Heat shock cognate 70 kDa protein

Overview
NameHeat shock cognate 70 kDa protein
Smed IDSMED30018637
Length (bp)2686
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 70 kDa protein (SMED30018637) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30018637) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 70 kDa protein (SMED30018637) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30018637) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018637

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018637SMESG000040632.1 dd_Smed_v4_15_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018637SMESG000040632.1 Contig39561uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018637SMESG000040632.1 Contig39561newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018637SMESG000053057.1 SMESG000050147.1 SMESG000040632.1 Contig20384uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018637SMESG000053057.1 SMESG000050147.1 SMESG000040632.1 Contig20384newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30018637SMESG000040632.1 dd_Smed_v6_15_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018637SMESG000040632.1 dd_Smed_v6_15_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 518/613 (84.50%), Postives = 562/613 (91.68%), Query Frame = 2
Query:  104 SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            ++GPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FEDA+VQSDMKHW F VV+EGG+PK+QV+YKGE K FFPEEISSMVL KMKE AEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEK+LRDAK+DK  I EIVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQ  VL+QVYEGERAMT+DNNLLGKF+L+GIPPAPRGVPQ+EVTFDIDANGILNV+A +KSTGKENKITI+NDKGRLSKDDI+RMV EAE+YK +DE  ++RV AKNALESY Y +K T+EDEKL+ K+SE D+  I+DKC EVI WL+ NQ AEK+EYEH QKELE+VCNPI++K YQ
Sbjct:    3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 518/613 (84.50%), Postives = 562/613 (91.68%), Query Frame = 2
Query:  104 SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            ++GPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FEDA+VQSDMKHW F VV+EGG+PK+QV+YKGE K FFPEEISSMVL KMKE AEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEK+LRDAK+DK  I EIVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQ  VL+QVYEGERAMT+DNNLLGKF+L+GIPPAPRGVPQ+EVTFDIDANGILNV+A +KSTGKENKITI+NDKGRLSKDDI+RMV EAE+YK +DE  ++RV AKNALESY Y +K T+EDEKL+ K+SE D+  I+DKC EVI WL+ NQ AEK+EYEH QKELE+VCNPI++K YQ
Sbjct:    3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 522/613 (85.15%), Postives = 566/613 (92.33%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVT-EGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D +VQSDMKHW F V++ EG +PK+QV+YKGE K F PEEISSMVLLKMKETAEA+LG  V DAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA+IEIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEKSLRDAKMDK  +H+IVLVGGSTRIPK+QKLL DLF GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  QTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK+NKITI+NDKGRLSKDDIERMV+EAEKYK  DE QK+R+ AKN LESYA+ +K T+EDEKLKDK+S  D+K I DKC E++ WL+ NQTAEKEE+EH QK+LE + NPI++K YQ
Sbjct:    1 MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 522/613 (85.15%), Postives = 566/613 (92.33%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVT-EGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK  AVGIDLGTTYSCVGVF HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D +VQSDMKHW F V++ EG +PK+QV+YKGE K F PEEISSMVLLKMKETAEA+LG  V DAVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA+IEIDSL+EGIDFYT+ITRARFEEL ADLFRST++PVEKSLRDAKMDK  +H+IVLVGGSTRIPK+QKLL DLF GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTK  QTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK+NKITI+NDKGRLSKDDIERMV+EAEKYK  DE QK+R+ AKN LESYA+ +K T+EDEKLKDK+S  D+K I DKC E++ WL+ NQTAEKEE+EH QK+LE + NPI++K YQ
Sbjct:    1 MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 436/613 (71.13%), Postives = 515/613 (84.01%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MS   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGRRF++++VQSD KHW F V  + G+P I+V+ KGE ++F PEEIS+MVL KMKETAE YLG  V DAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEK+LRDAK+DK  I E+VLVGGSTR+PKIQKLL+D F+GKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  +TFTTY+DNQPGV IQVYEGERAMTRDN+ LG FELSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK N+ITI N+KGRL++ DI+RMV EA++++++D  Q+ERV A+N LE+YA+Q+K  +++     KLS  D     +   E + WL+ N  AEK+E E   KEL+ VC  I+TK +Q
Sbjct:    1 MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 436/613 (71.13%), Postives = 515/613 (84.01%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MS   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGRRF++++VQSD KHW F V  + G+P I+V+ KGE ++F PEEIS+MVL KMKETAE YLG  V DAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEK+LRDAK+DK  I E+VLVGGSTR+PKIQKLL+D F+GKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  +TFTTY+DNQPGV IQVYEGERAMTRDN+ LG FELSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK N+ITI N+KGRL++ DI+RMV EA++++++D  Q+ERV A+N LE+YA+Q+K  +++     KLS  D     +   E + WL+ N  AEK+E E   KEL+ VC  I+TK +Q
Sbjct:    1 MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 436/613 (71.13%), Postives = 515/613 (84.01%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MS   A+GIDLGTTYSCVG++Q+GKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGRRF++++VQSD KHW F V  + G+P I+V+ KGE ++F PEEIS+MVL KMKETAE YLG  V DAV+TVPAYFNDSQRQATKDA  I+GLN +RIINEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSIL+I +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +E+DSL+EGID  T ITRARFEEL ADLFR TLEPVEK+LRDAK+DK  I E+VLVGGSTR+PKIQKLL+D F+GKELN SINPDEAVA+GAAVQAA+LSG K E ++D+LL+DVAPLSLGIETAGGVMT LI RNT IPTK  +TFTTY+DNQPGV IQVYEGERAMTRDN+ LG FELSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK N+ITI N+KGRL++ DI+RMV EA++++++D  Q+ERV A+N LE+YA+Q+K  +++     KLS  D     +   E + WL+ N  AEK+E E   KEL+ VC  I+TK +Q
Sbjct:    1 MSSCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 512/612 (83.66%), Postives = 565/612 (92.32%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGR+F+DA+VQSDMKHW F+VV+  G+PKI+V YK E K FFPEEISSMVL KMKETAEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EG DFYTSITRARFEELNADLFRST++PVEK+LRDAK+DK  IH+IVLVGGSTRIPK+Q+LLQDLF+GKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNV+A+E+ST KENKITI+NDKGRLSK+DIERMV+EAEKY+ +DE QKE + AKN LESY + MKAT++++ LK K+S+ DR  I+DKC E I WL+ NQ A+KEEYEH QKELE VCNPI+TK YQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 512/612 (83.66%), Postives = 565/612 (92.32%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGR+F+DA+VQSDMKHW F+VV+  G+PKI+V YK E K FFPEEISSMVL KMKETAEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EG DFYTSITRARFEELNADLFRST++PVEK+LRDAK+DK  IH+IVLVGGSTRIPK+Q+LLQDLF+GKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNV+A+E+ST KENKITI+NDKGRLSK+DIERMV+EAEKY+ +DE QKE + AKN LESY + MKAT++++ LK K+S+ DR  I+DKC E I WL+ NQ A+KEEYEH QKELE VCNPI+TK YQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 512/612 (83.66%), Postives = 565/612 (92.32%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGR+F+DA+VQSDMKHW F+VV+  G+PKI+V YK E K FFPEEISSMVL KMKETAEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EG DFYTSITRARFEELNADLFRST++PVEK+LRDAK+DK  IH+IVLVGGSTRIPK+Q+LLQDLF+GKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNV+A+E+ST KENKITI+NDKGRLSK+DIERMV+EAEKY+ +DE QKE + AKN LESY + MKAT++++ LK K+S+ DR  I+DKC E I WL+ NQ A+KEEYEH QKELE VCNPI+TK YQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 512/612 (83.66%), Postives = 565/612 (92.32%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGR+F+DA+VQSDMKHW F+VV+  G+PKI+V YK E K FFPEEISSMVL KMKETAEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EG DFYTSITRARFEELNADLFRST++PVEK+LRDAK+DK  IH+IVLVGGSTRIPK+Q+LLQDLF+GKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNV+A+E+ST KENKITI+NDKGRLSK+DIERMV+EAEKY+ +DE QKE + AKN LESY + MKAT++++ LK K+S+ DR  I+DKC E I WL+ NQ A+KEEYEH QKELE VCNPI+TK YQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 512/612 (83.66%), Postives = 565/612 (92.32%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP  T+FDAKRLIGR+F+DA+VQSDMKHW F+VV+  G+PKI+V YK E K FFPEEISSMVL KMKETAEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EG DFYTSITRARFEELNADLFRST++PVEK+LRDAK+DK  IH+IVLVGGSTRIPK+Q+LLQDLF+GKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVM+ LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNV+A+E+ST KENKITI+NDKGRLSK+DIERMV+EAEKY+ +DE QKE + AKN LESY + MKAT++++ LK K+S+ DR  I+DKC E I WL+ NQ A+KEEYEH QKELE VCNPI+TK YQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1049.65 bits (2713), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V++AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVIGWL+ NQTAE+EE+EH QKELEKVCNPI+TK YQ
Sbjct:    6 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V++AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVIGWL+ NQTAE+EE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V++AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVIGWL+ NQTAE+EE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1048.5 bits (2710), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V++AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVIGWL+ NQTAE+EE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 1048.11 bits (2709), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V++AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVIGWL+ NQTAE+EE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1055.05 bits (2727), Expect = 0.000e+0
Identity = 539/614 (87.79%), Postives = 580/614 (94.46%), Query Frame = 2
Query:   95 SQMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            S MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+V+++ GRPK+QV+YK E K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    4 STMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 617          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1054.66 bits (2726), Expect = 0.000e+0
Identity = 539/615 (87.64%), Postives = 581/615 (94.47%), Query Frame = 2
Query:   92 LSQMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            +S MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+V+++ GRPK+QV+YK E K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    6 VSTMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 620          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1052.35 bits (2720), Expect = 0.000e+0
Identity = 538/612 (87.91%), Postives = 579/612 (94.61%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+V+++ GRPK+QV+YK E K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1051.97 bits (2719), Expect = 0.000e+0
Identity = 538/612 (87.91%), Postives = 579/612 (94.61%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+V+++ GRPK+QV+YK E K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 535/609 (87.85%), Postives = 576/609 (94.58%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+V+++ GRPK+QV+YK E K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRKHKKDI DNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    5 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 517/613 (84.34%), Postives = 563/613 (91.84%), Query Frame = 2
Query:  104 SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            ++GPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FEDA+VQSDMKHW F VV+EGG+PK+QV+YKGE+K FFPEEISSMVL KMKE AEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEK+LRDAK+DK  I EIVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQ  VL+QVYEGERAMT+DNNLLGKF+L+GIPPAPRGVPQ+EVTFDIDANGILNV+A +KSTGKENKITI+NDKGRLSKDDI+RMV EAE+YK +DE  ++RV AKNA+ESY Y +K T+EDEKL+ K+SE D+  I+DKC EVI WL+ NQ AEK+EYEH QKELE+VCNPI++K YQ
Sbjct:    3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 517/613 (84.34%), Postives = 563/613 (91.84%), Query Frame = 2
Query:  104 SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKK--VGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            ++GPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGR+FEDA+VQSDMKHW F VV+EGG+PK+QV+YKGE+K FFPEEISSMVL KMKE AEAYLG  V  AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   G E+NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV+H  +EFKRKHKKDI  NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TLEPVEK+LRDAK+DK  I EIVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQ  VL+QVYEGERAMT+DNNLLGKF+L+GIPPAPRGVPQ+EVTFDIDANGILNV+A +KSTGKENKITI+NDKGRLSKDDI+RMV EAE+YK +DE  ++RV AKNA+ESY Y +K T+EDEKL+ K+SE D+  I+DKC EVI WL+ NQ AEK+EYEH QKELE+VCNPI++K YQ
Sbjct:    3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ 615          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 519/612 (84.80%), Postives = 560/612 (91.50%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+                   ATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK-------------------ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 593          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 507/611 (82.98%), Postives = 561/611 (91.82%), Query Frame = 2
Query:  104 SKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            +KG A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F D  VQSDMK W F V+ E G+PK+ V YKGE K F+PEEISSMVL KMKETAEA+LG NVT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ER+VLIFDLGGGTFDVSILTI+DGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS NKRAVRRLRTACERAKRTLSSS QAN+EIDSLYEGIDFYTSITRARFEEL ADLFR TLEPVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD F+G++LNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVAPLSLG+ETAGGVMT LIKRN+TIPTKQTQ FTTYSDNQPGVLIQVYEGERAMTRDNNLLG+F+L+GIPPAPRGVPQ+EVTFDIDANGILNV+A++KSTGK NKITI+NDKGRLSK++IERMV EAE+YK +DE Q+E++ AKNALESYA+ MK+ + DE LKDK+SE D+K I+DKC EV+ WLE NQ AEK+E++H +KELE +CNPI+TK YQ
Sbjct:    4 NKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQ 614          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63018|HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus OX=10116 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63017|HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q5NVM9|HSP7C_PONAB (Heat shock cognate 71 kDa protein OS=Pongo abelii OX=9601 GN=HSPA8 PE=2 SV=2)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P11142|HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 1046.57 bits (2705), Expect = 0.000e+0
Identity = 536/612 (87.58%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F VV + GRPK+QV+YKGE K F+PEE+SSMVL KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +DE Q+++V++KN+LESYA+ MKAT+EDEKL+ K+++ D++ I+DKC E+I WL+ NQTAEKEE+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: B0LVF7 (Heat shock protein 70 OS=Dugesia japonica OX=6161 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 589/612 (96.24%), Postives = 604/612 (98.69%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRRF+DA+VQSDMKHWSFDVV EGGRPKIQV+YKGE+KKFFPEEISSMVLLKMKETAE YLGR VTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+QEFKRKHKKDISDNKRAVRRLRTACERA+RTLSSSAQANIEIDSLYEGIDFYTS+TRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSA+EKSTGKENKITISNDKGRLSKDDIERMV+EAEKYKQQDELQK+RV AKNALES +YQMK TMEDEKLKDKLSE DRK I+DKC+EVIGWL+HNQTAEKEEYEHHQKELEKVCNPIMTKFYQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRRFDDATVQSDMKHWSFDVVCEGGRPKIQVNYKGELKKFFPEEISSMVLLKMKETAEGYLGRPVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISDNKRAVRRLRTACERARRTLSSSAQANIEIDSLYEGIDFYTSMTRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAIEKSTGKENKITISNDKGRLSKDDIERMVNEAEKYKQQDELQKDRVAAKNALESCSYQMKTTMEDEKLKDKLSESDRKTIIDKCSEVIGWLDHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: G1EHI2 (Heat shock protein 70 OS=Acipenser ruthenus OX=7906 PE=2 SV=1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 540/612 (88.24%), Postives = 585/612 (95.59%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKG AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+VV++GGRPK++V+YKGE K F+PEE+SSMVL KMKE AEAYLG++VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+E+V++KNALESYA+ MK+T+EDEKL+ K+S+ D++ I++KC E+IGWL+ NQTAEKEEYEHHQKELEKVCNPI+TK YQ
Sbjct:    1 MSKGTAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVVSDGGRPKLEVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKSVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKSEDDMQREKVSSKNALESYAFNMKSTVEDEKLEGKISDEDKQKILEKCNEIIGWLDKNQTAEKEEYEHHQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: M4VMY6 (Heat shock cognate 70 kDa protein OS=Clarias batrachus OX=59899 GN=hsc70 PE=2 SV=2)

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 538/612 (87.91%), Postives = 582/612 (95.10%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NT+FDAKRLIGRRFED+ VQSDMKHW F V+++GGRPK++V+YKGE+K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKLKDK+S+ D++ I+DKC EVI WL+ NQTAEKEEYEH  KELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDSVVQSDMKHWPFKVISDGGRPKVEVEYKGELKNFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKDKISDEDKQKILDKCNEVISWLDKNQTAEKEEYEHQHKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A0C5BIF3 (Heat shock protein 70 OS=Huso dauricus OX=55293 GN=HSP70 PE=2 SV=1)

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 540/612 (88.24%), Postives = 584/612 (95.42%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKG AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+VV++GGRPK++V+YKGE K F+PEE+SSMVL KMKE AEAYLG++VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+E+V++KNALESYA+ MK+T+EDEKL+ K+S  D++ I++KC E+IGWL+ NQTAEKEEYEHHQKELEKVCNPI+TK YQ
Sbjct:    1 MSKGTAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVVSDGGRPKLEVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKSVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKSEDDVQREKVSSKNALESYAFNMKSTVEDEKLEGKISNEDKQKILEKCNEIIGWLDKNQTAEKEEYEHHQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A3G2LMQ6 (Heat shock protein OS=Acipenser oxyrinchus oxyrinchus OX=40147 GN=hspa8 PE=2 SV=1)

HSP 1 Score: 1056.59 bits (2731), Expect = 0.000e+0
Identity = 539/612 (88.07%), Postives = 584/612 (95.42%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKG AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFEDA VQSDMKHW F+VV++GGRPK++V+YKGE K F+PEE+SSMVL KMKE AEAYLG++VT+AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG+ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEGIDFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+E+V++KNALESYA+ MK+T+EDEKL+ K+S+ D++ I++KC E+I WL+ NQTAEKEEYEHHQKELEKVCNPI+TK YQ
Sbjct:    1 MSKGTAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVVSDGGRPKLEVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKSVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKSEDDVQREKVSSKNALESYAFNMKSTVEDEKLEGKISDEDKQKILEKCNEIISWLDKNQTAEKEEYEHHQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 533/612 (87.09%), Postives = 577/612 (94.28%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRRF+D  VQSDMKHW F V+ +  RPK+QVDYKGE K F+PEEISSMVL+KMKE AEAYLG+ VT+AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRKHKKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSA +KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V++KN+LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAE++E+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 530/612 (86.60%), Postives = 581/612 (94.93%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKG AVGIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NT+FDAKRLIGRRFED  VQSDMKHW F V+++GGRPK++V+YKGE K F+PEEISSMVL+KMKE AEAYLG+++ +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKSLRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V++KN+LESYA+ MK+T+ED+KL+ K+S+ D++ I+DKC E+I WL+ NQTAEKEEYEH Q+ELEKVCNPI+TK YQ
Sbjct:    1 MSKGTAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDDKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 533/612 (87.09%), Postives = 577/612 (94.28%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+DA VQSDMKHW F V+ +  RPK+QV+YKGE K F+PEEISSMVL+KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKSLRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK++IERMV +AEKYK +D++Q+++V AKN LESYA+ MK+T+EDEKLK K+S+ D++ I+DKC EVI WL+ NQTAEK+E+EH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 530/612 (86.60%), Postives = 578/612 (94.44%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRF+DA VQSDMKHW F VV++GG+PK++V+YKGE+K F+PEE+SSMVL KMKE +EAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK KKDI+ NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELN+DLFR TL+PVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQD F+G++LNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNN+LGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EA++Y+ +DE Q+E+VT+KN LES A+ MK+T+EDEKLKDK+S  D+K IVDKC EVI WL+ NQTAEKEEYEH QKELEKVCNPI+TK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYPEEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNSDLFRGTLDPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVEDEKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 510/612 (83.33%), Postives = 572/612 (93.46%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MS G ++GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNT+FDAKRLIGRRF+DA VQSDMK W F V+++GG+PK++V+YKGEVK F+PEEISSMVL+KM+E +EAYLG+ VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK    ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMV HF++EFKRKHKKDI+ NKRAVRRLRTACERAKRTLSSS QA+IEIDSL++GIDFYTSITRARFEELN++LFR TLEPVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQ+ F+G++LNKSINPDEAVAYGAAVQAAIL GD SE VQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIP KQTQ F+TYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSA++KSTGKENKITI+NDKGRLSK++IERMV EA+KY+ +DE+Q+E+V AKN LESYA+ +K ++E+EKLK K+SE D+K ++DKC EVI WLE+NQ AEKEEYEH+QKELE VCNPI++K YQ
Sbjct:    1 MSAGVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDAVVQSDMKLWPFKVISDGGKPKVEVEYKGEVKTFYPEEISSMVLVKMREISEAYLGQRVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVQHFVEEFKRKHKKDITQNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFDGIDFYTSITRARFEELNSELFRGTLEPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQEFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPNKQTQIFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIDKSTGKENKITITNDKGRLSKEEIERMVQEADKYRAEDEIQREKVAAKNNLESYAFNVKNSVEEEKLKGKISEDDKKKVIDKCKEVITWLENNQLAEKEEYEHYQKELESVCNPIISKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 398/611 (65.14%), Postives = 497/611 (81.34%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDY-KGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMED-EKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            G  +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFDAKRLIGR + D +VQ D+K W F V+ + G+P IQV+   GE K F PEEIS+MVL KMKETAEAYLG+ VT AVVTVPAYFND+QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+L+FDLGGGTFDVS+LTI+ G+FEV +T GDTHLGGEDFD R++ HFI+ +K+K  KD+  + RAV++LR   E+AKRTLS+  QA I+I+S Y+G DF  ++TRA+FEELN DLFRST++PV+K + D+ + K DI EIVLVGGSTRIPKIQ+L+++LF+GKE ++ INPDEAVAYGAAVQA +LSG+ +    DL+LLDV PL+LGIET GGVMT LI RNT +PTK++Q F+T +DNQP V IQV+EGER MT+DN+LLGKF+L+GIPPAPRGVPQ+EVTF+ID NGIL VSA +K TG +NKITI+ND+ RL+ ++IERMVS+AE++   D+  KERV A+N LESYAY +K  + D EKL  KLS+ DR+ +     + I WLE +Q A+ ++++  +KELE+V  PI++K Y
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEG-EKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTG--DLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 526.939 bits (1356), Expect = 3.810e-177
Identity = 311/610 (50.98%), Postives = 424/610 (69.51%), Query Frame = 2
Query:   95 SQMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEK 1903
            S+  +G  +GIDLGTT SCV V +  + +++ N +G RTTPS VAFT D ERL+G  AK Q   NPNNT +  KRLIGRRF+D+ VQ DM + S+ +V         V+  G  K + P +I + VLLKMKETAE ++G +V +AV+TVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + ++DLGGGTFD+SIL I+ G+FEVKST GDT LGGEDFDN ++ + ++EFKR+   D++ +  A++R+R A E+AK  LSSS Q +I +   Y  +D          +TR++FE +  DL R T+ P +K+L+D ++ K DI +++LVGG TR+PK+Q+ +Q++F G+  +K++NPDEAVA GAA+Q  +L+GD    V D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN  LG+F L G+PPAPRGVPQ+EVTFDIDANGI++VSA +K TG+E +I I +  G LSKD+IE MV  AEKY ++D  +K+RV A N  E   + +++ ME+   KD+L   +   + ++ A+V   L    T   E  +     L++
Sbjct:   48 SEAIRGAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIV-RASNGDAWVEAHG--KMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLP--YLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD----VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEE--FKDQLPADECTKLKEEIAKVRELLTRKDTETGEAIKQAASTLQQ 642          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 280.796 bits (717), Expect = 4.106e-85
Identity = 151/379 (39.84%), Postives = 231/379 (60.95%), Query Frame = 2
Query:  116 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFP-EEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIER-NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSG 1246
            AVG+ LG+T +CV +++ G+ ++IAND G+R TP+ VAF D+E+++G AAK     N   TV   KR++G RFED  VQ  +   S  V+ + G P   ++  G VKK     E+++++L KMKETA   +G +  DAV+T P  F   Q    + A   +G NVLRI++EP AA +A+G+ ++    +  VL++ LGG     + + +  G++ V  +  D  +GGE+F   +  +   EF++ H++D+  N RA+ +L T  E AK  LS+ A +N  +DSL++G+DF  +ITRARF+ L + LF+ +L+P+   L    +   D  ++VL GGS RIPK+Q+LLQ+ F G EL  SI  DE +A GAA +A IL G
Sbjct:    3 AVGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSIN-NGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGILLG 380          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 242.276 bits (617), Expect = 2.802e-71
Identity = 153/422 (36.26%), Postives = 232/422 (54.98%), Query Frame = 2
Query:  119 VGIDLGTTYSCVGVFQHG--KVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQV-DYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKH---------------------KKDISDNKRAVRRLR----------TACERA------KRTLSSSAQANI-----EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSG 1246
            VGIDLGTTY  +GV+  G  +VE++A+  G R  PS VA  +D   L G  A  Q A NP+ T++DAKR IGR F    ++ +   + F V    G     +  + G  +   PE + + +L +++  AE  LG  V  AV+ VPA F++ QR +T  A  ++GL VLR++NEPTAAA+AYGL ++  +  +VL+ DLGGGT DVS+LT + G+F  ++ AG+ HLGG+DF  R+V H       +H                     K +++ N RA   LR            C         +R L +   A++     ++   +  ++   ++TR  FE LN DLF+  +EP+ + LR  ++  K +  +VLVGGSTRIP+++++L D F G E + S++P+ AV  G AVQA +L+G
Sbjct:   34 VGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVS-SVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPELAVVTGVAVQAGVLAG 453          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.322e-6
Identity = 25/69 (36.23%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  995 RARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDE 1201
            R  FE+ +A LF   + PV + L+ A +   ++ +I L+GG  RIPKIQ++L       +L   +N DE
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEMLIQTLQKNDLGVHLNGDE 69          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 457/606 (75.41%), Postives = 524/606 (86.47%), Query Frame = 2
Query:  116 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            AVGIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ A+NP+NTVFDAKRLIGR+F+D  V +D KH+ F V++  G+P +QV+YKGE K F PEEISSMVL KMKETAE YLG  V DAVVTVPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAAIAYGLDKK   E NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFDNR+VNH   EFKRK KKDIS+N+R++RRLRTA ERAKR LSSS+Q +IEIDSL+EG+DFYTS+TRARFEEL ADLFRSTLEPVEK L+D+K+DK  I EIVLVGGSTRIPKIQKL+ D F+GKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK+++TF+TY+DNQPGVLIQV+EGER  T+DNNLLGKFELSGIPPAPRGVPQ++VTFDIDANGILNVSA+EK TGK NKITI+NDKGRLSKDDI+RMVSEAEKY+  DE + ERV AKN LESYA+ +K T+ +   K+K+ E D K +     E I WL+ +Q A  +EY+  QKELE + NPIMTKFY
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFY 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 455/611 (74.47%), Postives = 528/611 (86.42%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            MSK  AVGIDLGTTYSCV  F + +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR+F+D  V +D KH+ F V+ +GG+P +QV+YKGE K F PEEISSM+L KMKETAE +LG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E NVLIFDLGGGTFDVS+L+I++G+FEVK+TAGDTHLGGEDFD+R+VN   +EFKRK+KKD++ N+R++RRLRTA ERAKRTLSSSAQ +IEIDSL+EGIDFYTSITRARFEEL ADLFRSTLEPVEK L D+K+DK  I EIVLVGGSTRIPK+QKL+ D F+GKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RN+TIPTK+++ F+TY+DNQPGVLIQV+EGER  T+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGK NKITI+NDKGRLSK+DI++MV+EAEK+K +DE + +RV AKN LESYA+ +K ++ +   K+K+ E D + +     + I WL+ +Q A  EEY+  QKELE V NPIM+KFY
Sbjct:    1 MSK--AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 465/612 (75.98%), Postives = 534/612 (87.25%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK  AVGIDLGTTYSCV  F + +V+IIANDQGNRTTPS+V FTDTERLIGDAAKNQ AMNP NTVFDAKRLIGR F D  VQ DMKH+ F ++   G+P+IQV++KGE K F PE+ISSMVL KMKETAE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAK+DK  + EIVLVGGSTRIPK+QKL+ D F+GKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK+++ F+TY+DNQPGVLIQV+EGERA T+DNNLLGKFELSGIPPAPRGVPQ+EVTFD+D+NGILNVSAVEK TGK NKITI+NDKGRLSK+DIE+MV+EAEK+K++DE + +R+ +KN LES AY +K T+ +    DKL + D+ A+  K  E I WL+ N TA KEE++   KEL++V NPIM+K YQ
Sbjct:    1 MSK--AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQ 607          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 464/612 (75.82%), Postives = 535/612 (87.42%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSK  AVGIDLGTTYSCV  F + +V+IIANDQGNRTTPS+VAFTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR F D  VQ+DMKH+ F ++   G+P+IQV++KGE K F PE+ISSMVL KMKETAE+YLG  V DAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E +VLIFDLGGGTFDVS+L+IEDGIFEVK+TAGDTHLGGEDFDNR+VNHFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++EIDSL+EGIDFYTSITRARFEEL ADLFRSTL+PVEK LRDAK+DK  + EIVLVGGSTRIPK+QKL+ D F+GKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RN+TIPTK+++ F+TY+DNQPGVLIQV+EGERA T+DNNLLGKFELSGIPPAPRGVPQ+EVTFD+D+NGILNVSAVEK TGK NKITI+NDKGRLSK+DIE+MV+EAEK+K++DE + +R+ +KN LES AY +K T+ +    DKL + D+  +  K  E I WL+ N TA KEE++   KEL+ + NPIM+K YQ
Sbjct:    1 MSK--AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK-GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQ 607          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 378/609 (62.07%), Postives = 482/609 (79.15%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHN-QTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            G  +GIDLGTTYSCV V ++GK EI+AN+QGNR TPSYVAFTD ERLIGDAAKNQVA NP NT+FD KRLIG ++ D SVQ D+KH  F+VV + G+P ++V  KGE K F PEEIS M+L KMK+ AE YLG  VT AVVTVPAYFND+QRQATKDAG I+GLNVLRI+NEPTAAAIAYGLDK    E  ++++DLGGGTFDVS+L+IE+G+FEV++T+GDTHLGGEDFD ++V   I+ FK+KH  D+SDN +A+ +L+   E+AKR LSS     IEIDS  +GID   ++TRA+FEELN DLF+ TL+PVEK L+D+ ++KKD+ +IVLVGGSTRIPK+Q+LL+  F GK+ +K INPDEAVAYGAAVQA +LSG+  E V+D++LLDV  L+LGIET GGVMT LIKRNT IPTK++Q F+T  DNQP V+I+VYEGERAM++DNNLLGKFEL+GIPPAPRGVPQ+EVTF +DANGIL VSA +K TGK   ITI+NDKGRL++++I+RMV EAEK+  +D   K +V ++N LE+YA+ +K  +  + L +KL E D++ ++D   +V+ WL+ N +TA  E+++   + L KV  PI +K Y
Sbjct:   50 GTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLDKS-DKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGE--EGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGD-LGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLY 654          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 507/614 (82.57%), Postives = 571/614 (93.00%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMD--KKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            M+K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  V  DM HW F V+ EG RPKIQV++KGE K FFPEEISSMVL KMKETAEAYLG  VTDAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG+ERNVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HF+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA+IEIDSL+EGIDFYTSITRARFEELN DLF+ T EPVE+++RD+K+   K+ IH+IVLVGGSTRIPKIQK+LQ+LF GKELNKSINPDEAVAYGAAVQAAIL GDK + V+DLLLLDVAPLS+GIETAGGVM+ LIKRN+TIPTKQTQTFTTYSDNQPGVLIQV+EGER+MT  NNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV+EA KYK++DE Q++R+  KN+LESYAY MK+T+ED+K+KDK+SE D+KAI+DKC EV+ WL+ NQTAEK+E+E+HQKELEKVCNPI+TK YQ
Sbjct:    1 MAKTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 499/613 (81.40%), Postives = 562/613 (91.68%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKD-IHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            M+K PA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVAMNP NT+FDAKRLIGRRF+D  V+ DMKHWSF+VV E GRPK++V+YKGE K FF EEISSMVL KMKETAEAYLG  VTDAVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ F+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA+IEIDSLY+GIDFYTSITRARFEE+NA LF+ TLEPVEK+++D+K++ K+ I EIV+VGGSTRIPKIQ LLQ+ F+GKELNKSINPDEAVAYGAAVQAAIL GDKSEA QDLLLLDVAPL+LG+ETAGGVMTA IKRNTTIPTKQTQTFTTYSDNQ  VLIQVYEGER++T+DNNLLGKFELSGIPPAPRGVPQ++VTFD+D+NGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEK+K  DE  +ER+ +KN+LESYA+ MK+TMEDEK+KDKLSE +R+ ++ +C   + WLEHNQ+AEKEE + HQKELE VCNPI+TK YQ
Sbjct:    1 MTKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 454/612 (74.18%), Postives = 537/612 (87.75%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            M K PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA+NP NT+FDAKRLIGRR++DA+VQSDMK W F ++++  +PKIQV+YKGE K F  EEISSMVL KMKETAEAYLG+ VT AV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK +  E+NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHF+ EFKRK+KKD+S N RA+RRLRTACERAKRTLSSS +A+IE+DSL+EGIDFYT I+RARFE+L +DLF S L+PV K+L DAK  K DIHE+VLVGGSTR+PKIQK+L++ F GK LNKSINPDEAVAYGAAVQAAILSGDKS+ V+D+LL+DVAPLSLGIETAG VMT LI+RN  IPTK TQTFTTYSDNQP V I+V+EGER +T+ NNLLGKF+LSGIPPAPRGVPQ+EVTFDIDANGILNVSA +KSTGK   ITI+NDKGRLSK++I+RM+++AEKYK +DE Q+E++ A+N LESYA+ +K+ + +  L+ KLS+ D+  + +K  EV+ WLE N  AEKEE+E  +KEL++VC+PIM K +
Sbjct:    1 MGKAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 391/610 (64.10%), Postives = 489/610 (80.16%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMED-EKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFY 1933
            G  +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+  NP NTVFDAKRLIGR ++D SVQ+D+K + F VV +  +P +QV  K E+K F  EEIS+MVL KMKETAEAYLG+ VT AVVTVPAYFND+QRQATKDAGAI+GL V+RIINEPTAAAIAYG+DKK G E+N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD  ++ HFI+ +K+K  K+I  + RAV++LR   E+AKR LS+  QA +EI+S +EG DF   +TRARFEELNA LF+STL+PV+K L DA + K +IHEIVLVGGSTRIPK+Q+L++D F GKE ++ INPDEAVAYGAAVQA +L G+  E   +++LLDV PL+LGIET GGVMT LI RNT IPTK++Q F+T +DNQ  V IQV+EGER MT+DN+ LGKF+L+GIPPAPRGVPQ+EVTF+ID NGIL VSA +K TG + KITI+ND+ RL+ +DIERMV++AEK+  +D+  KE+V A+N LESYAY +K  + D EKL  KLSE D+K I +   + I W++ NQ A  E+++  +KELE V  PI++K Y
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEG-EKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGE--EDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 518.85 bits (1335), Expect = 3.243e-174
Identity = 316/615 (51.38%), Postives = 430/615 (69.92%), Query Frame = 2
Query:   95 SQMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVV-TEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEH--NQTAE--KEEY-EHHQKELE 1900
            S+  +G   GIDLGTT SCV V      ++I N +G+RTTPS VAFT + ERL+G  A+ Q   NP NT++  KR IGRRF+   ++ D+K+ S+ +V    G    +V   G+V  + P ++ + VL+KMKETAE+YLG NV +AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYG+DK    ++ + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++   I EFK++   D+S +  A++RLR A E+AK  LSSS Q +I +   Y  +D          ++R++FE L ADL   T+ P +K L+DA+++K +I +++LVGG TR+PK+Q+ +QD+F G+  +K++NPDEAVA GAA+Q  +L+GD    V+D+LLLDV PLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F+L GIPPAPRGVPQVEVTFDIDANGI+NVSA +K TG+E +I I +  G LSKD IE M+ EAEKY + D+ +KE   A N  E   +  +  ME+   KD+L   + + + ++ A+V   L +  N+T E  ++ Y E  QK L+
Sbjct:    7 SESVRGAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNGDAWFEV--AGKV--YSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTE--DKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLP--YITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEE--FKDQLPSEEVEKLKEEIAKVREVLANKDNETGETIRQAYSELQQKSLK 605          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 535/612 (87.42%), Postives = 579/612 (94.61%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NPNNTVFDAKRLIGRRF+D+ VQSDMKHW F V+ +  RPK++V+YKGE K F+PEEISSMVL+KMKE AEAYLG+ VT+AVVTVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTY+DNQPGVLIQV+EGERAMT+DNNLLGKF+L+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+E+V+AKN LESYA+ MK+T+E+EKLKDK+SE DRK I+DKC EVI WL+ NQ+AEKEE+EH QKELEKVCNPIMTK YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEEEKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 534/618 (86.41%), Postives = 576/618 (93.20%), Query Frame = 2
Query:   83 TFALSQMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            T     MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKL  K+S+ D++ I+DKC EVI WL+ NQTAE++EYEH QKELEKVCNPI+TK YQ
Sbjct:   45 TICFGSMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 662          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 1027.31 bits (2655), Expect = 0.000e+0
Identity = 526/606 (86.80%), Postives = 569/606 (93.89%), Query Frame = 2
Query:  119 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            +GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D  VQSDMKHW F+V+ +  RPK+QV+YKGE K F+PEEISSMVL KMKE AEAYLG+ V +AV+TVPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFI EFKRK+KKDISDNKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG+DFYTSITRARFEELNADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKIQKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGI+NVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAEKYK +D++Q+++V+AKN LESYA+ MK+T+EDEKL  K+S+ D++ I+DKC EVI WL+ NQTAE++EYEH QKELEKVCNPI+TK YQ
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLYQ 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 520/612 (84.97%), Postives = 576/612 (94.12%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+DA VQSDMKHW F VV +  +PK++V+YKGE+K F+PEEISSMVL KMKE +EAYLG++VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG DFYTSITRARFEELNADLFR T+EPVEK+LRDAKMDK  IH++VLVGGSTRIPKIQKLLQDLF+G++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNN+LGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAE++K +DE Q++++TAKN+LES A+ MK+T++DEKL+DK+S  D+K IVDKC E+I WL+ NQ AEK+EYEH QKELEKVCNPI++K YQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 513/607 (84.51%), Postives = 571/607 (94.07%), Query Frame = 2
Query:  116 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            ++GIDLGTTYSCVG+FQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+DA VQSDMKHW F VV +  +PK++V+YKGE+K F+PEEISSMVL KMKE +EAYLG++VT+AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVK+TAGDTHLGGEDFDNRMVNHFI EFKRK KK+I++NKRAVRRLRTACERAKRTLSSS QA+IEIDSLYEG DFYTSITRARFEELNADLFR T+EPVEK+LRDAKMDK  IH++VLVGGSTRIPKIQKLLQDLF+G++LNKSINPDEAVAYGAAVQAAIL+GDKSE VQDLLLLDV PLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT+DNN+LGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAV+KSTGKENKITI+NDKGRLSK+DIERMV EAE++K +DE Q++++TAKN+LES A+ MK+T++DEKL+DK+S  D+K IVDKC E+I WL+ NQ AEK+EYEH QKELEKVCNPI++K YQ
Sbjct:   23 SLGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLYQ 629          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000040632.1 (SMESG000040632.1)

HSP 1 Score: 1179.47 bits (3050), Expect = 0.000e+0
Identity = 612/612 (100.00%), Postives = 612/612 (100.00%), Query Frame = 2
Query:  101 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 612          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 550/609 (90.31%), Postives = 583/609 (95.73%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+F+++SVQSDMKHWSFDV+ E GRPKI+V++KGE K FFPEEISSMVL+KMKE AEAYLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGKENKITI+NDKGRLSKDDIERMV+EAEKYK++DE QK+R+  KN+LESYAYQMK+T+EDEKLKDK+SE DRK I+DKC E I WLE NQ A KEE+E+H KELEK+CNPIMTK YQ
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 550/609 (90.31%), Postives = 583/609 (95.73%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+F+++SVQSDMKHWSFDV+ E GRPKI+V++KGE K FFPEEISSMVL+KMKE AEAYLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGKENKITI+NDKGRLSKDDIERMV+EAEKYK++DE QK+R+  KN+LESYAYQMK+T+EDEKLKDK+SE DRK I+DKC E I WLE NQ A KEE+E+H KELEK+CNPIMTK YQ
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 550/609 (90.31%), Postives = 583/609 (95.73%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+F+++SVQSDMKHWSFDV+ E GRPKI+V++KGE K FFPEEISSMVL+KMKE AEAYLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGKENKITI+NDKGRLSKDDIERMV+EAEKYK++DE QK+R+  KN+LESYAYQMK+T+EDEKLKDK+SE DRK I+DKC E I WLE NQ A KEE+E+H KELEK+CNPIMTK YQ
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 1069.3 bits (2764), Expect = 0.000e+0
Identity = 550/609 (90.31%), Postives = 583/609 (95.73%), Query Frame = 2
Query:  110 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEXXXXXXXXXXXILSGDKSEAVQDXXXXXXXXXXXGIETAGGVMTALIKRNXXXXXXXXXXXXXYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQ 1936
            G A+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGR+F+++SVQSDMKHWSFDV+ E GRPKI+V++KGE K FFPEEISSMVL+KMKE AEAYLG+ V DAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVG ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQAN+EIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEK+LRDAK+DK  IH+IVLVGGSTRIPKIQKLLQDLF+GKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQ FTTYSDNQPGVLIQVYEGERAMT+DNNLLGKFEL+GIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGKENKITI+NDKGRLSKDDIERMV+EAEKYK++DE QK+R+  KN+LESYAYQMK+T+EDEKLKDK+SE DRK I+DKC E I WLE NQ A KEE+E+H KELEK+CNPIMTK YQ
Sbjct:    3 GNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMYQ 611          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA80.000e+087.58heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+087.58heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+087.58heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+084.50heat shock protein family A (Hsp70) member 2 [Sour... [more]
HSPA20.000e+084.50heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-10.000e+085.15Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+085.15Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.50.000e+071.13pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.50.000e+071.13pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.40.000e+071.13pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-40.000e+083.66gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+087.58heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.58heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.58heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.58heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+087.58heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr260.000e+087.79WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.64WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.91WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.91WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+087.85WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa80.000e+087.58heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+084.34heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+084.34heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa80.000e+084.80heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1l0.000e+082.98heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63018|HSP7C_RAT0.000e+087.58Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
sp|P63017|HSP7C_MOUSE0.000e+087.58Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
sp|Q71U34|HSP7C_SAGOE0.000e+087.58Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
sp|Q5NVM9|HSP7C_PONAB0.000e+087.58Heat shock cognate 71 kDa protein OS=Pongo abelii ... [more]
sp|P11142|HSP7C_HUMAN0.000e+087.58Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LVF70.000e+096.24Heat shock protein 70 OS=Dugesia japonica OX=6161 ... [more]
G1EHI20.000e+088.24Heat shock protein 70 OS=Acipenser ruthenus OX=790... [more]
M4VMY60.000e+087.91Heat shock cognate 70 kDa protein OS=Clarias batra... [more]
A0A0C5BIF30.000e+088.24Heat shock protein 70 OS=Huso dauricus OX=55293 GN... [more]
A0A3G2LMQ60.000e+088.07Heat shock protein OS=Acipenser oxyrinchus oxyrinc... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+087.09heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
ENSAMXT00000004733.20.000e+086.60pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
hspa8b0.000e+087.09heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hsc700.000e+086.60heat shock cognate 71 kDa protein-like [Source:NCB... [more]
hspa1b0.000e+083.33heat shock protein family A (Hsp70) member 1B [Sou... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+065.14heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa93.810e-17750.98heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa144.106e-8539.84heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa132.802e-7136.26heat shock protein 70 family, member 13 [Source:ZF... [more]
ENSPMAT00000003663.16.322e-636.23pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA30.000e+075.41ATPase involved in protein folding and the respons... [more]
SSA40.000e+074.47Heat shock protein that is highly induced upon str... [more]
SSA20.000e+075.98HSP70 family ATP-binding protein; involved in prot... [more]
SSA10.000e+075.82ATPase involved in protein folding and NLS-directe... [more]
KAR20.000e+062.07ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372800.000e+082.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+081.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+074.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332960.000e+064.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477233.243e-17451.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+087.42heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsc700.000e+086.41heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc700.000e+086.80heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-30.000e+084.97heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsp70-30.000e+084.51heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040632.10.000e+0100.00SMESG000040632.1[more]
SMESG000051570.10.000e+090.31SMESG000051570.1[more]
SMESG000051567.10.000e+090.31SMESG000051567.1[more]
SMESG000051541.10.000e+090.31SMESG000051541.1[more]
SMESG000051540.10.000e+090.31SMESG000051540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018637 ID=SMED30018637|Name=Heat shock cognate 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2686bp
ATTGTTTTGTCGTATCAAATGATCATTTTCGCTAGGAAATGTTAATATTG
ATATTTAAACTCAATTCCACCATTTAATTTTCACTTTCGCTTTATCCCAA
ATGTCTAAAGGACCAGCAGTCGGCATCGATCTAGGAACTACTTATTCCTG
TGTAGGAGTTTTTCAACACGGAAAAGTTGAAATAATTGCAAATGACCAAG
GAAACAGAACTACTCCTTCATATGTTGCATTTACCGATACAGAAAGACTT
ATTGGAGATGCTGCAAAAAATCAAGTAGCAATGAATCCCAACAATACGGT
TTTCGATGCCAAAAGACTAATCGGAAGACGATTTGAAGATGCATCTGTAC
AAAGTGATATGAAACATTGGTCCTTTGATGTTGTTACTGAAGGAGGTAGG
CCCAAAATTCAAGTTGATTACAAAGGGGAAGTGAAAAAGTTTTTCCCCGA
GGAAATTTCATCGATGGTTTTATTGAAAATGAAAGAAACTGCAGAAGCTT
ATTTAGGAAGAAATGTGACTGATGCCGTTGTTACTGTGCCAGCATATTTC
AATGATAGTCAGCGACAAGCTACCAAGGATGCAGGTGCCATTAGTGGATT
GAATGTGTTGAGAATTATAAATGAGCCAACTGCAGCAGCAATTGCATACG
GTTTGGATAAGAAAGTTGGAATTGAACGCAATGTTCTCATCTTTGACCTT
GGAGGAGGAACTTTTGATGTATCGATTTTAACTATTGAAGATGGAATTTT
CGAAGTAAAATCTACAGCTGGGGACACACATTTGGGTGGTGAGGACTTTG
ATAATCGAATGGTGAATCACTTTATTCAGGAATTCAAAAGAAAGCACAAA
AAAGATATAAGTGATAACAAGCGAGCTGTGCGTCGTCTGCGTACAGCGTG
TGAACGTGCCAAGAGAACATTAAGTTCCAGTGCTCAAGCTAATATTGAAA
TCGACTCTTTGTATGAAGGAATTGATTTCTATACATCAATTACACGGGCC
AGATTCGAGGAGTTGAATGCGGATTTGTTTCGGTCAACATTGGAACCGGT
GGAGAAATCGTTGAGAGATGCAAAAATGGACAAAAAAGATATCCACGAAA
TTGTACTTGTTGGCGGGTCGACTCGAATTCCTAAAATTCAAAAGCTGTTA
CAAGATTTATTTCATGGAAAAGAATTGAATAAATCGATAAATCCTGATGA
AGCCGTTGCCTACGGCGCTGCAGTGCAAGCTGCTATTCTATCTGGGGATA
AATCAGAAGCTGTTCAAGATCTGTTGTTGTTGGACGTTGCACCTTTGAGT
CTGGGTATCGAGACTGCTGGTGGCGTCATGACAGCTCTCATCAAGCGTAA
CACGACAATTCCTACCAAACAAACGCAAACATTTACCACTTACTCAGATA
ACCAACCGGGCGTCCTCATTCAGGTTTACGAGGGCGAACGTGCGATGACG
CGTGATAATAATTTACTGGGGAAATTTGAATTGTCTGGAATTCCTCCCGC
GCCCCGTGGAGTGCCTCAAGTTGAGGTAACGTTTGATATCGACGCAAACG
GAATTTTGAATGTCTCTGCTGTTGAGAAAAGTACCGGCAAAGAGAATAAG
ATCACAATTTCTAATGACAAAGGCCGGTTATCAAAGGATGACATCGAACG
GATGGTGTCAGAGGCGGAGAAATATAAGCAGCAAGATGAGCTGCAGAAAG
AGCGGGTAACTGCTAAGAATGCATTGGAAAGCTATGCGTATCAGATGAAA
GCAACGATGGAAGACGAGAAATTAAAGGATAAATTGTCAGAACCGGATCG
AAAGGCAATTGTGGACAAATGCGCTGAAGTTATTGGCTGGCTAGAGCACA
ATCAGACGGCGGAAAAGGAGGAATACGAGCACCATCAGAAGGAATTGGAG
AAAGTTTGCAACCCAATAATGACAAAATTCTATCAAGCATCTGGTGGAAT
GCCGGGTGGATTCCCTGGTGCTCCTGGGACTGGTCAGGCGCCACCTGGGG
CTCCGGGTTCTGGACAAGGCCCGACAATAGAGGAGGTCGATTAAATGTTG
GTTAATTTAGGATTTACATTAAAAATCGAATGATTTCTAGTAGTTAAAAA
ATAAATGTGGACTTAATTGTGTTCGATTTTTTTGGCGGCTTTAATGTAAT
TTCGTATGCCGACCAGATTGTGTAATTGAATAATGCGTTGCATTGGATGA
ATTACGGTCAAAATATGAGTTTTGCACTTTGTAGTATCCATTGTGCACTT
TTATGTCACTAAAATTGTTAGATAAAGTTCAATCTTTGTTAATGAATGAC
TCGTTAAGCCCGCGATTTGATTGGTCCATTTGCAGGTTAATTTGGCATGT
CATGACTAATAAACGCCAACATTAAATTATATTTGTATTCAAGAATTTCA
AATTCATAGTTGATTTCGTAGCATACGAAAACTATTTTATACGTTGTTGA
ATTTGGACTGACGTGGCATTGGTGGTCGCCTGCTTTAATTGTAAGTGGTT
TACAAACTCTAGAATGAAATTTTCTCTGTCGCTATTTCTGGTAAAAGCAA
TTCTGTTGGACTGGGTCAAATATGAAGCAGGCTGTATTTTAAATAATTGA
TAATTATTTAATTTAAACTATTAAATCAATGCCTATCCCCCTATTTGTGG
TGCCCTTTCTTATATTACTATGTTATCATTGCACTT
back to top

protein sequence of SMED30018637-orf-1

>SMED30018637-orf-1 ID=SMED30018637-orf-1|Name=SMED30018637-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
IGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGR
PKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYF
NDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDL
GGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHK
KDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRA
RFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLL
QDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLS
LGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMT
RDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENK
ITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMK
ATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELE
KVCNPIMTKFYQASGGMPGGFPGAPGTGQAPPGAPGSGQGPTIEEVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: biological process
TermDefinition
GO:0009408response to heat
GO:0046686response to cadmium ion
GO:0046688response to copper ion
GO:1903842response to arsenite ion
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
IPR019651Glutamate_DH_NAD-spec
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0042470melanosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 363..383
score: 81.87
coord: 55..63
score: 76.1
coord: 142..162
score: 93.1
coord: 471..487
score: 81.11
coord: 390..409
score: 84.67
coord: 33..45
score: 85.18
coord: 203..213
score: 81.05
coord: 5..18
score: 81.55
coord: 331..347
score: 77.38
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 7..378
e-value: 7.2E-181
score: 602.7
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 229..306
e-value: 7.2E-181
score: 602.7
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 68..114
e-value: 7.2E-181
score: 602.7
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 188..365
e-value: 7.2E-181
score: 602.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 617..647
NoneNo IPR availablePANTHERPTHR19375:SF407HEAT SHOCK COGNATE 71 KDA PROTEIN-RELATEDcoord: 2..622
NoneNo IPR availableCDDcd10233HSPA1-2_6-8-like_NBDcoord: 6..381
e-value: 0.0
score: 879.753
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 510..613
e-value: 2.0E-38
score: 132.7
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 538..618
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 6..612
e-value: 2.8E-261
score: 868.0
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 2..622
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 381..509
e-value: 2.9E-66
score: 223.0
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 387..543
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 197..210
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 9..16
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 334..348
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 6..187
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 192..382