDVVRDRWKVIRKIGGGGFGEIYEVLDQLSQATVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSRGTFSVSTTLRLGKQILEAIESIHSVGFLHRDIKP-----------------------------------PRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKIKDKEQVGNLKETYDHRLMLKHLPSEFSTFLDHIMTLDYFTKPDYQLLTSMFDSAMKSHNVLENDPYDWEKCDSED 269          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ttbk2a (tau tubulin kinase 2 [Source:NCBI gene;Acc:101174145])

HSP 1 Score: 384.415 bits (986), Expect = 1.490e-128
Identity = 180/326 (55.21%), Postives = 231/326 (70.86%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQV 1046
            M    + +D+L   ++VK+RW+V+RKIGGGGFGEIYEA D  T+  VALK+ES++QPKQVLKMEVAVLKK+QG++H CRFVGCGRNDRFNY+VM LQGRNLA+LRR+ PRG FS+ST L+LG QIL++IE+IH VGFLHRD+KP                                   PRP+AGFRGTVRYAS NAH N+EMGRHDDLWS+FYMLVE + GQLPWRK+K+KEQVG++K+++DH ++LRHLP+EF +FL+H+ +L YF  PDY +L ++FD  M    V E+D +DWE   +     +    T P    R T + +
Sbjct:    1 MSGGVEPADILSVLSLVKERWKVVRKIGGGGFGEIYEAMDLLTRASVALKVESAQQPKQVLKMEVAVLKKLQGKDHICRFVGCGRNDRFNYVVMELQGRNLADLRRSMPRGTFSISTTLRLGHQILEAIESIHSVGFLHRDIKP-----------------------------------PRPVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKEKEQVGKLKETYDHCLMLRHLPAEFGVFLDHISNLDYFTKPDYQLLMSVFDNSMKTYNVVENDPYDWERTSTDGTVTISASTTTPQHHTRLTPAHM 291          
BLAST of Protein kinase vs. Ensembl Medaka
Match: csnk1e (casein kinase I [Source:NCBI gene;Acc:105356509])

HSP 1 Score: 184.496 bits (467), Expect = 4.179e-52
Identity = 111/289 (38.41%), Postives = 154/289 (53.29%), Query Frame = 3
Query:  114 VVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTP-RPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDK------EQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDW 959
             V +++R+ RKIG G FG+IY   + AT + VA+KLE  +     L +E    K +QG         CG    +N +VM L G +L +L     R  FS+ T+L L  Q++  IE IH   F+HRDVKP NF MG L +   +VYI+DFGL+++Y +       P R      GT RYAS N H+  E  R DDL S+ Y+L+    G LPW+ LK        E++ + K S    +L R  PSEF  +L + +SL + D PDY+ LR LF     R+      +FDW
Sbjct:    4 CVGNKYRLGRKIGSGSFGDIYLGSNIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPFIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRK-FSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMG-LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKGQKYERISEKKMSTPIGVLCRGYPSEFSTYLNYCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW 290          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000048011.1 (SMESG000048011.1)

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 474/515 (92.04%), Postives = 477/515 (92.62%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQVYVGTGGHASHQGHPVTIVRSMKQPNLINKKVPITKANEGLIENKKTHLEDAGMTKQVIFSNPKSLSKGGGKVAPSQNTPAVIEDKNCTYGSNLAGAENENFTNRLTLCRNGFTQLLDEKSYDDGQSFQTGFQTSACINCEPAPLGNRSNIIKTNEDFAKAPTVIERKINPSALKVCNEIPFKSIGREIL 1613
            MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQ+ +                                    GLIENKKTHLEDAGMTKQVIFSNPKSLSKGGGKVAPSQNTPAVIEDKNCTYGSNLAGAENENFTNRLTLCRNGFTQLLDEKSYDDGQSFQTGFQTSACINCEPAPLGNRSNIIK NEDFAKAPT+IERKINPSALKVCNEIPFKSIGREIL
Sbjct:    1 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETAPSTNQEEVEIGNTQPYVDGRPTGSQLQLS-----------------------------------GLIENKKTHLEDAGMTKQVIFSNPKSLSKGGGKVAPSQNTPAVIEDKNCTYGSNLAGAENENFTNRLTLCRNGFTQLLDEKSYDDGQSFQTGFQTSACINCEPAPLGNRSNIIKANEDFAKAPTIIERKINPSALKVCNEIPFKSIGREIL 480          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000068893.1 (SMESG000068893.1)

HSP 1 Score: 461.84 bits (1187), Expect = 1.354e-153
Identity = 209/312 (66.99%), Postives = 259/312 (83.01%), Query Frame = 3
Query:   81 SDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA-----PSTNQ-EEVEI 998
            SDSSDLL+ G ++K+RWRV +KIGGGGFG+IYEA D ++Q++VALKLES++Q KQVLKMEVAVLKK+QG +H CRF GCGRND+FNY+VMSLQG+NL ELRR T +GIFS+S+M++L +Q+L+ IE+IH VGFLHRD+KPSNFAMGRLP T R VY+LDFGL+RQY+N D EVR PRP+AGFRGTVRYAS NAH N+E+GRHDDLWS+ Y+ VEMVTGQLPWRK+KDKEQVG++KQ+ DH +LLRH+P EF+  L+H+Q L YF  PDY+ L+NL D+ M RK    +D FDWE        STN+  EVE+
Sbjct:    6 SDSSDLLEPGYIIKERWRVNKKIGGGGFGQIYEAIDLSSQEKVALKLESAQQSKQVLKMEVAVLKKLQGLDHVCRFYGCGRNDKFNYVVMSLQGKNLGELRRATSKGIFSISSMVRLTKQMLECIESIHSVGFLHRDIKPSNFAMGRLPSTFRKVYMLDFGLARQYVNTDGEVRPPRPVAGFRGTVRYASANAHFNKELGRHDDLWSLLYLAVEMVTGQLPWRKVKDKEQVGKLKQNVDHNLLLRHMPLEFKQILDHIQELHYFAKPDYSKLQNLLDQTMARKLFKFTDPFDWEIVVHQEPNSTNKANEVEV 317          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000030545.1 (SMESG000030545.1)

HSP 1 Score: 462.611 bits (1189), Expect = 1.185e-150
Identity = 207/302 (68.54%), Postives = 244/302 (80.79%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVD--DEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M S    +DLL   N+VKDRW+VIRK+GGGGFGEIYE  D  TQ++VALKLESSR  KQVLKMEVAVLKK+QG  H C+F+GCGRNDRFNY+ M+LQG+NLA+LRR      FS+STML+L  QIL SI+ IH  GFLHRD+KPSNF+MGRLP ++  V +LDFGL+RQY+  D   ++R PRP+ GFRGTVRYAS NAHMNREMGRHDDLWS FYM+ EMVTG LPWRKLKDK+QVGQIKQ+F+HT LLRHLPSEF+L L H+QSLTYFD+PDY  L+NL  +CM RK +   +LFDWET 
Sbjct:    1 MPSTKQETDLLNPSNIVKDRWKVIRKLGGGGFGEIYECLDSHTQEKVALKLESSRIAKQVLKMEVAVLKKLQGTAHVCKFLGCGRNDRFNYVAMTLQGKNLADLRRAQKNSAFSISTMLRLSAQILQSIQDIHNSGFLHRDIKPSNFSMGRLPLSSHTVVMLDFGLARQYILPDGNGDIRAPRPVTGFRGTVRYASVNAHMNREMGRHDDLWSAFYMMAEMVTGSLPWRKLKDKDQVGQIKQNFEHTQLLRHLPSEFKLLLSHIQSLTYFDAPDYEYLKNLIYQCMRRKGISSDELFDWETT 302          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000030545.1 (SMESG000030545.1)

HSP 1 Score: 461.07 bits (1185), Expect = 2.085e-148
Identity = 207/302 (68.54%), Postives = 244/302 (80.79%), Query Frame = 3
Query:   69 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVD--DEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA 968
            M S    +DLL   N+VKDRW+VIRK+GGGGFGEIYE  D  TQ++VALKLESSR  KQVLKMEVAVLKK+QG  H C+F+GCGRNDRFNY+ M+LQG+NLA+LRR      FS+STML+L  QIL SI+ IH  GFLHRD+KPSNF+MGRLP ++  V +LDFGL+RQY+  D   ++R PRP+ GFRGTVRYAS NAHMNREMGRHDDLWS FYM+ EMVTG LPWRKLKDK+QVGQIKQ+F+HT LLRHLPSEF+L L H+QSLTYFD+PDY  L+NL  +CM RK +   +LFDWET 
Sbjct:    1 MPSTKQETDLLNPSNIVKDRWKVIRKLGGGGFGEIYECLDSHTQEKVALKLESSRIAKQVLKMEVAVLKKLQGTAHVCKFLGCGRNDRFNYVAMTLQGKNLADLRRAQKNSAFSISTMLRLSAQILQSIQDIHNSGFLHRDIKPSNFSMGRLPLSSHTVVMLDFGLARQYILPDGNGDIRAPRPVTGFRGTVRYASVNAHMNREMGRHDDLWSAFYMMAEMVTGSLPWRKLKDKDQVGQIKQNFEHTQLLRHLPSEFKLLLSHIQSLTYFDAPDYEYLKNLIYQCMRRKGISSDELFDWETT 302          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000002855.1 (SMESG000002855.1)

HSP 1 Score: 429.483 bits (1103), Expect = 4.524e-142
Identity = 181/294 (61.56%), Postives = 246/294 (83.67%), Query Frame = 3
Query:   81 SDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 962
            S ++DL+  G ++K+RW++ +KIGGGGFGEIYEA D  T + VA+K+ES++Q KQVLKMEVAVLK++QG+ H C F+GCGRN+ FNY+VM+LQGRNLA++RR+  RG FS+ST +++G QILDSIE+IH VGFLHRD+KPSNFA+G+  + +R++ +LD+GL+RQY NV+ +VR PR +AGFRGTVRYAS NAH NRE+GRHDDLWS++Y+L E +TG+LPWRK+KDKEQVG +KQ+FDH  LL+ +P E R  LE++Q+LTYFD PDY ++R+ F E + RK ++++D+FDWE
Sbjct:    6 SSTADLVIPGTIIKERWKISKKIGGGGFGEIYEASDLQTNESVAIKVESTKQTKQVLKMEVAVLKRLQGKTHVCHFIGCGRNELFNYVVMTLQGRNLADIRRSMKRGCFSISTTMRIGIQILDSIESIHSVGFLHRDIKPSNFALGKSTELSRVIIMLDYGLARQYTNVNGDVRAPRQVAGFRGTVRYASVNAHQNRELGRHDDLWSLYYILAEFITGELPWRKIKDKEQVGTMKQTFDHNQLLKFMPREIRPVLEYIQTLTYFDKPDYNLIRSYFREYLKRKNLNDADIFDWE 299          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTBK21.101e-14967.11tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK18.299e-14766.33tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK29.112e-14468.62tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK11.131e-12966.79tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK21.009e-12660.07tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk-75.867e-12657.58Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
C39H7.11.337e-6638.06pep chromosome:WBcel235:IV:5631895:5633379:1 gene:... [more]
Y38H8A.31.533e-6638.06pep chromosome:WBcel235:IV:13472497:13474005:1 gen... [more]
W03G9.53.591e-6440.27pep chromosome:WBcel235:I:4968007:4970245:-1 gene:... [more]
R13H9.51.635e-6338.57pep chromosome:WBcel235:IV:5065746:5066987:-1 gene... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asator4.912e-15671.72gene:FBgn0039908 transcript:FBtr0300344[more]
Asator7.448e-15371.72gene:FBgn0039908 transcript:FBtr0344869[more]
Asator7.448e-15371.72gene:FBgn0039908 transcript:FBtr0332908[more]
Asator1.641e-15271.72gene:FBgn0039908 transcript:FBtr0332904[more]
Asator3.493e-15271.72gene:FBgn0039908 transcript:FBtr0332905[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk1a1.730e-14662.24tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk1a1.730e-14662.24tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk1b8.154e-14565.23tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk2b8.815e-14565.44tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ttbk2a2.227e-14362.19tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-12... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col24a13.434e-14867.00collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a15.189e-14567.22collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a11.274e-14467.22collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a13.697e-14069.53collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a11.008e-12760.26collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttbk14.800e-15066.33tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk13.273e-14766.33tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk21.106e-14566.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk27.172e-14366.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk27.172e-14366.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IMC6|ASATR_DROME2.789e-15071.72Tau-tubulin kinase homolog Asator OS=Drosophila me... [more]
sp|Q6PCN3|TTBK1_MOUSE2.289e-14666.33Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=T... [more]
sp|Q5TCY1|TTBK1_HUMAN3.986e-14666.33Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TT... [more]
sp|Q6IQ55|TTBK2_HUMAN4.376e-14368.62Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TT... [more]
sp|Q3UVR3|TTBK2_MOUSE5.017e-14266.00Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=T... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8P1Y91.687e-15873.29Protein kinase domain-containing protein OS=Stomox... [more]
T1PJ511.861e-15873.29Protein kinase OS=Musca domestica OX=7370 GN=10189... [more]
Q4V5D77.865e-15671.72RE74626p OS=Drosophila melanogaster OX=7227 GN=CG1... [more]
A0A182SPC21.073e-15569.51Protein kinase domain-containing protein OS=Anophe... [more]
A0A2M4BIH74.624e-15569.51Putative discs overgrown protein kinase (Fragment)... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk1a1.528e-15061.96tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk1b4.288e-14765.33tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk2b3.953e-14366.44tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ttbk2b7.854e-12458.88tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ENSAMXT00000001347.22.306e-5336.50casein kinase I [Source:NCBI gene;Acc:103041322][more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004926.19.271e-10963.11pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
ENSPMAT00000008477.13.529e-4936.43pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
csnk1g2a2.613e-4232.07casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g15.409e-3232.90casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000001691.11.255e-2836.17pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRR255.169e-4434.25Conserved casein kinase; regulates diverse events ... [more]
YCK18.250e-3530.34Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK22.020e-3431.03Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK37.522e-3027.13Palmitoylated vacuolar membrane-localized casein k... [more]
STE207.350e-1125.47Cdc42p-activated signal transducing kinase; involv... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467894.287e-13563.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347422.612e-5037.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465231.964e-4634.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487381.519e-4433.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342894.294e-4233.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk2a1.592e-14063.46tau tubulin kinase 2 [Source:NCBI gene;Acc:1011741... [more]
ttbk1a1.051e-13460.00tau tubulin kinase 1 [Source:NCBI gene;Acc:1053541... [more]
ttbk2b2.982e-13159.54tau-tubulin kinase 2 [Source:NCBI gene;Acc:1011577... [more]
ttbk2a1.490e-12855.21tau tubulin kinase 2 [Source:NCBI gene;Acc:1011741... [more]
csnk1e4.179e-5238.41casein kinase I [Source:NCBI gene;Acc:105356509][more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048011.10.000e+092.04SMESG000048011.1[more]
SMESG000068893.11.354e-15366.99SMESG000068893.1[more]
SMESG000030545.11.185e-15068.54SMESG000030545.1[more]
SMESG000030545.12.085e-14868.54SMESG000030545.1[more]
SMESG000002855.14.524e-14261.56SMESG000002855.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018644 ID=SMED30018644|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1736bp
AAATCTATATAAATCTTATATGCCGTATTATAAGAATCTTCGAATAGTAA
TGAAATTAATGTAATGGGATGGGCTCAGAAAGCGATTCTTCGGATTTATT
ACAAGCTGGAAATGTCGTGAAAGATAGATGGAGAGTTATCAGGAAAATTG
GTGGTGGAGGCTTTGGAGAAATATATGAAGCGTTTGATGAAGCAACGCAA
GATCGGGTTGCATTGAAATTAGAATCATCTCGTCAACCTAAACAAGTACT
AAAGATGGAAGTTGCCGTGCTGAAAAAGATACAAGGAAGAGAGCATTCTT
GTAGATTTGTTGGATGCGGACGAAATGATAGATTCAATTATTTAGTCATG
TCACTACAAGGTCGAAATTTGGCTGAGTTACGAAGAAATACCCCAAGAGG
AATCTTTTCAGTTTCGACAATGCTCAAATTAGGAAGACAAATTCTAGATT
CAATTGAAACCATTCATATGGTAGGATTCTTGCATCGAGATGTCAAACCT
TCGAATTTCGCCATGGGTCGATTACCTCAAACTGCGAGAATAGTTTACAT
TCTGGATTTCGGTCTATCCCGGCAATATTTGAATGTCGACGATGAGGTTA
GAACTCCTCGGCCAATCGCTGGATTCCGAGGCACGGTCAGATATGCGTCG
ACTAATGCTCACATGAACCGTGAAATGGGCCGTCATGATGATTTGTGGTC
AATGTTTTACATGCTCGTTGAAATGGTCACTGGTCAACTGCCATGGAGGA
AGTTGAAAGACAAAGAACAGGTTGGTCAAATTAAGCAGTCGTTCGATCAC
ACGATCTTACTTCGACATCTTCCGTCTGAGTTCCGTTTGTTTTTGGAACA
TGTTCAAAGCCTCACATACTTTGATTCTCCTGATTACACTATGCTTAGAA
ACCTTTTCGATGAGTGCATGCTGAGAAAGCGGGTACACGAGAGTGATTTA
TTTGATTGGGAAACGGCTCCTTCCACAAATCAAGAAGAAGTAGAAATAGG
AAATACTCAGCCCTATGTCGATGGAAGACCGACCGGTAGTCAGGTATATG
TTGGTACAGGTGGTCATGCAAGTCATCAAGGTCATCCAGTTACAATTGTC
CGGTCAATGAAACAACCAAATTTGATCAACAAAAAGGTTCCGATAACGAA
AGCAAACGAAGGTTTAATTGAAAATAAGAAAACTCATTTGGAAGATGCAG
GAATGACAAAGCAAGTAATCTTCTCCAATCCTAAATCGCTGAGTAAAGGA
GGTGGCAAGGTAGCTCCTAGCCAGAACACGCCTGCGGTGATCGAAGACAA
GAACTGCACATACGGCAGCAATTTGGCTGGAGCAGAAAATGAAAATTTCA
CTAATCGTTTGACTCTTTGTCGAAATGGTTTCACTCAATTACTAGATGAA
AAATCTTATGACGACGGGCAATCGTTCCAAACCGGTTTCCAAACGTCAGC
GTGTATCAATTGTGAACCTGCACCACTAGGAAATCGTTCAAATATAATAA
AAACCAATGAAGATTTTGCTAAGGCACCCACAGTTATTGAGCGTAAGATA
AACCCGTCGGCCTTGAAAGTTTGCAATGAGATTCCTTTTAAAAGCATTGG
TCGAGAAATATTGTAAAATTTTAATTATTTTTCTGAAATTTCTATAGCAA
TTATTTGAGTATTCATTCATTTTAATGTACAAATGTATGATGCAATCGAT
TTTGTATTACCTACGCAGGGGGTGAATTAGATTCAT
back to top

protein sequence of SMED30018644-orf-1

>SMED30018644-orf-1 ID=SMED30018644-orf-1|Name=SMED30018644-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALK
LESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRN
LAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMG
RLPQTARIVYILDFGLSRQYLNVDDEVRTPRPIAGFRGTVRYASTNAHMN
REMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRH
LPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWETA
PSTNQEEVEIGNTQPYVDGRPTGSQVYVGTGGHASHQGHPVTIVRSMKQP
NLINKKVPITKANEGLIENKKTHLEDAGMTKQVIFSNPKSLSKGGGKVAP
SQNTPAVIEDKNCTYGSNLAGAENENFTNRLTLCRNGFTQLLDEKSYDDG
QSFQTGFQTSACINCEPAPLGNRSNIIKTNEDFAKAPTVIERKINPSALK
VCNEIPFKSIGREIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 21..268
e-value: 1.8E-17
score: 74.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 22..241
e-value: 7.3E-30
score: 104.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 21..284
score: 27.043
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3..319
e-value: 2.5E-92
score: 311.9
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 6..299
NoneNo IPR availablePANTHERPTHR11909:SF201TAU-TUBULIN KINASE 2coord: 6..299
NoneNo IPR availableCDDcd14017STKc_TTBKcoord: 20..281
e-value: 5.05288E-162
score: 458.26
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 27..50
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 16..298