High mobility group protein

Overview
NameHigh mobility group protein
Smed IDSMED30018630
Length (bp)1718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of High mobility group protein (SMED30018630) t-SNE clustered cells

Violin plots show distribution of expression levels for High mobility group protein (SMED30018630) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of High mobility group protein (SMED30018630) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for High mobility group protein (SMED30018630) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018630

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018630SMESG000052032.1 Contig49572uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018630SMESG000052032.1 Contig49572newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30018630SMESG000052032.1 dd_Smed_v6_1331_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30018630SMESG000052032.1 dd_Smed_v6_1331_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30018630SMESG000052032.1 dd_Smed_v6_1331_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30018630SMESG000052032.1 dd_Smed_v4_1331_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 157.147 bits (396), Expect = 5.516e-44
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA SDK R++REM NY P     + ++K         PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNA-----PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 157.147 bits (396), Expect = 5.516e-44
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA SDK R++REM NY P     + ++K         PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNA-----PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 157.147 bits (396), Expect = 5.516e-44
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA SDK R++REM NY P     + ++K         PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNA-----PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 157.147 bits (396), Expect = 5.581e-44
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 157.147 bits (396), Expect = 5.581e-44
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 147.517 bits (371), Expect = 1.272e-40
Identity = 77/174 (44.25%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  670 VYKMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            +Y+ + +D  KP  +G  S Y +FV++  EEHK+K+P E V  +E SKKC+EKWK M   EK+RF E+A  D +R+  E++     GE   R+RKR + K+P  PKRA SAFFF+  + RP+++  HPDW+VG +A+ELG++W+      K+ YE+K++ADK RY ++M  ++A
Sbjct:   31 MYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAK-KDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 203          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 147.517 bits (371), Expect = 1.295e-40
Identity = 77/174 (44.25%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  670 VYKMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            +Y+ + +D  KP  +G  S Y +FV++  EEHK+K+P E V  +E SKKC+EKWK M   EK+RF E+A  D +R+  E++     GE   R+RKR + K+P  PKRA SAFFF+  + RP+++  HPDW+VG +A+ELG++W+      K+ YE+K++ADK RY ++M  ++A
Sbjct:   32 MYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAK-KDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 147.517 bits (371), Expect = 1.295e-40
Identity = 77/174 (44.25%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  670 VYKMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            +Y+ + +D  KP  +G  S Y +FV++  EEHK+K+P E V  +E SKKC+EKWK M   EK+RF E+A  D +R+  E++     GE   R+RKR + K+P  PKRA SAFFF+  + RP+++  HPDW+VG +A+ELG++W+      K+ YE+K++ADK RY ++M  ++A
Sbjct:   32 MYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAK-KDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 147.132 bits (370), Expect = 1.564e-40
Identity = 78/174 (44.83%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  670 VYKMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            +Y+ + +D  KP  +G  S Y +FV++  EEHK+K+P E V  +E SKKC+EKWK M   EK+RF E+A  D +R+  E+  Y   GE   R+RKR + K+P  PKRA SAFFF+  + RP+++  HPDW+VG +A+ELG++W+      K+ YE+K++ADK RY ++M  ++A
Sbjct:   32 MYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAY--GGEDAMRKRKRAK-KDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 202          
BLAST of High mobility group protein vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 147.132 bits (370), Expect = 1.564e-40
Identity = 78/174 (44.83%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  670 VYKMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            +Y+ + +D  KP  +G  S Y +FV++  EEHK+K+P E V  +E SKKC+EKWK M   EK+RF E+A  D +R+  E+  Y   GE   R+RKR + K+P  PKRA SAFFF+  + RP+++  HPDW+VG +A+ELG++W+      K+ YE+K++ADK RY ++M  ++A
Sbjct:   32 MYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAY--GGEDAMRKRKRAK-KDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 202          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0289960)

HSP 1 Score: 173.711 bits (439), Expect = 2.223e-48
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 343          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089259)

HSP 1 Score: 173.326 bits (438), Expect = 2.337e-48
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  170 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 331          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089260)

HSP 1 Score: 173.326 bits (438), Expect = 2.337e-48
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  170 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 331          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089261)

HSP 1 Score: 173.326 bits (438), Expect = 2.337e-48
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  170 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 331          
BLAST of High mobility group protein vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089262)

HSP 1 Score: 173.326 bits (438), Expect = 2.393e-48
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  171 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 332          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 157.147 bits (396), Expect = 3.214e-44
Identity = 81/166 (48.80%), Postives = 117/166 (70.48%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G  S+YA+FVQ  REEHK+K+PG  V FSEFSKKC+E+W+ M+ KEK +FEEMA +DK R++REM NY P     +  +  ++ K+P  PKR  SAFF FC ++RPKV+  +P   +G+IAK+LG +W   + KEK  YE+K+   K++YE+ ++ +RA
Sbjct:    3 KDPNKPRGKTSSYAFFVQTCREEHKKKNPGTSVNFSEFSKKCSERWRTMSSKEKGKFEEMAKTDKVRYDREMKNYVPP----KGAKGGKKKKDPNAPKRPPSAFFVFCSDHRPKVKGDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb1a (high mobility group box 1a [Source:ZFIN;Acc:ZDB-GENE-030131-341])

HSP 1 Score: 155.992 bits (393), Expect = 7.098e-44
Identity = 87/167 (52.10%), Postives = 116/167 (69.46%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA  DK R+ REM NY  P GE      K++R K+P  PKR  SAFF FC E+RPKV+E  P   +G++AK LG +W   + +EK  YEKK+   K++YE+ ++ +R+
Sbjct:    3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKARYEREMKNYIPPKGE------KKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRS 163          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb1a (high mobility group box 1a [Source:ZFIN;Acc:ZDB-GENE-030131-341])

HSP 1 Score: 155.992 bits (393), Expect = 7.098e-44
Identity = 87/167 (52.10%), Postives = 116/167 (69.46%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA  DK R+ REM NY  P GE      K++R K+P  PKR  SAFF FC E+RPKV+E  P   +G++AK LG +W   + +EK  YEKK+   K++YE+ ++ +R+
Sbjct:    3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKARYEREMKNYIPPKGE------KKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRS 163          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb1a (high mobility group box 1a [Source:ZFIN;Acc:ZDB-GENE-030131-341])

HSP 1 Score: 155.992 bits (393), Expect = 7.098e-44
Identity = 87/167 (52.10%), Postives = 116/167 (69.46%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA  DK R+ REM NY  P GE      K++R K+P  PKR  SAFF FC E+RPKV+E  P   +G++AK LG +W   + +EK  YEKK+   K++YE+ ++ +R+
Sbjct:    3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKARYEREMKNYIPPKGE------KKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRS 163          
BLAST of High mobility group protein vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 155.221 bits (391), Expect = 1.748e-43
Identity = 81/166 (48.80%), Postives = 113/166 (68.07%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRAG 1188
            D  +PKG  SAYA+FVQ  R+EHKRK P   V FSEFSKKC+E+WK +   +K +FE+MA +DK R++REM  Y P    G+  RK+   K+P  PKR  SAFF FC EYRP V+  HP+  +G IAK+LG LW  +S  D+  +E+K+   +++YE++++ +RAG
Sbjct:    5 DVNKPKGKTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPPKGVGKTGRKK---KDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAG 167          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: cep170b (centrosomal protein 170B [Source:Xenbase;Acc:XB-GENE-5943417])

HSP 1 Score: 161.384 bits (407), Expect = 1.458e-45
Identity = 82/166 (49.40%), Postives = 114/166 (68.67%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YAYFVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC E+RPK++  HP   +G+IAK+LG +W +    DK  YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKSKFEDMAKADKVRYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGSTIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb2 (high mobility group box 2 [Source:NCBI gene;Acc:394499])

HSP 1 Score: 153.295 bits (386), Expect = 1.225e-42
Identity = 82/171 (47.95%), Postives = 115/171 (67.25%), Query Frame = 1
Query:  679 MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            M   D +KPR  G MS+YAYFVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FEEMA +DK R+ REM  Y P     +  +K ++ K+P  PKR  SAFF FC E+RP+++   P   +G+ AK+LG +W   T K+K  YE+K+   K++YE+ ++ ++A
Sbjct:    1 MGKGDPNKPR--GKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTYIPP----KGEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYKA 165          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 141.354 bits (355), Expect = 2.301e-38
Identity = 69/157 (43.95%), Postives = 107/157 (68.15%), Query Frame = 1
Query:  721 MSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            MSAYAYFVQ  REEHK+K+P   V F+EFSKKC+E+WK M+ KEK +F+++A +DK R++REM ++ P  +        ++ K+P  PKR  S FF FC E+RPK++  +P   +G++AK+LG +W +  D EK  Y  K+   K++YE+ ++ +++
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKK-------GKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKDVADYKS 162          
BLAST of High mobility group protein vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 138.272 bits (347), Expect = 1.681e-37
Identity = 70/151 (46.36%), Postives = 103/151 (68.21%), Query Frame = 1
Query:  721 MSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQ 1167
            MSAYAYFVQ  REEHK+K+P   V F+EFSKKC+E+WK M+ KEK +F+++A +DK R++REM ++ P  +G ++       K+P  PKR  S FF FC E+RPK++  +P   +G++AK+LG +W +  D EK  Y  K+   K++YE+ 
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKK-------KDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKH 156          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 157.918 bits (398), Expect = 1.559e-44
Identity = 83/173 (47.98%), Postives = 119/173 (68.79%), Query Frame = 1
Query:  676 KMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            ++++   D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:   12 QLNMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 178          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 157.147 bits (396), Expect = 3.832e-44
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 157.147 bits (396), Expect = 3.832e-44
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 157.147 bits (396), Expect = 3.832e-44
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Mouse
Match: Hmgb2 (high mobility group box 2 [Source:MGI Symbol;Acc:MGI:96157])

HSP 1 Score: 153.295 bits (386), Expect = 1.010e-42
Identity = 81/165 (49.09%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE++A SDK R++REM NY P      +  K+ + K+P  PKR  SAFF FC E RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPP-----KGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|Q24537|HMG2_DROME (High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.123e-47
Identity = 89/162 (54.94%), Postives = 118/162 (72.84%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFR 1182
            +P+G M+AYAYFVQ  REEHK+KHP E V+F+EFS+KCAE+WK M  KEKKRF EMA  DK R+  EM NY  P G    R +KR++IK+P  PKR+ SAFF+FC++ R KV+  +P++ VG+IAKELGR W       K+KYE  +E DK RYE +M++++
Sbjct:  178 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYK 339          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P26584|HMGB2_CHICK (High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 6.511e-45
Identity = 84/171 (49.12%), Postives = 116/171 (67.84%), Query Frame = 1
Query:  679 MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            M   D +KPR  G MS+YAYFVQ  REEHK+KHP   V F+EFS+KC+E+WK M+ KEK +FEEMA  DK R++REM NY P      +  K+ + K+P  PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +   DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    1 MGKGDPNKPR--GKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSRKCSERWKTMSSKEKGKFEEMAKGDKARYDREMKNYVPP-----KGEKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKNDHPGLSIGDTAKKLGEMWSEQLAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P26583|HMGB2_HUMAN (High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 2.649e-43
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA SDK R++REM NY P     + ++K         PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNA-----PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P40673|HMGB2_BOVIN (High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3)

HSP 1 Score: 157.147 bits (396), Expect = 2.649e-43
Identity = 80/165 (48.48%), Postives = 113/165 (68.48%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA SDK R++REM NY P     + ++K         PKR  SAFF FC E+RPK++  HP   +G+ AK+LG +W  +S  DK+ YE+K+   K++YE+ ++ +RA
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNA-----PKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. UniProt/SwissProt
Match: sp|P63159|HMGB1_RAT (High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 2.680e-43
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +P+G MS+YA+FVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FE+MA +DK R+ REM  Y  P GE       +++ K+P  PKR  SAFF FC EYRPK++  HP   +G++AK+LG +W +    DK+ YEKK+   K++YE+ ++ +RA
Sbjct:    5 DPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGE------TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A3S5AFA8 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS12449 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.840e-76
Identity = 126/204 (61.76%), Postives = 167/204 (81.86%), Query Frame = 1
Query:  676 KMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSSTEDPTAVST 1287
            K+ V+D++KP  KGAM+AYA FVQVIREEHK+KHPGEQ+VFS+FSKKCAE+WK+M+PKEKKRFE+MAA DK+R+NREMN+Y P  +G ++ +KR+  ++P QPKRAWSAFFFFCDE+R K++E HP+W+V +IAKELGR WE C +K KYE  ++ DKQRYEE M ++RAG YVPP K+P+ +S    L+AG S++ D  ++S 
Sbjct:   25 KLVVKDRNKP--KGAMTAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKVMSPKEKKRFEDMAALDKERYNREMNDYVPP-DGVKKAKKRKAARDPRQPKRAWSAFFFFCDEFRAKIKEEHPEWKVADIAKELGRRWEECQEKPKYETLAQQDKQRYEEDMLKYRAGTYVPP-KQPKFES----LMAGVSASGDGPSISN 220          
BLAST of High mobility group protein vs. TrEMBL
Match: C1LIA1 (High mobility group protein DSP1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.711e-74
Identity = 125/201 (62.19%), Postives = 157/201 (78.11%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKR-PRADSNGSALIAGSSSTEDPTAVSTGA 1293
            KDK +PKG MSAY+ FVQVIREEHK+KHPGEQ+VFS+FSKKCAE+WKLMTPKEKKRFE++A  D++RFNREM +Y P  +G ++ +KR+  K+P  P RAWSAFFFFCDE+R KVRE++PDW+V +IAKELGR WESC DK KYE  ++ DKQRYEE M ++RAG YVP  K+   A SN +++    S   D T V++ A
Sbjct:    5 KDKNKPKGPMSAYSCFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAVLDRERFNREMCDYVPP-DGIKKGKKRKGPKDPSVPARAWSAFFFFCDEFRAKVRESNPDWKVADIAKELGRQWESCQDKAKYELLAQKDKQRYEEDMIKYRAGTYVPREKKLASAVSNSASIRTSESQNPDCTTVTSAA 204          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A0R3UE70 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5262 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.458e-74
Identity = 121/194 (62.37%), Postives = 157/194 (80.93%), Query Frame = 1
Query:  679 MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSS 1260
            MS   KDK RPKG MSAYA FVQVIREEHK+KHPGE +VFS+FS+KCAE+WK+MTPKEKKRFE+MAA DK+R+NREM +Y P  +G ++ +KR+  K+P  PKRA SAFFFFCDE+R K+R+ HPDW+VG+IAKELGR WE CT+K KY+  ++ DKQRYEE M+++R G YVP  K+ ++D N +A+++ + S
Sbjct:    1 MSRVLKDKNRPKGPMSAYACFVQVIREEHKKKHPGEHIVFSDFSRKCAERWKIMTPKEKKRFEDMAALDKERYNREMVDYVPP-DGMKKGKKRKAAKDPSVPKRALSAFFFFCDEFRGKIRDEHPDWKVGDIAKELGRRWEECTEKAKYDTLAQQDKQRYEEDMNKYRQGVYVPSKKQTKSD-NSAAMVSDAGS 192          
BLAST of High mobility group protein vs. TrEMBL
Match: Q5DA81 (High mobility group protein DSP1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010071 PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.099e-73
Identity = 124/200 (62.00%), Postives = 156/200 (78.00%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKR-PRADSNGSALIAGSSSTEDPTAVSTG 1290
            KDK +PKG MSAY+ FVQVIREEHK+KHPGEQ+VFS+FSKKCAE+WKLMTPKEKKRFE++A  D++RFNREM +Y P  +G ++ +KR+  K+P  P RAWSAFFFFCDE+R KVRE++PDW+V +IAKELGR WESC DK KYE  ++ DKQRYEE M ++RAG YVP  K+   A SN +++    S   D T V++ 
Sbjct:    5 KDKNKPKGPMSAYSCFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAVLDRERFNREMCDYVPP-DGIKKGKKRKGPKDPSVPARAWSAFFFFCDEFRAKVRESNPDWKVADIAKELGRQWESCQDKAKYELLAQKDKQRYEEDMIKYRAGTYVPREKKLASAVSNSASIRTSESQNPDCTTVTSA 203          
BLAST of High mobility group protein vs. TrEMBL
Match: A0A4S2M7M8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002095 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.236e-73
Identity = 124/202 (61.39%), Postives = 157/202 (77.72%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSA---LIAGSSSTEDPTAVSTG 1290
            KDK RPKGAMSAYA FVQVIREEHK+KHPGEQ+VFS+FSKKCAE+WKLMTPKEKKRFE++AA DK+RFNREM++Y P  EG ++ +KR+  ++PG P+RAWSAFFFFCDE+R KV+E +P+++V ++AKELGR WE+C DK KYE  ++ DKQRYEE M ++RAG YVP  K+P   +       L     S  +PT  + G
Sbjct:    5 KDKNRPKGAMSAYACFVQVIREEHKKKHPGEQIVFSDFSKKCAERWKLMTPKEKKRFEDLAALDKERFNREMSDYVPP-EGMKKGKKRKVPRDPGLPRRAWSAFFFFCDEHRGKVKENNPEFKVADVAKELGRQWEACQDKAKYELLAQQDKQRYEEDMVKYRAGVYVPVQKKPAGATPNPTTLDLTENPGSDRNPTPGTGG 205          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb2a (high mobility group box 2 [Source:NCBI gene;Acc:111195933])

HSP 1 Score: 162.54 bits (410), Expect = 3.018e-46
Identity = 83/166 (50.00%), Postives = 117/166 (70.48%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G  S+YA+FVQ  REEHK+KHPG  V F+EFSKKCAE+WK M+PKEK +FE++A +DK R++REM  Y P        +K ++ K+P  PKR  SAFF FC ++RPKV+  HP   +G+IAK+LG +W  +S  DK  YE+K+   K++YE+ ++ +RA
Sbjct:    3 KDPNKPRGKTSSYAFFVQTCREEHKKKHPGTSVNFAEFSKKCAERWKTMSPKEKTKFEDLAKNDKVRYDREMKTYIPPKG----AKKGKKKKDPNAPKRPPSAFFVFCSDHRPKVKSEHPGISIGDIAKKLGEMWSKQSPKDKAPYEQKAMKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb1a (high mobility group-T protein-like [Source:NCBI gene;Acc:103039534])

HSP 1 Score: 161.77 bits (408), Expect = 4.114e-46
Identity = 91/171 (53.22%), Postives = 119/171 (69.59%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWE--SCTDKEKYEKKSEADKQRYEEQMSQFRAGQYV 1197
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+ KEK +FEEMA  DK R+ REM NY  P GE      K++R K+P  PKR  SAFF FC EYRPKV+E  P   +G++AK+LG +W   S  +K+ YEKK+   K++YE+ ++ +R G+ V
Sbjct:    3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPDTSVNFSEFSKKCSERWKTMSAKEKGKFEEMARLDKARYEREMKNYVPPRGE------KKKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLSIGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKGKVV 167          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb1b (high mobility group protein B1-like [Source:NCBI gene;Acc:103041093])

HSP 1 Score: 155.221 bits (391), Expect = 9.244e-44
Identity = 86/167 (51.50%), Postives = 117/167 (70.06%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY-QPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+PKEK +FE+MA  DK R+ REM NY  P GE      K++R K+P  PKR  SAFF FC +YRPK++  +P   +G+IAK+LG +W S +   K+ YEKK+   K++Y++ ++ +R 
Sbjct:    3 KDPRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSPKEKSKFEDMAKQDKVRYEREMKNYIPPKGE------KKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLSIGDIAKKLGEMWNSSSPEVKQPYEKKAAKLKEKYDKDIAVYRT 163          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: ENSAMXT00000044228.1 (high mobility group protein B2-like [Source:NCBI gene;Acc:103034313])

HSP 1 Score: 147.517 bits (371), Expect = 1.090e-40
Identity = 77/170 (45.29%), Postives = 113/170 (66.47%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWE--SCTDKEKYEKKSEADKQRYEEQMSQFRAGQYV 1197
            KD  +PKG  SAYA+FV   R+E K+K PG  V F +FSKKC+E WK +TP EKK+FE++A +DK R++ EM +Y P    G+  RK+   K+P  PKR  SAFF FC E+RP V+  HP+  +G IAK+LG  W   S  D+  +++K+   +++YE++++ +R+G  V
Sbjct:    3 KDANKPKGRTSAYAFFVLSSRDELKKKSPGTSVNFGKFSKKCSEDWKALTPSEKKKFEDLAKADKARYDEEMKSYVPPKGMGKMGRKK---KDPNAPKRPPSAFFIFCSEHRPAVKSEHPNLTIGEIAKKLGEKWSKLSTKDRSPFDQKAVLLREKYEKEVAAYRSGGSV 169          
BLAST of High mobility group protein vs. Ensembl Cavefish
Match: hmgb3a (high mobility group protein B3 [Source:NCBI gene;Acc:103036962])

HSP 1 Score: 145.206 bits (365), Expect = 5.824e-40
Identity = 76/165 (46.06%), Postives = 109/165 (66.06%), Query Frame = 1
Query:  697 DKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRA 1185
            D  +PKG MSAYAYFVQ  REEHK K P   V F+EFSKKC+ +WK M+ KEK RFE+MA  DK R+++EM +Y  TG+ G++       K+P  PKR  S FF FC ++RPK++  +P   +G +AK+LG +W + TD  K+ Y  KS   K +Y++ ++ +++
Sbjct:    5 DPRKPKGKMSAYAYFVQTCREEHKLKSPEIPVNFAEFSKKCSVRWKAMSGKEKTRFEDMAKQDKVRYDQEMMHY--TGKRGKK-------KDPNAPKRPPSGFFIFCSDHRPKIKAQYPHMGIGEVAKKLGEMWNNLTDAHKQPYVMKSNKLKDKYQQDIADYKS 160          
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 159.458 bits (402), Expect = 4.575e-46
Identity = 88/170 (51.76%), Postives = 114/170 (67.06%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRAGQYVPPVK 1209
            +P+G MS+YAYFVQ  REEHK+KHP   V F+EFSKKC+E+WK M+PKEK RFEEMA +DK RF+REM NY P        + +R+ K+P  PKR  SAFF FC E+RPKV+  HP   +G IAK LG +W   T + K  YEKK+   K++YE+ ++ +R      P K
Sbjct:    8 KPRGKMSSYAYFVQTCREEHKKKHPEASVNFAEFSKKCSERWKTMSPKEKARFEEMAKADKARFDREMKNYVPP-------KGKRKTKDPNAPKRPPSAFFVFCSEHRPKVKADHPGLGIGEIAKRLGEMWGLLTPETKSPYEKKAAKLKEKYEKDVAAYRGKGKAAPSK 170          
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 150.984 bits (380), Expect = 9.498e-43
Identity = 80/158 (50.63%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  721 MSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            MS+YAYFVQ  REEHK+K+P   V F+EFSKKC+E+WK M+ KEK RFE+MA  DK R++REM  Y  P GE G R++     K+P  PKR  SAFF +C EYR KVR  +P   +G+IAK+LG +W +    EK  YE+K+   K++Y++ M+ +R+
Sbjct:   13 MSSYAYFVQTCREEHKKKNPEASVNFAEFSKKCSERWKTMSEKEKTRFEDMAKVDKVRYDREMKTYVPPKGERGSRKK-----KDPNAPKRPPSAFFIYCAEYRSKVRAENPGLTIGSIAKKLGEMWNNAPADEKSIYERKTAKLKEKYDKDMASYRS 165          
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Match: tfam (transcription factor A, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-061013-552])

HSP 1 Score: 48.1358 bits (113), Expect = 2.131e-6
Identity = 27/91 (29.67%), Postives = 49/91 (53.85%), Query Frame = 1
Query:  964 IKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTD--KEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSN 1230
            +  P  PKR  ++FF F  E RP+    +P+ +   I K +   W   +D  KE+Y++ ++AD Q+Y+++  +F   +  P   + R D+N
Sbjct:   36 VPSPTPPKRPLTSFFRFLAEQRPQKTLQYPEMKQTEIIKNISEQWRKMSDVHKERYQESAKADMQKYQDEYQRF-LSRLSPEQIKARKDAN 125          
BLAST of High mobility group protein vs. Ensembl Yeast
Match: NHP6A (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to chromosomes; functionally redundant with Nhp6Bp; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6A has a paralog, NHP6B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006256])

HSP 1 Score: 65.4698 bits (158), Expect = 7.419e-14
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  970 EPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            +P  PKRA SA+ FF +E R  VR  +PD   G + K+LG  W++ T +EK  YE K++ADK+RYE +   + A
Sbjct:   17 DPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNA 90          

HSP 2 Score: 52.373 bits (124), Expect = 3.503e-9
Identity = 28/73 (38.36%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  709 PKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPT 927
            PK A+SAY +F    R+  + ++P   + F +  KK  EKWK +TP+EK+ +E  A +DK R+  E   Y  T
Sbjct:   21 PKRALSAYMFFANENRDIVRSENP--DITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNAT 91          
BLAST of High mobility group protein vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 63.5438 bits (153), Expect = 5.220e-13
Identity = 32/75 (42.67%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  967 KEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            K+P  PKR  SA+ FF +E R  VR  +PD   G + + LG  W++ T +EK  YE K++ADK+RYE +   + A
Sbjct:   22 KDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNA 96          

HSP 2 Score: 44.2838 bits (103), Expect = 2.382e-6
Identity = 26/84 (30.95%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  676 KMSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPT 927
            + + + KD   PK  +SAY +F    R+  + ++P   V F +  +   E+WK +T +EK+ +E  A +DK R+  E   Y  T
Sbjct:   16 RTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENP--DVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNAT 97          
BLAST of High mobility group protein vs. Ensembl Yeast
Match: IXR1 (Transcriptional repressor that regulates hypoxic genes during normoxia; involved in the aerobic repression of genes such as COX5b, TIR1, and HEM13; binds DNA intrastrand cross-links formed by cisplatin; HMG (high mobility group box) domain containing protein which binds and bends cisplatin-modified DNA, blocking excision repair; IXR1 has a paralog, ABF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001515])

HSP 1 Score: 48.9062 bits (115), Expect = 1.517e-6
Identity = 44/152 (28.95%), Postives = 66/152 (43.42%), Query Frame = 1
Query:  709 PKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEE 1164
            PK   SAY  F   IR E  ++ P  +V   E SK  + +WK +T  +KK F E   ++ +++    + Y+ T                  PKR    F  F  E RP V + +PD  +  I K +G  W    D  K  + +E  K+R +E
Sbjct:  361 PKRPSSAYFLFSMSIRNELLQQFPEAKV--PELSKLASARWKELTDDQKKPFYEEFRTNWEKYRVVRDAYEKTLP----------------PKRPSGPFIQFTQEIRPTVVKENPDKGLIEITKIIGERWREL-DPAKKAEYTETYKKRLKE 493          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO36028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW6])

HSP 1 Score: 103.99 bits (258), Expect = 6.423e-26
Identity = 63/165 (38.18%), Postives = 103/165 (62.42%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQ-PTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRAGQ 1191
            +PKGA SAY +F+Q  RE+ +R+    +   ++FSK  AEKWK M+ +EK+ F + A  DK+RF  EM +Y  P  E   +++++++ K+P +PKR  SA+F F +  R  V++ +P+   G ++K LG +W   TD +K  Y+  ++ DK RYE +M  F+ G+
Sbjct:    2 KPKGAKSAYNFFLQDQREKLQREEG--KFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTPPPSEESGKKKRKKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAFKDGK 164          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO39305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG5])

HSP 1 Score: 54.299 bits (129), Expect = 8.808e-10
Identity = 22/66 (33.33%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  982 PKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQF 1179
            PKRA SA+  + ++ R ++++ +P   V  ++K  G +W++ TDK K+E+K+  +KQ+Y ++M ++
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEY 66          

HSP 2 Score: 47.3654 bits (111), Expect = 3.200e-7
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  709 PKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNY 918
            PK AMSAY  ++   R+E K K+PG  +  +E SK   E WK +T K K  +EE AA +K ++ + M  Y
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPG--ISVTEVSKVAGEMWKNLTDKSK--WEEKAAIEKQKYVQRMKEY 66          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO40495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S799])

HSP 1 Score: 49.2914 bits (116), Expect = 2.144e-6
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  967 KEPGQPKRAWSAFFFFCDEYRPKVREAHPDWR--VGN--IAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRAGQYVPPVKR 1212
            K+P  PK+  +AFF FC + R  ++E H D    +G+  + K L + W +    EK  Y +  E DK+RYE +M Q+ + +  PP K+
Sbjct:  109 KDPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLLPDEKKVYYEMYERDKERYELEMKQYSSDK--PPSKK 194          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO41032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L8])

HSP 1 Score: 47.3654 bits (111), Expect = 6.823e-6
Identity = 28/104 (26.92%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  967 KEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESC--TDKEKYEKKSEADKQRYEEQMSQF-RAGQYVPPVKRPRADSNGSALIAGSSSTED 1269
            K+   PK   + +  F +E+R KVR  +PD     + + LG +W       K+ + +++E DK+RY +++ ++ R   Y   + + +A   G A I+ +S   D
Sbjct:   10 KDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQRTDTYKMFIAKQKALKKGRAQISLNSFAMD 113          
BLAST of High mobility group protein vs. Ensembl Nematostella
Match: EDO47230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY4])

HSP 1 Score: 47.3654 bits (111), Expect = 7.404e-6
Identity = 25/78 (32.05%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPT 927
            +D   PK  ++ Y  F+   RE+ + +HP  ++ F E +K    +W  M+  +K+R+ + A  DK+R+  E+ NYQ T
Sbjct:   16 RDTNAPKAPLTGYVQFLNEQREKVRSEHP--ELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYIIELENYQKT 91          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb2a (high mobility group protein B2 [Source:NCBI gene;Acc:101157589])

HSP 1 Score: 159.844 bits (403), Expect = 2.751e-45
Identity = 82/166 (49.40%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLW--ESCTDKEKYEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G  SAYAYFV   REEHK+KHPG  V F+EFSKKC+E+WK M+ KEK +F+E+A +DK R++REM  Y P        +K ++ K+P  PKR  SAFF FC ++RPK++E +P   +G+IAK+LG LW  +S  DK  YE K+   K++YE+ ++ +RA
Sbjct:    3 KDPNKPRGKTSAYAYFVATCREEHKKKHPGTSVNFAEFSKKCSERWKTMSSKEKVKFDELAKTDKARYDREMKTYVPPKG----AKKVKKKKDPNAPKRPPSAFFVFCSDHRPKIKEDNPGISIGDIAKKLGELWATQSAKDKAPYEAKAAKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb1a (high mobility group-T protein [Source:NCBI gene;Acc:101165167])

HSP 1 Score: 153.68 bits (387), Expect = 3.910e-43
Identity = 82/166 (49.40%), Postives = 114/166 (68.67%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCT--DKEKYEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V F+EFSKKC+E+WK M+ KEK +FE+MA  DK R++REM +Y P      +  K ++ K+P  PKR  SAFF FC E+RPKV+   P   +G++AK LG +W S +  DK+ YEKK+   K++Y + ++ +RA
Sbjct:    3 KDPTKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFEDMARQDKVRYDREMMSYVPA-----KGAKTKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLTIGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYRA 163          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmgb1b (high mobility group protein B1 [Source:NCBI gene;Acc:101156596])

HSP 1 Score: 152.525 bits (384), Expect = 8.219e-43
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEK--YEKKSEADKQRYEEQMSQFRA 1185
            KD  +P+G MS+YAYFVQ  REEHK+KHP   V FSEFSKKC+E+WK M+PKEK +FE+MA  DK R+ REM NY P      + +K++R K+P  PKR  SAFF FC ++RPK++   P   +G+ AK+LG +W S + +EK  YEKK+   K++Y++ +  +R 
Sbjct:    3 KDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFEDMAKQDKVRYEREMKNYVPP-----KGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLSIGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRT 163          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmg20a (high mobility group 20A [Source:NCBI gene;Acc:101158691])

HSP 1 Score: 49.2914 bits (116), Expect = 4.681e-6
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPT 927
            KD   PK  ++ Y  F+   RE+ + + P   V F E ++    +W  + P+EK+R+ + A  DK+R+ RE+  YQ T
Sbjct:   40 KDSNAPKAPLTGYVRFMNDRREQLRAERP--DVPFPEITRMLGNEWSKLPPEEKQRYLDEAERDKERYMRELEKYQKT 115          
BLAST of High mobility group protein vs. Ensembl Medaka
Match: hmg20a (high mobility group 20A [Source:NCBI gene;Acc:101158691])

HSP 1 Score: 49.2914 bits (116), Expect = 4.681e-6
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  694 KDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPT 927
            KD   PK  ++ Y  F+   RE+ + + P   V F E ++    +W  + P+EK+R+ + A  DK+R+ RE+  YQ T
Sbjct:   40 KDSNAPKAPLTGYVRFMNDRREQLRAERP--DVPFPEITRMLGNEWSKLPPEEKQRYLDEAERDKERYMRELEKYQKT 115          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000052032.1 (SMESG000052032.1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:  679 MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSSTEDPTAVSTGAPVIXXXXXXXXXXXXXXXXXXXXXVIKDDDRKETQVKGDPAEGENIYLKSASGENHATKTPQINCDSSIKSDEINLNSNVSAKESVIG 1557
            MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGRRRRKRRRIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSSTEDPTAVSTGAPVIDEEDLEDDEEYDEEAGEVDDEVIKDDDRKETQVKGDPAEGENIYLKSASGENHATKTPQINCDSSIKSDEINLNSNVSAKESVIG
Sbjct:    1 MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGRRRRKRRRIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSSTEDPTAVSTGAPVIDEEDLEDDEEYDEEAGEVDDEVIKDDDRKETQVKGDPAEGENIYLKSASGENHATKTPQINCDSSIKSDEINLNSNVSAKESVIG 293          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000034017.1 (SMESG000034017.1)

HSP 1 Score: 201.445 bits (511), Expect = 4.675e-61
Identity = 99/173 (57.23%), Postives = 133/173 (76.88%), Query Frame = 1
Query:  712 KGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVP-PVKRPRADS 1227
            K AM+AY YFV++IR+EH++KHP EQ  F+EFS KCAEKWK M P+E+KRFEE+A+        E N+ +P G   R R+++++   PGQPKRAWSAFF+FCDE RPKVR+ HPDWRV  +A+ELGRLWE+C+D+++YEK +  DK+RYE++M QFRAG +V    KRP+ D+
Sbjct:   10 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDKKPPGRKKRTRKRQKKA--PGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN 172          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000023365.1 (SMESG000023365.1)

HSP 1 Score: 196.438 bits (498), Expect = 1.802e-59
Identity = 102/186 (54.84%), Postives = 140/186 (75.27%), Query Frame = 1
Query:  691 DKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIA 1248
            +KD  RPKGAMSAYA FVQVIRE++K KHP E VVFSEFSKKCAEKW+ + PKEKK+FE+MAA DK R+ +EMN Y P   GG +  KR++ ++P QPKR  SAFF +  E+R ++++ HPDWRVG+IAKELG+ WE+C DK KYE+ +  +K+R+E +M ++++G +VP  K+ +   +G+  I 
Sbjct:    4 NKDFNRPKGAMSAYACFVQVIREKYKNKHPDEAVVFSEFSKKCAEKWRQLGPKEKKQFEDMAAVDKARYIKEMNEYVPP--GGVKPNKRKQPRDPAQPKRGLSAFFLYSQEFRGQIKDEHPDWRVGDIAKELGKRWETCADKGKYEELARREKERFEREMDEYKSGTFVPYCKKDKIMRDGNETIG 187          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000068286.1 (SMESG000068286.1)

HSP 1 Score: 196.438 bits (498), Expect = 2.229e-59
Identity = 89/164 (54.27%), Postives = 134/164 (81.71%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYV 1197
            +PKGA + YA FVQV+REEHK+KHP EQ+VFSEFSK+C+EKWK M+PKEK+RF ++AA DK+R+ +EM+NYQP        + +R+IK+P +PK AW+AFFFF DE+R K++E +P+++VG++AK LG++WE+C DK KYE++++ DK+RY +++ ++++G  V
Sbjct:    5 KPKGAKTPYACFVQVVREEHKKKHPDEQIVFSEFSKRCSEKWKEMSPKEKQRFMDIAAKDKERYLKEMDNYQPPA----GTKNKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPV 164          
BLAST of High mobility group protein vs. Planmine SMEST
Match: SMESG000020771.1 (SMESG000020771.1)

HSP 1 Score: 139.428 bits (350), Expect = 3.667e-38
Identity = 70/173 (40.46%), Postives = 115/173 (66.47%), Query Frame = 1
Query:  706 RPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQP-TGEGGXXXXXXXXIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVPPVKRPRA 1221
            +P GA SAY  + Q +REE+K+K+P  +V F+E SK  +EKWK ++ KEK+++  +A +DK R+ +EM  Y+P T      ++ +R  K+P +PK   +AFFFF +E+R  V+E +P+++VG+IAK LG++W  C DK KYE+ ++  K++Y   M +++ G   P  K+ +A
Sbjct:    5 KPSGAKSAYIIYTQAVREEYKKKNPDGKVNFTEISKIASEKWKNISDKEKEKYNVLAQADKKRYTKEMEGYEPETDNRKPSKKAKREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNG--APSAKKSKA 175          
The following BLAST results are available for this feature:
BLAST of High mobility group protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGB25.516e-4448.48high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB25.516e-4448.48high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB25.516e-4448.48high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB15.581e-4450.00high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB15.581e-4450.00high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmg-1.21.272e-4044.25High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.295e-4044.25High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.295e-4044.25High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.564e-4044.83High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.564e-4044.83High mobility group protein 1.2 [Source:UniProtKB... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsp12.223e-4854.94gene:FBgn0278608 transcript:FBtr0289960[more]
Dsp12.337e-4854.94gene:FBgn0278608 transcript:FBtr0089259[more]
Dsp12.337e-4854.94gene:FBgn0278608 transcript:FBtr0089260[more]
Dsp12.337e-4854.94gene:FBgn0278608 transcript:FBtr0089261[more]
Dsp12.393e-4854.94gene:FBgn0278608 transcript:FBtr0089262[more]
back to top
BLAST of High mobility group protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a3.214e-4448.80high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb1a7.098e-4452.10high mobility group box 1a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb1a7.098e-4452.10high mobility group box 1a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb1a7.098e-4452.10high mobility group box 1a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b1.748e-4348.80high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep170b1.458e-4549.40centrosomal protein 170B [Source:Xenbase;Acc:XB-GE... [more]
hmgb21.225e-4247.95high mobility group box 2 [Source:NCBI gene;Acc:39... [more]
hmgb32.301e-3843.95high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
hmgb31.681e-3746.36high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmgb11.559e-4447.98high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb13.832e-4450.00high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb13.832e-4450.00high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb13.832e-4450.00high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb21.010e-4249.09high mobility group box 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of High mobility group protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24537|HMG2_DROME3.123e-4754.94High mobility group protein DSP1 OS=Drosophila mel... [more]
sp|P26584|HMGB2_CHICK6.511e-4549.12High mobility group protein B2 OS=Gallus gallus OX... [more]
sp|P26583|HMGB2_HUMAN2.649e-4348.48High mobility group protein B2 OS=Homo sapiens OX=... [more]
sp|P40673|HMGB2_BOVIN2.649e-4348.48High mobility group protein B2 OS=Bos taurus OX=99... [more]
sp|P63159|HMGB1_RAT2.680e-4350.00High mobility group protein B1 OS=Rattus norvegicu... [more]
back to top
BLAST of High mobility group protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5AFA84.840e-7661.76Uncharacterized protein (Fragment) OS=Protopolysto... [more]
C1LIA12.711e-7462.19High mobility group protein DSP1 OS=Schistosoma ja... [more]
A0A0R3UE707.458e-7462.37Uncharacterized protein OS=Mesocestoides corti OX=... [more]
Q5DA811.099e-7362.00High mobility group protein DSP1 OS=Schistosoma ja... [more]
A0A4S2M7M81.236e-7361.39Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a3.018e-4650.00high mobility group box 2 [Source:NCBI gene;Acc:11... [more]
hmgb1a4.114e-4653.22high mobility group-T protein-like [Source:NCBI ge... [more]
hmgb1b9.244e-4451.50high mobility group protein B1-like [Source:NCBI g... [more]
ENSAMXT00000044228.11.090e-4045.29high mobility group protein B2-like [Source:NCBI g... [more]
hmgb3a5.824e-4046.06high mobility group protein B3 [Source:NCBI gene;A... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmgb2a4.575e-4651.76high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b9.498e-4350.63high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
tfam2.131e-629.67transcription factor A, mitochondrial [Source:ZFIN... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NHP6A7.419e-1444.59High-mobility group (HMG) protein; binds to and re... [more]
NHP6B5.220e-1342.67High-mobility group (HMG) protein; binds to and re... [more]
IXR11.517e-628.95Transcriptional repressor that regulates hypoxic g... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360286.423e-2638.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393058.808e-1033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404952.144e-635.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410326.823e-626.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472307.404e-632.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of High mobility group protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2a2.751e-4549.40high mobility group protein B2 [Source:NCBI gene;A... [more]
hmgb1a3.910e-4349.40high mobility group-T protein [Source:NCBI gene;Ac... [more]
hmgb1b8.219e-4350.00high mobility group protein B1 [Source:NCBI gene;A... [more]
hmg20a4.681e-633.33high mobility group 20A [Source:NCBI gene;Acc:1011... [more]
hmg20a4.681e-633.33high mobility group 20A [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of High mobility group protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052032.10.000e+0100.00SMESG000052032.1[more]
SMESG000034017.14.675e-6157.23SMESG000034017.1[more]
SMESG000023365.11.802e-5954.84SMESG000023365.1[more]
SMESG000068286.12.229e-5954.27SMESG000068286.1[more]
SMESG000020771.13.667e-3840.46SMESG000020771.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018630 ID=SMED30018630|Name=High mobility group protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1718bp
TGAAAATTTGTTATTGTTGTTCGTAAATAAATAAAATTTGAATATTATTT
TTCAACTAAGTAAAACTAAATATTTTAAATAAAATATGAAATCAATGAAT
GGCCAGATAGAAAGAAAAATGTTAATTAATGATTTTCTTTCACATAAAGT
AAACGAGAAAATGTCCTTCCCTTACTTAAAAAAAAATTGAAACAATCTAT
GATTAGTCATTAAAACCATTTTAGAGTAGAAGCAGATACCTTGTTCGTAT
GACACAGATAATTAACATCATAAAATTGCGCATACACTCACTGGTGTTGA
TTTGTACTTGTATTTCAATAATCACGGGTAACAAAAGGGATAGAGTTTAA
TGGCTTGTGTAGAAAAATACACACAAGAGTTTGTATGCGGTTTAGTGTGC
GTATTTGGTATTCTGAACGTCCACATGCCCTTAAATGTAGAATGTGTATC
TTATATTCAGCTCAGCGTTAGTTATATTACACAAGCTATAGCTAACAGTG
TCTAGCTCTAAATCATAATCCTTATCTAGCTACATATACAGAACACAGCA
ATTGCCTATATGTTAGCTAAGTTAATATAGGTTATATTAAAGAGTCACAG
TTTTATGCTATGCCTTTAGTTTTGCAAAGCCGGGACATATTTGTTATTTG
AAATAATATTTAGCTTTTCGTTTATAAAATGTCTGTTCAAGATAAAGATA
AACCTAGACCAAAGGGTGCCATGTCAGCTTATGCTTATTTCGTGCAAGTT
ATCCGAGAGGAACATAAGCGAAAGCATCCAGGAGAACAAGTAGTTTTCAG
TGAATTTTCAAAGAAATGTGCAGAGAAATGGAAATTGATGACTCCTAAAG
AAAAGAAAAGATTTGAAGAAATGGCGGCTAGTGACAAAGATCGATTTAAT
AGAGAAATGAATAACTATCAGCCTACCGGGGAAGGTGGACGTCGACGAAG
AAAAAGAAGGCGAATTAAAGAACCGGGACAACCAAAGCGAGCTTGGTCTG
CATTTTTCTTTTTCTGTGACGAATATAGACCTAAAGTAAGAGAAGCCCAT
CCTGATTGGAGAGTTGGAAATATAGCGAAAGAATTGGGTCGATTATGGGA
ATCATGTACAGATAAAGAGAAATATGAAAAAAAATCAGAAGCGGATAAAC
AAAGATATGAAGAGCAAATGTCTCAGTTCAGAGCTGGTCAATATGTTCCG
CCCGTCAAGCGCCCGAGAGCAGATTCCAATGGTAGTGCTTTAATAGCTGG
TAGTTCAAGCACTGAGGATCCTACCGCGGTTTCAACTGGTGCTCCAGTTA
TAGATGAAGAAGATCTAGAAGATGATGAAGAATATGATGAAGAAGCGGGT
GAAGTAGATGATGAAGTAATTAAGGATGATGATAGAAAAGAAACACAGGT
TAAAGGCGATCCTGCGGAGGGTGAAAACATTTATTTAAAATCAGCTTCTG
GTGAAAATCATGCTACCAAAACCCCTCAAATAAATTGCGACAGTTCAATT
AAATCCGATGAAATAAATTTAAATTCTAATGTTTCAGCCAAGGAATCAGT
CATTGGATAATTTATGTACATTTATAAAATCATGTTTCATGTACTTAACG
TTGTAGTAAAATATCGCTATTACATTTCTATTTTAATTAAATATAGTCCA
TTAGTCCGTAATTTTGATTTACAAAACTTATGGTTAAGTTACACTGTTAA
ATTCTAACTTTAATTTTG
back to top

protein sequence of SMED30018630-orf-1

>SMED30018630-orf-1 ID=SMED30018630-orf-1|Name=SMED30018630-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=294bp
MSVQDKDKPRPKGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEK
WKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGRRRRKRRRIKEPG
QPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYE
KKSEADKQRYEEQMSQFRAGQYVPPVKRPRADSNGSALIAGSSSTEDPTA
VSTGAPVIDEEDLEDDEEYDEEAGEVDDEVIKDDDRKETQVKGDPAEGEN
IYLKSASGENHATKTPQINCDSSIKSDEINLNSNVSAKESVIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 146..166
NoneNo IPR availablePRINTSPR00886HIGHMOBLTY12coord: 42..64
score: 64.25
coord: 117..135
score: 40.94
coord: 135..154
score: 25.93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 148..269
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..201
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 208..229
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 230..244
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 148..163
NoneNo IPR availablePANTHERPTHR13711SWI/SNF-RELATED CHROMATIN BINDING PROTEINcoord: 4..81
coord: 82..237
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 102..165
e-value: 2.4387E-19
score: 78.0533
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 11..77
e-value: 1.33176E-17
score: 73.4309
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 10..82
e-value: 4.9E-19
score: 79.2
coord: 101..169
e-value: 6.5E-19
score: 78.8
IPR009071High mobility group box domainPFAMPF09011HMG_box_2coord: 9..80
e-value: 2.0E-21
score: 76.4
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 102..168
e-value: 1.7E-18
score: 66.8
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 11..81
score: 16.48
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 102..168
score: 17.049
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 1..82
e-value: 2.5E-29
score: 103.5
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 85..170
e-value: 1.7E-22
score: 81.5
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 90..169
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 5..83