Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30018632
Length (bp)1777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30018632) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30018632) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30018632) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30018632) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018632SMESG000017261.1 SMESG000017084.1 Contig3842newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018632SMESG000017261.1 SMESG000017084.1 Contig3842uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018632SMESG000009012.1 Contig3842newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018632SMESG000009012.1 Contig3842uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018632SMESG000017261.1 dd_Smed_v4_2030_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 160.229 bits (404), Expect = 1.787e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  358 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 160.229 bits (404), Expect = 1.919e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 160.614 bits (405), Expect = 2.270e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  389 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 644          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 160.229 bits (404), Expect = 2.567e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 648          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 160.229 bits (404), Expect = 2.567e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  393 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 648          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.918 bits (398), Expect = 4.607e-41
Identity = 101/262 (38.55%), Postives = 141/262 (53.82%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F K   IG G+FG VYK   +    V A+K I+L++    ++ I++ I + L + + Q + KYFG+      L I MEYL  GS  D  K  + L   +I    ++IL+GLE+LH    IHRDIK  N+L+S   ++K+ DFGV+  L  T   V K  T +G+P + APE+   S     Y   ADIWSLG T I +  G PP+ D HP  V   I       L  SQ  SK  KEF++  L+ DP+ R +A+ LLK +  
Sbjct:   14 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTET---VKKRITFVGSPFWMAPELIKQSS----YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.918 bits (398), Expect = 5.023e-41
Identity = 101/262 (38.55%), Postives = 141/262 (53.82%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F K   IG G+FG VYK   +    V A+K I+L++    ++ I++ I + L + + Q + KYFG+      L I MEYL  GS  D  K  + L   +I    ++IL+GLE+LH    IHRDIK  N+L+S   ++K+ DFGV+  L  T   V K  T +G+P + APE+   S     Y   ADIWSLG T I +  G PP+ D HP  V   I       L  SQ  SK  KEF++  L+ DP+ R +A+ LLK +  
Sbjct:   19 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTET---VKKRITFVGSPFWMAPELIKQSS----YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.918 bits (398), Expect = 6.162e-41
Identity = 101/262 (38.55%), Postives = 141/262 (53.82%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F K   IG G+FG VYK   +    V A+K I+L++    ++ I++ I + L + + Q + KYFG+      L I MEYL  GS  D  K  + L   +I    ++IL+GLE+LH    IHRDIK  N+L+S   ++K+ DFGV+  L  T   V K  T +G+P + APE+   S     Y   ADIWSLG T I +  G PP+ D HP  V   I       L  SQ  SK  KEF++  L+ DP+ R +A+ LLK +  
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTET---VKKRITFVGSPFWMAPELIKQSS----YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 157.147 bits (396), Expect = 2.592e-40
Identity = 101/262 (38.55%), Postives = 141/262 (53.82%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F K   IG G+FG VYK   +    V A+K I+L++    ++ I++ I + L + + Q + KYFG+      L I MEYL  GS  D  K  + L   +I    ++IL+GLE+LH    IHRDIK  N+L+S   ++K+ DFGV+  L  T   V K  T +G+P + APE+   S     Y   ADIWSLG T I +  G PP+ D HP  V   I       L  SQ  SK  KEF++  L+ DP+ R +A+ LLK +  
Sbjct:  184 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTET---VKKRITFVGSPFWMAPELIKQSS----YDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 435          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 155.992 bits (393), Expect = 2.611e-40
Identity = 102/263 (38.78%), Postives = 141/263 (53.61%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNN-IKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F K   IG G+FG VYK   +    V A+K I+L++    ++ I++ I + L + + Q + KYFG+      L I MEYL  GS  D  K  + L   +I    ++IL+GLE+LH    IHRDIK  N+L+      +KI D+GV++ L      V KA T +GTP F APEV         Y++ ADIWSLG T I +  G PP+ D HP  V   I       L  SQ  SK  KEF++  L+ DP+ R +A+ LLK +  
Sbjct:   14 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEI-QVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPL----DTVLKANTFVGTPFFMAPEVVKGE-----YSIEADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQ-WSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333364)

HSP 1 Score: 155.606 bits (392), Expect = 2.230e-39
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +G+G +G VYK + +    + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + MEY  AGS+ D +K  + +SL  E I    ++IL GL +LH N +IHRDIK  N+L+++   +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y   +D+WSLG T + M   +PP CD HP      I       L  S+  SK+   FID +L  D  QR     LLK
Sbjct:   38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072956)

HSP 1 Score: 155.606 bits (392), Expect = 2.437e-39
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +G+G +G VYK + +    + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + MEY  AGS+ D +K  + +SL  E I    ++IL GL +LH N +IHRDIK  N+L+++   +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y   +D+WSLG T + M   +PP CD HP      I       L  S+  SK+   FID +L  D  QR     LLK
Sbjct:   38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333365)

HSP 1 Score: 155.221 bits (391), Expect = 2.494e-39
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +G+G +G VYK + +    + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + MEY  AGS+ D +K  + +SL  E I    ++IL GL +LH N +IHRDIK  N+L+++   +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y   +D+WSLG T + M   +PP CD HP      I       L  S+  SK+   FID +L  D  QR     LLK
Sbjct:   38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0072957)

HSP 1 Score: 155.221 bits (391), Expect = 2.494e-39
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +G+G +G VYK + +    + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + MEY  AGS+ D +K  + +SL  E I    ++IL GL +LH N +IHRDIK  N+L+++   +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y   +D+WSLG T + M   +PP CD HP      I       L  S+  SK+   FID +L  D  QR     LLK
Sbjct:   38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: msn (gene:FBgn0010909 transcript:FBtr0333362)

HSP 1 Score: 155.221 bits (391), Expect = 2.655e-39
Identity = 97/260 (37.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +G+G +G VYK + +    + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + MEY  AGS+ D +K  + +SL  E I    ++IL GL +LH N +IHRDIK  N+L+++   +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y   +D+WSLG T + M   +PP CD HP      I       L  S+  SK+   FID +L  D  QR     LLK
Sbjct:   38 VGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNIATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDENPDATYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVKDYHQRPYTENLLK 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 163.31 bits (412), Expect = 8.479e-43
Identity = 99/267 (37.08%), Postives = 149/267 (55.81%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K +            V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ + +  +   R +A +LL+
Sbjct:  343 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFL-RCIFVEAKYRPSAEELLR 600          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 163.31 bits (412), Expect = 1.135e-42
Identity = 99/267 (37.08%), Postives = 149/267 (55.81%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K +            V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ + +  +   R +A +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFL-RCIFVEAKYRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 162.925 bits (411), Expect = 1.285e-42
Identity = 99/267 (37.08%), Postives = 149/267 (55.81%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K +            V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ + +  +   R +A +LL+
Sbjct:  361 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFL-RCIFVEAKYRPSAEELLR 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 158.688 bits (400), Expect = 3.909e-41
Identity = 101/263 (38.40%), Postives = 147/263 (55.89%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQT--EDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            G  +G GAFG V+ C  +      AVK ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG SR L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T RPP+ +    A   KI T      LP    +S   ++F+ ++   +  QR  A  LL+
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVI--SGEG--YGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLP--PHVSDHCRDFLKRIFV-ETKQRPAAEDLLR 618          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 158.688 bits (400), Expect = 4.489e-41
Identity = 101/263 (38.40%), Postives = 147/263 (55.89%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQT--EDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            G  +G GAFG V+ C  +      AVK ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG SR L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T RPP+ +    A   KI T      LP    +S   ++F+ ++   +  QR  A  LL+
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVI--SGEG--YGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLP--PHVSDHCRDFLKRIFV-ETKQRPAAEDLLR 610          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 165.236 bits (417), Expect = 3.305e-43
Identity = 100/266 (37.59%), Postives = 152/266 (57.14%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQT--EDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H RI++Y+G+++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP   + S++ ++F+ ++L  +  QR TA +L++
Sbjct:  365 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPP--NTSEQCRDFVKRIL-VEARQRPTAEELIR 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 164.851 bits (416), Expect = 3.710e-43
Identity = 100/266 (37.59%), Postives = 152/266 (57.14%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQT--EDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H RI++Y+G+++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP   + S++ ++F+ ++L  +  QR TA +L++
Sbjct:  347 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPP--NTSEQCRDFVKRIL-VEARQRPTAEELIR 603          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 157.532 bits (397), Expect = 1.262e-40
Identity = 95/270 (35.19%), Postives = 152/270 (56.30%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENIN------KFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFH 1403
            G  +G GAFG VY C  +      AVK ++     ++  +E +N      + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L      +Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +   R ++ +LL+   F+++H
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKE-VNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI--SGEG--YGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLP--AHVSEHCRDFLKRIFV-EAKVRPSSEELLR-HTFAQYH 602          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 157.532 bits (397), Expect = 1.489e-40
Identity = 95/270 (35.19%), Postives = 152/270 (56.30%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENIN------KFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFH 1403
            G  +G GAFG VY C  +      AVK ++     ++  +E +N      + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L      +Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +   R ++ +LL+   F+++H
Sbjct:  370 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDSLETSKE-VNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI--SGEG--YGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLP--AHVSEHCRDFLKRIF-VEAKVRPSSEELLR-HTFAQYH 630          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 154.066 bits (388), Expect = 2.383e-40
Identity = 102/284 (35.92%), Postives = 147/284 (51.76%), Query Frame = 3
Query:  546 MGLKCKSFCNH--RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            M L+  SF +   +L   SL K+    FD   ++G G++G V+K        V A+K + ++    + I+E     + + +   ++KY+G+      L I MEY  AGS+ D I+ R ++L  E I    +  L+GLE+LH    IHRDIK  NIL++   + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T         +  S E  +F+ K L  +P+QR+TA QLL+
Sbjct:    1 MCLRFFSFISKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEI--SIMQQCDSHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQ 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 159.458 bits (402), Expect = 2.875e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 155.992 bits (393), Expect = 3.953e-40
Identity = 100/271 (36.90%), Postives = 151/271 (55.72%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENIN------KFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFH 1403
            G  +G GAFG VY C         AVK ++      +  +E +N      + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  NIK+ DFG S+ L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+  TV+ M+T +PP+ +    A   KI T      LP    +S   ++F+ ++   +   R +A +LL+  +F  +H
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKE-VNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVI--SGEG--YGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLP--PHVSDYTRDFLKRIFV-EAKLRPSAEELLR-HMFVHYH 619          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 149.443 bits (376), Expect = 1.451e-38
Identity = 97/271 (35.79%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  579 RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +L   SL K+    FD   ++G G++G V+K        V A+K + ++    + I+E     + + +   ++KY+G+      L I MEY  AGS+ D I+ R ++L  + I    K  L+GLE+LH    IHRDIK  NIL++   + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T         +  S +  +F+ K L   P+QR+TA QLL+
Sbjct:   11 KLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEI--SIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQ 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 149.058 bits (375), Expect = 2.505e-38
Identity = 97/271 (35.79%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  579 RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +L   SL K+    FD   ++G G++G V+K        V A+K + ++    + I+E     + + +   ++KY+G+      L I MEY  AGS+ D I+ R ++L  + I    K  L+GLE+LH    IHRDIK  NIL++   + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T         +  S +  +F+ K L   P+QR+TA QLL+
Sbjct:   13 KLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEI--SIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQ 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk10 (serine/threonine kinase 10 [Source:MGI Symbol;Acc:MGI:1099439])

HSP 1 Score: 152.525 bits (384), Expect = 2.704e-38
Identity = 95/259 (36.68%), Postives = 140/259 (54.05%), Query Frame = 3
Query:  627 EIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKL------NHQRIIKYFGAIQTEDHLCIFMEYLSAGSLED-EIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFL-TSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            E+G GAFG VYK K      + A K IE K       EE +  ++ ++      +H  I+K  GA   +  L I +E+   G+++   ++  R L    I    +Q+LE L FLHG  IIHRD+K  N+LM+   +I++ DFGVS   L+T   + K ++ IGTP + APEV L  + +  PY   ADIWSLG T+I M    PP+ + +P  V +KI  +    L      S E ++F+   LD +P+ R +AAQLL+
Sbjct:   41 ELGDGAFGKVYKAKNKETGALAAAKVIETKS------EEELEDYIVEIEILATCDHPYIVKLLGAYYYDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKT---LQKRDSFIGTPYWMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLQ 290          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O22042|M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.477e-41
Identity = 96/275 (34.91%), Postives = 149/275 (54.18%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWI---------ELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            + KG  IG GAFG VY         + A+K +         E  +  ++ +EE + + L  L+H  I++Y G ++  D L I ME++  GS+   +++  S     II Y+KQ+L GLE+LH N I+HRDIK  NIL+ N   I++ DFG S+ ++     V  A++  GTP + APEV L +     ++ SADIWS+G TVI M TG+PP+ + +     V  +   K   P  + +S E K+F+ K L  +P  R +A +LL+    +   Q+
Sbjct:   68 WRKGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEV-QLLKNLSHPNIVRYLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGANILVDNKGCIRLADFGASKKVVE-LATVNGAKSMKGTPYWMAPEVILQTG----HSFSADIWSVGCTVIEMATGKPPWSEQYQQFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELLQHPFVTGKRQE 336          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 4.379e-41
Identity = 97/264 (36.74%), Postives = 141/264 (53.41%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIE--ENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGV-----SRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            G +IG GAFG V+K          A+K I+  KI    ++  +   + L KL H  I+K  G ++ +  L   +EY+  GSL D I++   L+ E  I Y  Q+L+GL +LH N +IHRDIK  NIL++    IK+ DFGV     S S LR         + +GTP + APE    S E    + ++DIWSLG+T+I ++TG PPY    P A   +IV+ +    P    +SKE  ++  +    DP QR TA +LL+  +F
Sbjct:   39 GEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEVEILHKLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCIIYLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQIDSESQLRF--------SVVGTPYWMAPE----SIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHPPFPT--DISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q40541|NPK1_TOBAC (Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.666e-41
Identity = 96/275 (34.91%), Postives = 147/275 (53.45%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG---------VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            + KG  IG GAFG VY         + A+K + +   G         V+ +EE +N  L  L+H  I++Y G  +    L I +E++  GS+   + +  S     I  Y+KQ+L GLE+LH N I+HRDIK  NIL+ N   IK+ DFG S+ ++     +T A++  GTP + APEV L +     ++ SADIWS+G T+I M TG+PP+   +     +  + T K   P  + +S E K+F+ K L  +P  R +A+ LL+    +  HQ+
Sbjct:   80 WRKGEMIGCGAFGRVYMGMNVDSGELLAIKEVSIAMNGASRERAQAHVRELEEEVN-LLKNLSHPNIVRYLGTAREAGSLNILLEFVPGGSISSLLGKFGSFPESVIRMYTKQLLLGLEYLHKNGIMHRDIKGANILVDNKGCIKLADFGASKKVVE-LATMTGAKSMKGTPYWMAPEVILQTG----HSFSADIWSVGCTIIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPEHLSAESKDFLLKCLQKEPHLRHSASNLLQHPFVTAEHQE 348          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 9.213e-41
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.011e-40
Identity = 98/265 (36.98%), Postives = 148/265 (55.85%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + +G  +G GAFG VY C         A K ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TE++ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T      LP    +S+  ++F+ ++   +  QR +A +LL
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEI-QLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIF-VEARQRPSAEELL 617          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 7.936e-60
Identity = 137/364 (37.64%), Postives = 205/364 (56.32%), Query Frame = 3
Query:  288 NGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA-IKNQNXXXXXXXXXXXXXXXXXMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            N D+ K+  + +GAAI   D     PIH AC+  NI+  + L++  CD+   DK   SPL IA   +    +  + + + + +    M LKC   CNH+ C TS ++K       I SG++G V+    SG D  FAVK I  + I  + IE NIN F   L H+RI+K+FGA   +++  IFMEYL   +L+ +  +K+S    +++ ++KQILE L FLH  +IIHRDIKP+N+L+    N+K++DFG+S  L     ++ K     GT  + APE+         YT S DIWSLGAT+I + TG+PPY +    A+   I TT++++    + M K +   ID ML+ D  +R +A +LL
Sbjct:  584 NNDIVKL-LIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLD--TLQKKKYQKKSPG--DLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEIL----NAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A453KR49 (Protein kinase domain-containing protein OS=Aegilops tauschii subsp. strangulata OX=200361 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.211e-47
Identity = 107/268 (39.93%), Postives = 157/268 (58.58%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDT--VFAVKWI---------ELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKL 1382
            + KG  IGSGAFG VY   G  +DT  + AVK +         E  +  ++ +EE + K L  L+H  I++Y G ++ ED L I +E++  GS++  + +  S     I +Y++QIL+GLE+LH N IIHRDIK  NIL+ N   IK+ DFG S+ + +    +T A+T  GTP++ APEV +    G  +T SADIWS+G TVI M TG+PP+   +     +  V T K   P  + +S E K+F+ K L  +P+ RS+A+ LLK 
Sbjct:  102 WRKGEMIGSGAFGQVYL--GMNLDTGELLAVKQVLIGSTNATREKAQAHIRELEEEV-KLLKNLSHPNIVRYLGTVREEDTLNILLEFVPGGSIQSLLGKLGSFPEAVIRKYTRQILQGLEYLHSNAIIHRDIKGANILVDNKGCIKLADFGASKQVAK-LATMTAAKTMKGTPHWMAPEVIV----GSGHTFSADIWSVGCTVIEMATGKPPWSQQYQEVALLFHVGTTKSHPPIPEHISPEAKDFLLKCLQKEPELRSSASDLLKF 361          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: K1PKP1 (Mitogen-activated protein kinase kinase kinase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10008499 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.828e-47
Identity = 108/279 (38.71%), Postives = 152/279 (54.48%), Query Frame = 3
Query:  576 HRLCNTSLRKK-----TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            + L + SL K       +  G+ +GSGAFG VY C         A+K + L+++       V+ +E  I+  L    H+RI+ YFG  Q +  L IFMEYL  GS++DEI +  SL TEN+ R Y+KQ+LEGL +LH N I+HRDIK  NIL     NIK+ DFG S+  L+T  + T   + +GTP + APEV      G  Y   ADIWS+G T++ M+T +PP+ +    A   KI   K+        +S+   + + K  D +P  R TA  LL
Sbjct:   47 YALADLSLSKSPRCPVNWKAGALLGSGAFGEVYVCHDKDTGRDLAMKVVRLEQMNAETSKEVRALENEIH-LLRNFEHERIVSYFGCAQDKQSLYIFMEYLPGGSVKDEITKYGSL-TENVSRKYTKQMLEGLAYLHKNVIVHRDIKGANILRDGNGNIKLGDFGASKR-LQTIVSATGLHSVVGTPYWMAPEVI----NGEGYGRKADIWSVGCTIVEMLTTKPPWAEFESMAALYKIAMEKRPHFTLPNHISELCHDVLSKAFDRNPSTRPTAIDLL 318          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A453KR43 (Protein kinase domain-containing protein OS=Aegilops tauschii subsp. strangulata OX=200361 PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.864e-47
Identity = 107/267 (40.07%), Postives = 157/267 (58.80%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDT--VFAVKWI---------ELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            + KG  IGSGAFG VY   G  +DT  + AVK +         E  +  ++ +EE + K L  L+H  I++Y G ++ ED L I +E++  GS++  + +  S     I +Y++QIL+GLE+LH N IIHRDIK  NIL+ N   IK+ DFG S+ + +    +T A+T  GTP++ APEV +    G  +T SADIWS+G TVI M TG+PP+   +     +  V T K   P  + +S E K+F+ K L  +P+ RS+A+ LLK
Sbjct:   87 WRKGEMIGSGAFGQVYL--GMNLDTGELLAVKQVLIGSTNATREKAQAHIRELEEEV-KLLKNLSHPNIVRYLGTVREEDTLNILLEFVPGGSIQSLLGKLGSFPEAVIRKYTRQILQGLEYLHSNAIIHRDIKGANILVDNKGCIKLADFGASKQVAK-LATMTAAKTMKGTPHWMAPEVIV----GSGHTFSADIWSVGCTVIEMATGKPPWSQQYQEVALLFHVGTTKSHPPIPEHISPEAKDFLLKCLQKEPELRSSASDLLK 345          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A210PFZ5 (Mitogen-activated protein kinase kinase kinase 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24565 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.092e-46
Identity = 100/266 (37.59%), Postives = 149/266 (56.02%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKL 1388
            + KG  +GSG+FG V+ C         AVK + L ++       V+ +E  I + L    H+RI+ YFG  Q    L IFMEY+  GS++DE+ +   L TE + R Y++Q+LEGL FLH N I+HRDIK  N+L     NIK+ DFG S+ L   C + T  ++ +GTP++ APEV      G  Y   AD+WSLG TV+ MI+G+PP+ +    A   KI T ++ +    Q  S+  +EF+      +P +R ++  LL+ + 
Sbjct:  130 WKKGHRLGSGSFGEVFVCYDKDSGRELAVKQVNLNQMNAETSKEVRALENEI-QLLRNFQHERIVSYFGCHQDHSILSIFMEYMPGGSIKDELAKYGPL-TEGVTRKYTRQMLEGLAFLHKNVIVHRDIKAANVLRDLQGNIKLADFGASKRLHTIC-SATGFKSFVGTPHYMAPEVI----NGEGYGRKADVWSLGCTVVEMISGKPPWSELESMAAIYKIATAERPEFELPQRSSEFSREFLRLTFRRNPLERPSSEDLLRHRF 388          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 167.162 bits (422), Expect = 4.047e-44
Identity = 97/266 (36.47%), Postives = 149/266 (56.02%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV      G  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T     +  S + S++ ++FI ++   +   R +A +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI----SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIF-VEAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 167.162 bits (422), Expect = 4.047e-44
Identity = 97/266 (36.47%), Postives = 149/266 (56.02%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV      G  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T     +  S + S++ ++FI ++   +   R +A +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI----SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIF-VEAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 167.162 bits (422), Expect = 4.047e-44
Identity = 97/266 (36.47%), Postives = 149/266 (56.02%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV      G  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T     +  S + S++ ++FI ++   +   R +A +LL+
Sbjct:  355 TWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEI-QLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVI----SGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIF-VEAKHRPSAEELLR 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 158.688 bits (400), Expect = 3.502e-41
Identity = 101/263 (38.40%), Postives = 148/263 (56.27%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQT--EDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            G  +G GAFG V+ C  +      AVK ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG SR L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T RPP+ +    A   KI T      LP    +S   ++F+ ++   +  QR  A +LL+
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVSALECEI-QLLKNLFHERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVI--SGEG--YGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQPTNPALP--AHVSDHCRDFLKRIFV-ETKQRPAAEELLR 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 155.992 bits (393), Expect = 3.577e-41
Identity = 96/278 (34.53%), Postives = 146/278 (52.52%), Query Frame = 3
Query:  579 RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEF 1400
            +L   SL K+    FD   ++G G++G V+K        + A+K + ++    + I+E     + + N   +++Y+G+      L I MEY  AGS+ D I+ R ++LA + I    +  L+GLE+LH    IHRDIK  NIL+++    K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T       +    S+  ++F+ + L  +P+ R+TA QLL++ +F  F
Sbjct:   19 KLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAHYKETGEIVAIKQVPVESDLQEIIKEI--SIMQQCNSPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRQRNKTLAEDEIAAILQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDQWSEPFRDFVSQCLVKNPENRATATQLLQVFIFVYF 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 165.622 bits (418), Expect = 2.624e-44
Identity = 96/256 (37.50%), Postives = 143/256 (55.86%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENIN------KFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT---KKLDLPDSQSMSKEMKE-FIDKMLDP 1340
            + +G  +G GAFG VY C  +      AVK ++     V+  +E +N      + L  L H+RI++YFG ++   +  L IFMEY+  GS++D+++   +L TEN+ R Y++QILEG+ FLHGN I+HRDIK  NIL  +  N+K+ DFG S+ L   C   T   +  GTP + +PEV      G  Y   ADIWS+G TV+ M+T +PP+ +    A   KI T     +L L  S+     ++  F++  L P
Sbjct:  359 WQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKE-VNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGAL-TENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVI----NGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIFVEAKLRP 608          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 145.206 bits (365), Expect = 1.169e-36
Identity = 92/264 (34.85%), Postives = 138/264 (52.27%), Query Frame = 3
Query:  627 EIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKL------NHQRIIKYFGAIQTEDHLCIFMEYLSAGSLED-EIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFL-TSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFS 1394
            E+G GAFG VYK +      + A K IE K       EE +  ++ ++      +H  I+    A   E+ L IF+E+   G+++   ++ +R LA   I    KQ+LE L +LH + IIHRD+K  NIL++   ++K+ DFGVS    RT   + + ++ IGTP + APEV +  + +  PY   ADIWSLG T+I +    PP  + +P  V +KI       L      S E  +F+ K LD +P+ R  A QLL+    S
Sbjct:   38 ELGDGAFGKVYKAQNKESGVLAAAKVIETKS------EEELEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRT---LQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFIS 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 137.117 bits (344), Expect = 2.015e-35
Identity = 98/266 (36.84%), Postives = 133/266 (50.00%), Query Frame = 3
Query:  603 KKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCI--EENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIK--PDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKL 1388
            ++ F K   IG G+FG V+K   +    V A+K I+L++   +    ++ I   L + +   +  YFG+      L I MEYL  GS  D IK    L    I    ++IL+GL++LH    IHRDIK    N+L+S   ++K+ DFGV+  L  T     K  T +GTP + APEV   S     Y   ADIWSLG T I +  G PP  + HP  V   I       L    + SK  KEF+D  L+ DP  R TA +LLK K 
Sbjct:   23 EELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEIT-VLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIK-PGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDT---QIKRNTFVGTPFWMAPEVIKQSA----YDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTL--EGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKF 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 132.494 bits (332), Expect = 1.421e-32
Identity = 79/260 (30.38%), Postives = 129/260 (49.62%), Query Frame = 3
Query:  603 KKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT--KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            ++ F+    +GSG +G V+K +      + A+K I+L+      + +     + +  H  I+ Y+G+    D L I ME+   GSL+D       L    I   +++ L+GL +LH    +HRDIK  NIL+++  ++K+ DFGVS  +  T   + K ++ IGTP + APEV     +G  Y    D+W++G T I +   +PP  D HP      +  +  +   L D Q  S     FI   L  +P +R TA ++L
Sbjct:   11 QEDFELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITAT---IAKRKSFIGTPYWMAPEVAAVERKG-GYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKML 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 124.405 bits (311), Expect = 4.221e-32
Identity = 79/270 (29.26%), Postives = 134/270 (49.63%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELK--------KIGVKCIE----ENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSR--SLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            T+ KG+ +G GAFG V+    +    + AVK +EL+        + G K  E    ++  + L  L+H  +++Y G     +   IFME++  G++ + ++    L       Y  Q+  GL +LHG+ ++H D+K  N +++    +K+ DFG ++  +L  +C       +  GT  + APEV      G  Y   AD+WSLG T+  M  GRPP+ D  P A  + I     +     Q+ SKE +EF+++    D  +R ++ +LL
Sbjct:   14 TWIKGNRLGKGAFGTVFLGL-TNQGKLIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVI----NGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELL 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 141.739 bits (356), Expect = 8.887e-36
Identity = 95/263 (36.12%), Postives = 138/263 (52.47%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG--VKCIEENINKFLPKLNH-QRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLF 1391
            F +   IG G FG VYK        V+A+K + L      V+ ++  I +FL  L     I +Y+G+   +  L I ME+ + GSL   + R   +  + I    +++L  L+ +H +N+IHRDIK  N+L++N  N+K+ DFGV+  + +T     + +T  GTP + APEV +   EG  Y    DIWSLG T   + TG PPYCD         I+ +K   L D +S S  +KEFI   LD DP +R +A  LLK K  
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREI-QFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRS-LLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS---LRRQTMAGTPYWMAPEVIM---EGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLED-RSYSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 137.502 bits (345), Expect = 2.178e-34
Identity = 98/257 (38.13%), Postives = 132/257 (51.36%), Query Frame = 3
Query:  630 IGSGAFGHVYKCKGSGIDTVFAVKWI------ELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            IG G++G VYK      D V A+K +      EL  I  +         L  LNH  I+KY G I+    L I +EY + GSL   I R  +  +EN  + Y  Q L GL++LHG  +IHRDIK  NIL+S  N +K+ DFGVS     T  N + A T  GT N+ APE+    + G   +  +DIWSLGATV+ M+T  PPY +       +          P S S S+ +K+F+ K    +  +R TA QLLK
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEI------SLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVS-----TIVN-SSALTLAGTLNWMAPEIL--GNRGA--STLSDIWSLGATVVEMLTKNPPYHNLTD--ANIYYAVENDTYYPPS-SFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 136.732 bits (343), Expect = 3.460e-34
Identity = 90/265 (33.96%), Postives = 133/265 (50.19%), Query Frame = 3
Query:  627 EIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENII-RYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVT----KAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQ 1406
            +IG GA G VY     G +   A+K + L+K   K +  N    +    H  I+ +  +   +  L + MEY+  GSL D +     + TE  I    ++ L GLEFLH   ++HRDIK DNIL+S   +IK+TDFG        C  +     K  T +GTP + APEV    + GP      DIWSLG  +I MI G PPY +  P      I T     L + +++S  +K+F+D  L  +P+ R++A +LL  +  +E  +
Sbjct:  625 KIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTH--CILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGF-------CAQINELNLKRTTMVGTPYWMAPEVVSRKEYGP----KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAE 876          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 136.346 bits (342), Expect = 6.113e-34
Identity = 95/284 (33.45%), Postives = 147/284 (51.76%), Query Frame = 3
Query:  588 NTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIE------LKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLL----RTCGNV--------TKA-ETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDC-HPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLL 1376
            N S+R   + K S IG G FG VY         + AVK I+      +KKI    I+E +   L  LNH  I++Y+G     D + IFMEY   GSL   +   R +  E + + Y+ ++LEGL +LH + ++HRDIKP+NIL+     IK  DFG +R+++    RT  N         TK+    +GTP + APE  ++         + D+W+LG  V+ M TGR P+ +  + +A+   +   +   LP+   M+   + F+++ L  DP  R+TA +LL
Sbjct: 1029 NVSMR---WQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKI-FPLIKEEMT-VLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGR-IEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPET-ISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 127.872 bits (320), Expect = 1.804e-31
Identity = 94/302 (31.13%), Postives = 138/302 (45.70%), Query Frame = 3
Query:  606 KTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKK--IGVKC-------------------------------IEENINK-----------FLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            K + KG+ IGSG+FG VY    +    + AVK +E+K   IGV                                   +NI++            L +L+H+ I+ Y+GA Q   +L IF+EY+  GS+   +          I  +++QIL G+ +LH  NIIHRDIK  NIL+     +KITDFG+S+ L        K  +  G+  + +PEV     +    T  ADIWS G  VI M TG+ P+ D        KI T    ++P     + E K F+ K  + D   R +A +LL+
Sbjct:  413 KNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVV----KQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIP--SWATSEGKNFLRKAFELDYQYRPSALELLQ 708          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 171.4 bits (433), Expect = 4.333e-49
Identity = 103/269 (38.29%), Postives = 151/269 (56.13%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQTED-HLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTT-KKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFS 1394
            + KG  +G+GAFG VY C         AVK IE  ++       VK +E  I +F+    ++RI++Y+G I+T+D H+ IFMEYL  GS+ + IK+  +L      +YS+QILEG+ +LH N I+HRDIK  NIL     N+K+ DFG S+  L+T  + T   +  GTP + APEV      G  Y   AD+WS+G TV+ M+T +PP+ D  P A   KI T   + +LP    +S +  EF+   L  +   R +A +LL+    +
Sbjct:    4 WRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEI-EFMKAFRNERIVQYYG-IETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKR-LQTIRSKTGFRSVHGTPYWMAPEVI----NGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPS--DLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVT 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 150.599 bits (379), Expect = 6.403e-41
Identity = 96/271 (35.42%), Postives = 143/271 (52.77%), Query Frame = 3
Query:  579 RLCNTSLRK---KTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +L   SL +   + FD   ++G G++G V+K        V A+K + +     + I+E     + + +   ++KY+G+      L I MEY  AGS+ D +K R ++L  E I    K  L+GLE+LH    IHRDIK  NIL+++  + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T + M  G+PPY D HP      I T       D    S++ K+F+ K L  +P++R+TA +LL+
Sbjct:   10 KLSEESLTRPPEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIKEI--SMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQ 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 144.436 bits (363), Expect = 7.935e-39
Identity = 94/266 (35.34%), Postives = 138/266 (51.88%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAI------QTEDHLCIFMEYLSAGSLEDEIK--RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGP--PYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            FD    +G+G +G V+K +      + A+K +++ +   + I+  IN      NH+ I  Y+GA         +D L + ME+  AGS+ D +K  R ++L  E I    +++L G+  LH N++IHRDIK  N+L++    +K+ DFGVS  L RT G   +  T IGTP + APEV +  DE P   Y    D+WS+G T I M   +PP CD HP      I  +    L   +S SK    F++  L  D   R TA QLL+
Sbjct:   20 FDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDEEEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIG---RRNTFIGTPYWMAPEV-IACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQ 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 143.28 bits (360), Expect = 9.675e-39
Identity = 91/276 (32.97%), Postives = 138/276 (50.00%), Query Frame = 3
Query:  612 FDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKF------LPKLNHQRIIKYFGAIQTEDHLC---IFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKA---ETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFH 1403
            + KG+ +G GAFG V+         + AVK +EL    V   E    K       L  L H+ I++Y G    +D  C   IFME++  GS+   +KR  +       RY++QIL+G+ +LH NN+IHRDIK  NI++     IK+ DFG ++ +     +V+K+    +  GTP + APEV   +  G      +DIWS+G TV  M TG+PP+ +  P +    I     +   D +S S    +F+   +  D D R +A +LL+     E H
Sbjct:    5 WQKGNVLGKGAFGTVF-LGLVNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCM-DDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGR----KSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVPRLD-ESFSAAAIDFVTSCMTRDQDTRPSADELLRHDFLQEPH 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 141.354 bits (355), Expect = 6.744e-37
Identity = 95/261 (36.40%), Postives = 137/261 (52.49%), Query Frame = 3
Query:  603 KKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCI--EENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +K F K   IG G+FG V+K   +  + V A+K I+L++   +    ++ I   L + +   + KY G+      L I MEYL  GS  D +K   ++    I    +++L+GL++LH    +HRDIK  N+LMS   ++K+ DFGV+  L  T   + K  T +GTP + APEV   S     Y   ADIWSLG T I +  G PP  D HP  V   I      +L  + + SK  KEF+   L+ DP+ R TA +LLK
Sbjct:    8 EKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAEDEIEDIQQEIT-VLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKAG-NIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDT---LNKRNTFVGTPFWMAPEVIKQS----AYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPEL--TGNFSKAFKEFVSLCLNKDPNDRPTAKELLK 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 163.696 bits (413), Expect = 5.691e-43
Identity = 100/266 (37.59%), Postives = 150/266 (56.39%), Query Frame = 3
Query:  609 TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            T+ +G  +G GAFG VY C         A K ++           V  +E  I + L  L+H+RI++Y+G ++  +E  L IFMEY+  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG S+ L   C + T   +  GTP + +PEV   S EG  Y   AD+WSLG TV+ M+T +PP+ +    A   KI T     L  S + S + ++FI  +   +   R +A +LL+
Sbjct:  352 TWRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEI-QLLKNLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVI--SGEG--YGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPSHT-SDQARDFIHCIF-VEAKHRPSAEELLR 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 160.999 bits (406), Expect = 7.828e-42
Identity = 102/263 (38.78%), Postives = 150/263 (57.03%), Query Frame = 3
Query:  621 GSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG------VKCIEENINKFLPKLNHQRIIKYFGAIQ--TEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIR-YSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTK-KLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            G  +G GAFG VY C  +      AVK ++           V  +E  I + L  L H+RI++Y+G ++   E  L IFME++  GS++D++K   +L TEN+ R Y++QILEG+ +LH N I+HRDIK  NIL  +  N+K+ DFG SR L   C + T  ++  GTP + +PEV   S EG  Y   ADIWS+G TV+ M+T RPP+ +    A   KI T     +LP    +S   +EF+ ++   +  QR +A +LL+
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEI-QLLKNLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVI--SGEG--YGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPELP--VHVSDHCREFLRRIFV-ETKQRPSADELLR 645          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 150.599 bits (379), Expect = 5.505e-39
Identity = 98/277 (35.38%), Postives = 143/277 (51.62%), Query Frame = 3
Query:  579 RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSE 1397
            +L   SL K+    FD   ++G G++G V+K        V A+K + ++    + I+E     + + +   ++KY+G+      L I MEY  AGS+ D I+ R ++L  + I    K  L+GLE+LH    IHRDIK  NIL++   + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T         +  S +  +F+ K L  +P+QR+TA QLL+    S+
Sbjct:   13 KLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEI--SIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFISQ 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 149.828 bits (377), Expect = 7.151e-39
Identity = 94/271 (34.69%), Postives = 140/271 (51.66%), Query Frame = 3
Query:  579 RLCNTSLRKK---TFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLK 1379
            +L   SL K+    FD   ++G G++G V+K        + A+K + ++    + I+E     + + N   +++Y+G+      L I MEY  AGS+ D I+ R ++L+ E I       L+GLE+LH    IHRDIK  NIL++     K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T       +    S+  ++F+ + L  +P+ R+TA QLL+
Sbjct:   19 KLSEDSLTKQPEEVFDVLEKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEIIKEI--SIMQQCNSPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQ 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 149.443 bits (376), Expect = 1.424e-38
Identity = 95/270 (35.19%), Postives = 140/270 (51.85%), Query Frame = 3
Query:  591 TSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIK-RKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSE 1397
            T   ++ FD   ++G G++G V+K        V A+K + ++    + I+E     + + +   ++KY+G+      L I MEY  AGS+ D I+ R ++L  + I    K  L+GLE+LH    IHRDIK  NIL++   + K+ DFGV+  L  T   + K  T IGTP + APEV     +   Y   ADIWSLG T I M  G+PPY D HP      I T         +  S +  +F+ K L  +P+QR+TA QLL+    S+
Sbjct:   23 TKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEI--SIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDT---MAKRNTVIGTPFWMAPEVI----QEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFISQ 283          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 371/382 (97.12%), Postives = 373/382 (97.64%), Query Frame = 3
Query:  264 PCLLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQNXXXXXXXXXXXXXXXXXMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            PCLLRACKNGDLKKVST LNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDK NLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLS GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYC CHP+AV  KI  TKKLDLPDSQSMSKEMKEFI+KMLDPDPDQRSTAAQLLKLKLFSEF QD
Sbjct:  190 PCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSGGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 571          

HSP 2 Score: 57.3806 bits (137), Expect = 2.328e-8
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQN 491
            AC  G  + V  L+ +   IE  D+  +RPIH AC+ G+ + VK LI+ KCDI A D+   SP++IA+K+ N
Sbjct:  109 ACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHN 180          

HSP 3 Score: 50.0618 bits (118), Expect = 4.138e-6
Identity = 29/68 (42.65%), Postives = 38/68 (55.88%), Query Frame = 3
Query:  276 RACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
             AC  G  + V  L+ +   IE  DK   RPIH+AC  G+ + VK LI+ KCDI A D +N  P+  A
Sbjct:   42 HACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYA 109          

HSP 4 Score: 49.2914 bits (116), Expect = 7.975e-6
Identity = 28/67 (41.79%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ +   IE  D   +RPIH+AC  G  + VK LI+ KCDI A D++N  P+  A
Sbjct:   76 ACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHA 142          

HSP 5 Score: 48.9062 bits (115), Expect = 9.896e-6
Identity = 26/69 (37.68%), Postives = 36/69 (52.17%), Query Frame = 3
Query:  270 LLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
             + A K+G             +E  D D   PIH AC +G+ ++VK LI+  CDI A DK+NL P+  A
Sbjct:    8 FINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYA 76          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 371/382 (97.12%), Postives = 373/382 (97.64%), Query Frame = 3
Query:  264 PCLLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQNXXXXXXXXXXXXXXXXXMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            PCLLRACKNGDLKKVST LNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDK NLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLS GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYC CHP+AV  KI  TKKLDLPDSQSMSKEMKEFI+KMLDPDPDQRSTAAQLLKLKLFSEF QD
Sbjct:  256 PCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSGGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 637          

HSP 2 Score: 57.3806 bits (137), Expect = 2.521e-8
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQN 491
            AC  G  + V  L+ +   IE  D+  +RPIH AC+ G+ + VK LI+ KCDI A D+   SP++IA+K+ N
Sbjct:  175 ACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHN 246          

HSP 3 Score: 53.9138 bits (128), Expect = 2.802e-7
Identity = 30/67 (44.78%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ +   IE  DK  RRPIH AC  G+ + VK LI+  CDI A D +NL P+  A
Sbjct:   76 ACDQGRSEAVKLLIEHKCDIEALDKRNRRPIHLACYQGHSEAVKLLIEHNCDIEALDVWNLRPIHYA 142          

HSP 4 Score: 53.1434 bits (126), Expect = 5.170e-7
Identity = 30/68 (44.12%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  276 RACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
             AC  G  + V  L+ +   IE  DK  +RPIH AC+ G  + VK LI+ KCDI A DK N  P+ +A
Sbjct:   42 HACFAGHAEIVKLLIEHNCDIEALDKRNQRPIHLACDQGRSEAVKLLIEHKCDIEALDKRNRRPIHLA 109          

HSP 5 Score: 48.9062 bits (115), Expect = 9.355e-6
Identity = 28/67 (41.79%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ +   IE  D   +RPIH+AC  G  + VK LI+ KCDI A D++N  P+  A
Sbjct:  142 ACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHA 208          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 371/382 (97.12%), Postives = 373/382 (97.64%), Query Frame = 3
Query:  264 PCLLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQNXXXXXXXXXXXXXXXXXMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            PCLLRACKNGDLKKVST LNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDK NLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLS GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYC CHP+AV  KI  TKKLDLPDSQSMSKEMKEFI+KMLDPDPDQRSTAAQLLKLKLFSEF QD
Sbjct:  355 PCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSGGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 736          

HSP 2 Score: 56.9954 bits (136), Expect = 3.071e-8
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQN 491
            AC  G  + V  L+ +   IE  D+  +RPIH AC+ G+ + VK LI+ KCDI A D+   SP++IA+K+ N
Sbjct:  274 ACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHN 345          

HSP 3 Score: 53.5286 bits (127), Expect = 4.097e-7
Identity = 30/67 (44.78%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC +G  + V  L+ N   IE  D   RRPIH AC  G+ + VK LI+  CDI A D +NL P+  A
Sbjct:  175 ACYHGHSEAVKLLIENKCDIEALDWRNRRPIHLACYQGHSEAVKLLIEHNCDIEALDVWNLRPIHYA 241          

HSP 4 Score: 52.7582 bits (125), Expect = 6.353e-7
Identity = 30/68 (44.12%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  276 RACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
             AC  G  + V  L+ +   IE  DK  +RPIH AC+ G  + VK LI+ KCDI A DK N  P+ +A
Sbjct:   42 HACFAGHAEIVKLLIEHNCDIEALDKRNQRPIHLACDQGRSEAVKLLIEHKCDIEALDKRNQRPIHLA 109          

HSP 5 Score: 52.373 bits (124), Expect = 8.659e-7
Identity = 30/67 (44.78%), Postives = 37/67 (55.22%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ N   IE  D   +RPIH AC  G+ K VK LI  KCDI A D +N  P+ +A
Sbjct:  109 ACDQGHSEAVKLLIENKCDIEALDWGNQRPIHLACYYGHSKAVKLLIDHKCDIEALDWWNQRPIHLA 175          

HSP 6 Score: 51.6026 bits (122), Expect = 1.366e-6
Identity = 29/67 (43.28%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ +   IE  DK  +RPIH AC+ G+ + VK LI+ KCDI A D  N  P+ +A
Sbjct:   76 ACDQGRSEAVKLLIEHKCDIEALDKRNQRPIHLACDQGHSEAVKLLIENKCDIEALDWGNQRPIHLA 142          

HSP 7 Score: 48.9062 bits (115), Expect = 9.859e-6
Identity = 28/67 (41.79%), Postives = 38/67 (56.72%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G  + V  L+ +   IE  D   +RPIH+AC  G  + VK LI+ KCDI A D++N  P+  A
Sbjct:  241 ACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHA 307          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000032703.1 (SMESG000032703.1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 300/381 (78.74%), Postives = 330/381 (86.61%), Query Frame = 3
Query:  270 LLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQNXXXXXXXXXXXXXXXXXMMGLKCKS-FCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD 1409
            LL ACK GD KKVS LLN   IEYCDK +RRPIHWACESGNIK+VKSLIKTKCDI+A+DK NL PLDIAIK +NKELVE+LK EELEQQI MMGL+CK  FCNHRLC TSL+ KTF KGSEIGSG FGH+YKCKGSGIDTVFA+KWIEL KI  K IEENIN FLPKL H+RII+YFGAIQT+DHLCIFMEYL  GSLEDEI++KR +AT+NIIRYSKQILEGLEFLHGN IIHRDIKP NILM   NNIK+ DFG+SRSL+RTCG +TKA TTIGTPNFTAPEV LTSD GPPYT SADIWS+GATVINMITGRPPY  CHPFAV  +I T+KKL+LP+S+ MS  MK FI++ML+PDPDQRSTAAQLLKLK FSEF  D
Sbjct:  535 LLLACKTGDTKKVSRLLNSITIEYCDKGKRRPIHWACESGNIKIVKSLIKTKCDITAKDKDNLRPLDIAIKKENKELVEILKEEELEQQISMMGLECKPPFCNHRLCKTSLKNKTFAKGSEIGSGGFGHIYKCKGSGIDTVFAIKWIELIKISEKYIEENINTFLPKLMHKRIIRYFGAIQTKDHLCIFMEYLFKGSLEDEIEKKRFIATKNIIRYSKQILEGLEFLHGNRIIHRDIKPANILMGPENNIKLADFGISRSLMRTCGEITKAVTTIGTPNFTAPEVILTSDNGPPYTESADIWSMGATVINMITGRPPYYYCHPFAVINRISTSKKLELPESELMSDAMKGFIEEMLNPDPDQRSTAAQLLKLKFFSEFDFD 915          

HSP 2 Score: 57.7658 bits (138), Expect = 2.240e-8
Identity = 28/73 (38.36%), Postives = 48/73 (65.75%), Query Frame = 3
Query:  276 RACKNGDLKKVSTLLNGAA-IEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQN 491
             AC++G ++ V  L++    I+  D++  +PIH AC +GNI+ +K LI   C+I A DK+  SP++IA+++ N
Sbjct:  451 HACRSGHIETVKLLIDHHCDIDASDRNDWQPIHHACVAGNIETLKLLIDHYCNIEALDKFGDSPIEIAVRSCN 523          

HSP 3 Score: 53.9138 bits (128), Expect = 3.287e-7
Identity = 27/67 (40.30%), Postives = 41/67 (61.19%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC  G ++ V  L+ +   IE  D++  RPIH+AC +G++K+VK LI   CDI A D  +  P+ +A
Sbjct:  221 ACSAGHIEAVKLLIYHHCDIEALDQNDWRPIHYACCAGHMKIVKLLIDYHCDIDASDTNDWRPIHLA 287          

HSP 4 Score: 50.0618 bits (118), Expect = 5.333e-6
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLLN-GAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIK 482
            AC  G +K V  L++    I+  D +  RPIH AC +G+I++VK LI   CDI+A D  +  P+  A++
Sbjct:  254 ACCAGHMKIVKLLIDYHCDIDASDTNDWRPIHLACGAGHIEIVKLLIDYHCDINASDMNDNRPIHFALR 322          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 274/378 (72.49%), Postives = 315/378 (83.33%), Query Frame = 3
Query:  270 LLRACKNGDLKKVSTLLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQNXXXXXXXXXXXXXXXXXMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSAGSLEDEI-KRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQSMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEF 1400
            LL ACKNGDLK VS L+NG+ IE CDK++RRPIHWACESGNI++VK LI+ KCD++ARDK  +SPLDIA+KN+NKELVE+LKAEELE  I  MGLKCK FC+H+ CNTSLR KTF KGS IG+GAFG +YKCKGSGID VFA+KWIELKKIG K IE NIN+FL KLNH+RIIKYFGAIQ +DHLCIFMEYLS GSLEDEI KRKR + TEN I+YSKQILEGLEFLH + IIHRDIKP NIL+S+ NNIK+ DFG+SRSL+RT G  TKA + +GT NFTAPEV     +  PYT SADIWS+GATVINMI GRPPY  C P A+  KI T KKL +P SQ MS+EMK FI++ML+PDP++R TAAQLLKLKLFSEF
Sbjct:  354 LLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSKGSLEDEIIKRKRPIDTENTIKYSKQILEGLEFLHSHRIIHRDIKPANILLSDENNIKLADFGISRSLMRTDGKSTKAVSGVGTFNFTAPEVIRIEIDNAPYTESADIWSVGATVINMIEGRPPYDYCDPLALIFKIATDKKLVMPHSQMMSEEMKAFIEEMLNPDPNKRPTAAQLLKLKLFSEF 731          

HSP 2 Score: 55.8398 bits (133), Expect = 7.187e-8
Identity = 28/72 (38.89%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIAIKNQN 491
            AC +G  + V  L+ +   IE  D+D  RPIH+AC  G+ + +K LI+ +C+I A DK+N  P+  AI  ++
Sbjct:  106 ACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRH 177          

HSP 3 Score: 50.447 bits (119), Expect = 3.420e-6
Identity = 27/67 (40.30%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  279 ACKNGDLKKVSTLL-NGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKYNLSPLDIA 476
            AC +G  + V  L+ +   IE  D  ++RPIH AC  G+ + VK L + KCDI A D +N  P+ +A
Sbjct:  205 ACNHGHSEAVKLLIEHKCDIEALDWQKQRPIHLACNHGHSEAVKLLTEHKCDIEALDIWNQRPIHLA 271          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K31.787e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.919e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.270e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.567e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.567e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-14.607e-4138.55Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-15.023e-4138.55Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-16.162e-4138.55Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.592e-4038.55Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.611e-4038.78Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msn2.230e-3937.31gene:FBgn0010909 transcript:FBtr0333364[more]
msn2.437e-3937.31gene:FBgn0010909 transcript:FBtr0072956[more]
msn2.494e-3937.31gene:FBgn0010909 transcript:FBtr0333365[more]
msn2.494e-3937.31gene:FBgn0010909 transcript:FBtr0072957[more]
msn2.655e-3937.31gene:FBgn0010909 transcript:FBtr0333362[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k38.479e-4337.08mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.135e-4237.08mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.285e-4237.08mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k23.909e-4138.40mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k24.489e-4138.40mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd83.305e-4337.59sterile alpha motif domain containing 8 [Source:Xe... [more]
samd83.710e-4337.59sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K21.262e-4035.19mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.489e-4035.19mitogen-activated protein kinase kinase kinase 2 [... [more]
elp42.383e-4035.92elongator acetyltransferase complex subunit 4 [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k32.875e-4136.98mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k23.953e-4036.90mitogen-activated protein kinase kinase kinase 2 [... [more]
Stk31.451e-3835.79serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk32.505e-3835.79serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk102.704e-3836.68serine/threonine kinase 10 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O22042|M3K3_ARATH1.477e-4134.91Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q54PX0|Y4251_DICDI4.379e-4136.74Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q40541|NPK1_TOBAC4.666e-4134.91Mitogen-activated protein kinase kinase kinase NPK... [more]
sp|Q99759|M3K3_HUMAN9.213e-4136.98Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE2.011e-4036.98Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG27.936e-6037.64Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A453KR491.211e-4739.93Protein kinase domain-containing protein OS=Aegilo... [more]
K1PKP11.828e-4738.71Mitogen-activated protein kinase kinase kinase 2 O... [more]
A0A453KR431.864e-4740.07Protein kinase domain-containing protein OS=Aegilo... [more]
A0A210PFZ51.092e-4637.59Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.047e-4436.47mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.047e-4436.47mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.047e-4436.47mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k23.502e-4138.40mitogen-activated protein kinase kinase kinase 2 [... [more]
STK43.577e-4134.53serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.624e-4437.50mitogen-activated protein kinase kinase kinase 2 [... [more]
slka1.169e-3634.85STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
stk25a2.015e-3536.84serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
MAP4K31.421e-3230.38mitogen-activated protein kinase kinase kinase kin... [more]
map3k194.221e-3229.26mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIC18.887e-3636.12Protein kinase of the PAK/Ste20 family, required f... [more]
CDC152.178e-3438.13Protein kinase of the Mitotic Exit Network; locali... [more]
STE203.460e-3433.96Cdc42p-activated signal transducing kinase; involv... [more]
SSK226.113e-3433.45MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
STE111.804e-3131.13Signal transducing MEK kinase; involved in pheromo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414104.333e-4938.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428456.403e-4135.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409617.935e-3935.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478219.675e-3932.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319346.744e-3736.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k35.691e-4337.59mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k27.828e-4238.78mitogen-activated protein kinase kinase kinase 2 [... [more]
stk35.505e-3935.38serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
ENSORLT00000044704.17.151e-3934.69serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
stk31.424e-3835.19serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017261.12.328e-897.12SMESG000017261.1[more]
SMESG000017261.12.521e-897.12SMESG000017261.1[more]
SMESG000017261.13.071e-897.12SMESG000017261.1[more]
SMESG000032703.12.240e-878.74SMESG000032703.1[more]
SMESG000017030.17.187e-872.49SMESG000017030.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018632 ID=SMED30018632|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1777bp
CAAACGAGAGTCAACAAAATCATTTTACAGAAAAATAGAAATTATGTGCC
ATTTCTATGCACAACATATTTAATTATTTAATTAATTAATTTTAATCCAA
TCATTCACCAGCACTCATTTCACCTCAATTATGCAGGGCCCTTTCACCCC
TCCCTATATAAATCCGATAGCAAATCCCACCGATATTGAATGCATTCATT
GCTCTCTATTCTCTTATTTTCTCTATTTCGTTTTTCCTATCAGTTTGATT
TGTCTGCATTTAGCCTTGCTTGCTGCGGGCCTGTAAAAATGGCGACCTGA
AGAAGGTTTCTACGTTACTAAATGGTGCCGCCATAGAATATTGTGATAAG
GACCAAAGGCGGCCGATTCATTGGGCATGTGAGAGCGGCAACATCAAAGT
TGTCAAATCATTGATTAAAACAAAATGTGATATCAGTGCAAGAGATAAAT
ATAATTTGTCCCCCCTGGACATTGCTATTAAGAATCAGAATAAGGAGCTC
GTGGAGCTCCTCAAGGCGGAGGAATTGGAACAACAAATTTTAATGATGGG
TCTAAAATGCAAATCTTTCTGTAACCACAGGCTGTGCAACACATCGCTCA
GGAAGAAAACATTTGATAAAGGTTCAGAAATTGGAAGTGGAGCATTCGGG
CATGTTTATAAATGCAAGGGTTCTGGAATAGATACGGTTTTTGCTGTCAA
GTGGATAGAATTAAAAAAGATTGGTGTGAAATGCATAGAAGAAAACATTA
ATAAATTCCTACCCAAACTGAATCACCAGAGAATTATAAAGTATTTCGGA
GCTATTCAGACAGAAGATCATTTATGCATTTTCATGGAATACCTTTCTGC
AGGCTCCCTGGAAGATGAAATAAAAAGGAAGAGATCCCTAGCCACGGAAA
ATATCATAAGGTACAGCAAGCAGATACTTGAAGGCCTGGAATTCCTGCAC
GGAAACAACATTATTCATCGAGATATAAAGCCGGACAATATATTGATGAG
CAATGGAAATAATATAAAAATAACAGACTTTGGTGTCAGCCGGTCATTAT
TGAGGACCTGTGGCAATGTAACTAAAGCTGAAACAACTATTGGAACTCCA
AATTTTACAGCTCCTGAGGTTTTCCTAACTAGTGATGAAGGGCCACCCTA
TACTGTGTCAGCGGATATCTGGTCGTTGGGGGCCACTGTTATCAATATGA
TAACTGGCAGGCCGCCATATTGTGATTGTCATCCATTTGCTGTCCCAGTA
AAAATCGTCACAACTAAAAAGCTTGACCTGCCGGACTCCCAGTCGATGTC
AAAGGAAATGAAAGAGTTCATTGACAAAATGTTGGATCCAGATCCAGATC
AGAGATCAACCGCTGCACAATTATTAAAATTGAAATTATTTTCTGAATTC
CATCAAGATTAAATAAATTTTTATGTTTGATTTCTGGATGTATAGAAATA
TTTTTTGTTTTAATGAATGGAATTATATTTTAGTAAATTCTGCAAGGGAA
AGGTTGCATTCGTGTTATCCAGTCTGGCTTGTTTTGACTTCTTTTAACCA
TTCCAGTGAACCTTGCGGTTGGATTATGGAGGATAACTTTATCATCCACC
ACCACAAATGGGCCCCTAATCCTGGAGATCCATCTCGATCCAAAATATCC
AAATGAAATTCTTCTTTCCTTTGAAATATTCGAGATTTTTTACTAATTTA
AAAAATATAATTCCTAATTTTTCGGTGTGATAATTGGTTTCCATGTGTAA
ATTGCCCCCCCCCAGCCAACTTGCTCG
back to top

protein sequence of SMED30018632-orf-1

>SMED30018632-orf-1 ID=SMED30018632-orf-1|Name=SMED30018632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=290bp
MMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVF
AVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEY
LSAGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNI
LMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEG
PPYTVSADIWSLGATVINMITGRPPYCDCHPFAVPVKIVTTKKLDLPDSQ
SMSKEMKEFIDKMLDPDPDQRSTAAQLLKLKLFSEFHQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0046777protein autophosphorylation
GO:2000401regulation of lymphocyte migration
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 24..283
e-value: 1.4E-82
score: 290.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 25..282
e-value: 7.3E-67
score: 225.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 24..283
score: 47.552
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 10..284
e-value: 5.3E-37
score: 125.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 20..289
e-value: 2.2E-79
score: 268.6
NoneNo IPR availablePANTHERPTHR45832FAMILY NOT NAMEDcoord: 16..279
NoneNo IPR availablePANTHERPTHR45832:SF5coord: 16..279
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 140..152
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 30..53
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 22..286