smedxin-11

Overview
Namesmedxin-11 (ABI30950.1)
Smed IDSMED30018622
Length (bp)1733
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of smedxin-11 (SMED30018622) t-SNE clustered cells

Violin plots show distribution of expression levels for smedxin-11 (SMED30018622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of smedxin-11 (SMED30018622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for smedxin-11 (SMED30018622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30018622SMESG000034762.1 DQ851133smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30018622SMESG000034762.1 DQ851133smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30018622SMESG000034762.1 SmedASXL_006972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018622SMESG000034762.1 SmedASXL_006972SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018622SMESG000034762.1 dd_Smed_v4_2810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30018622SMESG000034762.1 CUFF.236310.1be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of smedxin-11 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 172.94 bits (437), Expect = 2.930e-48
Identity = 119/395 (30.13%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  303 RVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMP---NDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNM--IKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQ 1472
            RVD  D  DK++   T AI+F F+ +++ K Y   P++C    A     +E Y  ++CWV     L      P    DR     + + I+YY W+P +L ++ L FY+P + W+    +  G ++ +L  ++  A     ++R+ +V+ IA  +E+   + R+                V  +   KR  N +  +Y+ +K++Y+   V Q++ +   L  DN F+  FH + + +  G +W  +  FPRV  C   +R LGN+ + H  QCVL IN+ NEKI++FL+ W +++  +S V + +WI II F  P Q+M  I+ YL+  ++ T  +   + KF+ +F+  DG+F ++MI  +AGD+L   ++  LW  +  + R I F++TE L+ 
Sbjct:   16 RVD-DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVP-AQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-----RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQRE-------------VTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYG-FH-ILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNV-HHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWI-IISF-LPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTESLNH 383          
BLAST of smedxin-11 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 172.94 bits (437), Expect = 2.930e-48
Identity = 119/395 (30.13%), Postives = 208/395 (52.66%), Query Frame = 3
Query:  303 RVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMP---NDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNM--IKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQ 1472
            RVD  D  DK++   T AI+F F+ +++ K Y   P++C    A     +E Y  ++CWV     L      P    DR     + + I+YY W+P +L ++ L FY+P + W+    +  G ++ +L  ++  A     ++R+ +V+ IA  +E+   + R+                V  +   KR  N +  +Y+ +K++Y+   V Q++ +   L  DN F+  FH + + +  G +W  +  FPRV  C   +R LGN+ + H  QCVL IN+ NEKI++FL+ W +++  +S V + +WI II F  P Q+M  I+ YL+  ++ T  +   + KF+ +F+  DG+F ++MI  +AGD+L   ++  LW  +  + R I F++TE L+ 
Sbjct:   16 RVD-DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVP-AQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-----RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQRE-------------VTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYG-FH-ILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNV-HHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWI-IISF-LPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTESLNH 383          
BLAST of smedxin-11 vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 165.622 bits (418), Expect = 1.444e-45
Identity = 107/368 (29.08%), Postives = 195/368 (52.99%), Query Frame = 3
Query:  318 DLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIY 1421
            D+ DK++   T AI+ +F+ L++ K Y   P++C    A      E Y  ++CWV     L   + +P+  N+   + + I YY W+P +L ++ L FY+P + W+   S++ G  + +L+ ++  +    +ESR+ +++ IAT VE   H+      G          K + L++  + SG  +  +Y+ +K++Y    V Q++ +   L   +K++ +  QV   +  G +W  + +FPRV  C   ++ LGN+ + H  QCVL IN+ NEKI++FL+ W +LL   ++  L  WIYI      + N +  YL G      ++   + +F+  F+R DG+FLL+M+  +AG++    + + LW+ Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVP-ATFTEPMEQYTENYCWVQNTYFLPLHDYIPH--NYAERENRQIGYYQWVPFVLALEALLFYVPTIVWR-LLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSG-------NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGL--QVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNV-HRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of smedxin-11 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 163.696 bits (413), Expect = 1.781e-44
Identity = 114/383 (29.77%), Postives = 200/383 (52.22%), Query Frame = 3
Query:  303 RVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMP---NDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNM--IKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYR 1436
            RVD  D  DK++   T AI+F F+ +++ K Y   P++C    A     +E Y  ++CWV     L      P    DR     + + I+YY W+P +L ++ L FY+P + W+    +  G ++ +L  ++  A     ++R+ +V+ IA  +E+   + R+                V  +   KR  N +  +Y+ +K++Y+   V Q++ +   L  DN F+  FH + + +  G +W  +  FPRV  C   +R LGN+ + H  QCVL IN+ NEKI++FL+ W +++  +S V + +WI II F  P Q+M  I+ YL+  ++ T  +   + KF+ +F+  DG+F ++MI  +AGD+L   ++  LW  +  + R
Sbjct:   16 RVD-DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVP-AQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDR-----RARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQRE-------------VTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYG-FH-ILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNV-HHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWI-IISF-LPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVR 371          
BLAST of smedxin-11 vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 148.673 bits (374), Expect = 5.658e-40
Identity = 94/323 (29.10%), Postives = 172/323 (53.25%), Query Frame = 3
Query:  453 ENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIY 1421
            E Y  ++CWV     L   + +P+  N+   + + I YY W+P +L ++ L FY+P + W+   S++ G  + +L+ ++  +    +ESR+ +++ IAT VE   H+      G          K + L++  + SG  +  +Y+ +K++Y    V Q++ +   L   +K++ +  QV   +  G +W  + +FPRV  C   ++ LGN+ + H  QCVL IN+ NEKI++FL+ W +LL   ++  L  WIYI      + N +  YL G      ++   + +F+  F+R DG+FLL+M+  +AG++    + + LW+ Y
Sbjct:    2 EQYTENYCWVQNTYFLPLHDYIPH--NYAERENRQIGYYQWVPFVLALEALLFYVPTIVWR-LLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSG-------NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGL--QVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNV-HRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 311          
BLAST of smedxin-11 vs. Ensembl Fly
Match: zpg (gene:FBgn0024177 transcript:FBtr0076983)

HSP 1 Score: 65.4698 bits (158), Expect = 4.687e-11
Identity = 67/301 (22.26%), Postives = 113/301 (37.54%), Query Frame = 3
Query:  306 VDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWV---------------NGIVPLGPDELM----PNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYG--SDWN--STKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEK 1139
            V + D    + S VTVA+L   + L++ K YF  P++C            +Y+ +FCW+               NG     PD +     P +RN+       I YY W+ ++L ++   FY+P   W+    ++GG   H   D  K A       +  S   +  +V N F       H R                            Y+  +++ ++IS+     +         FW  +      ++ G  + WN  +   FP+   C++         N +   C+LP+NILNEK
Sbjct:   17 VHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKD------MDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNY-------ITYYQWVVLVLLLESFVFYMPAFLWK---IWEGGRLKHLCDDFHKMAV-----CKDKSRTHLRVLV-NYFSSDYKETHFR------------------------YFVSYVFCEILNLSISILNFLLLDVFF---GGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEK 268          
BLAST of smedxin-11 vs. Ensembl Fly
Match: zpg (gene:FBgn0024177 transcript:FBtr0330185)

HSP 1 Score: 65.4698 bits (158), Expect = 4.687e-11
Identity = 67/301 (22.26%), Postives = 113/301 (37.54%), Query Frame = 3
Query:  306 VDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWV---------------NGIVPLGPDELM----PNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYG--SDWN--STKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEK 1139
            V + D    + S VTVA+L   + L++ K YF  P++C            +Y+ +FCW+               NG     PD +     P +RN+       I YY W+ ++L ++   FY+P   W+    ++GG   H   D  K A       +  S   +  +V N F       H R                            Y+  +++ ++IS+     +         FW  +      ++ G  + WN  +   FP+   C++         N +   C+LP+NILNEK
Sbjct:   17 VHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKD------MDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNY-------ITYYQWVVLVLLLESFVFYMPAFLWK---IWEGGRLKHLCDDFHKMAV-----CKDKSRTHLRVLV-NYFSSDYKETHFR------------------------YFVSYVFCEILNLSISILNFLLLDVFF---GGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEK 268          
BLAST of smedxin-11 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 57.3806 bits (137), Expect = 1.878e-8
Identity = 70/285 (24.56%), Postives = 112/285 (39.30%), Query Frame = 3
Query:  330 KMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGI--VP------LGPDELMPN--DRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWN---STKYFPRVGYCKVTLRSLGNMGN--SHITQCVLPINILNEK 1139
            +M    TV IL  FS L+  + Y   P++C+  + P        M ++CW+     VP       G D + P          + K   YY W+  +L  Q + FY+P+  W+   S++GG     ++DL+     +PI +      D   ++ + F          I  L R  F      V    +   ++G               Q+YF+     LD +F +    V +      D       + FP+V  C  T    G  G+  +H   CVLP+NI+NEK
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPL-----GVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLN-----SPIVN-DECKNDRKKILVDYF----------IGNLNRHNFYAFRFFVCEALNFVNVIG---------------QIYFVD--FFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKC--TFHKYGPSGSVQTHDGLCVLPLNIVNEK 266          
BLAST of smedxin-11 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 57.3806 bits (137), Expect = 1.878e-8
Identity = 70/285 (24.56%), Postives = 112/285 (39.30%), Query Frame = 3
Query:  330 KMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGI--VP------LGPDELMPN--DRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWN---STKYFPRVGYCKVTLRSLGNMGN--SHITQCVLPINILNEK 1139
            +M    TV IL  FS L+  + Y   P++C+  + P        M ++CW+     VP       G D + P          + K   YY W+  +L  Q + FY+P+  W+   S++GG     ++DL+     +PI +      D   ++ + F          I  L R  F      V    +   ++G               Q+YF+     LD +F +    V +      D       + FP+V  C  T    G  G+  +H   CVLP+NI+NEK
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPL-----GVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLN-----SPIVN-DECKNDRKKILVDYF----------IGNLNRHNFYAFRFFVCEALNFVNVIG---------------QIYFVD--FFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKC--TFHKYGPSGSVQTHDGLCVLPLNIVNEK 266          
BLAST of smedxin-11 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 57.3806 bits (137), Expect = 1.878e-8
Identity = 70/285 (24.56%), Postives = 112/285 (39.30%), Query Frame = 3
Query:  330 KMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGI--VP------LGPDELMPN--DRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWN---STKYFPRVGYCKVTLRSLGNMGN--SHITQCVLPINILNEK 1139
            +M    TV IL  FS L+  + Y   P++C+  + P        M ++CW+     VP       G D + P          + K   YY W+  +L  Q + FY+P+  W+   S++GG     ++DL+     +PI +      D   ++ + F          I  L R  F      V    +   ++G               Q+YF+     LD +F +    V +      D       + FP+V  C  T    G  G+  +H   CVLP+NI+NEK
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPL-----GVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK---SWEGGRLKMLVMDLN-----SPIVN-DECKNDRKKILVDYF----------IGNLNRHNFYAFRFFVCEALNFVNVIG---------------QIYFVD--FFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKC--TFHKYGPSGSVQTHDGLCVLPLNIVNEK 266          
BLAST of smedxin-11 vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.837e-44
Identity = 107/368 (29.08%), Postives = 195/368 (52.99%), Query Frame = 3
Query:  318 DLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIY 1421
            D+ DK++   T AI+ +F+ L++ K Y   P++C    A      E Y  ++CWV     L   + +P+  N+   + + I YY W+P +L ++ L FY+P + W+   S++ G  + +L+ ++  +    +ESR+ +++ IAT VE   H+      G          K + L++  + SG  +  +Y+ +K++Y    V Q++ +   L   +K++ +  QV   +  G +W  + +FPRV  C   ++ LGN+ + H  QCVL IN+ NEKI++FL+ W +LL   ++  L  WIYI      + N +  YL G      ++   + +F+  F+R DG+FLL+M+  +AG++    + + LW+ Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVP-ATFTEPMEQYTENYCWVQNTYFLPLHDYIPH--NYAERENRQIGYYQWVPFVLALEALLFYVPTIVWR-LLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSG-------NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGL--QVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNV-HRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of smedxin-11 vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 9.812e-35
Identity = 108/407 (26.54%), Postives = 196/407 (48.16%), Query Frame = 3
Query:  279 TLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLV-WGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIID-----KFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKEN 1481
             L+P  D      D  DK++   T  IL  F+ L++ K Y   P++C    A      E Y  ++CWV     +   E +P  R     + + I YY W+P IL I+ L FY+P + W+    +  G +L  L+ ++  A     E ++ +V  +A  +++   L   ++ G      R  F  + L    G+  G  +  +Y+ +K++Y A  + Q + +  +L  ++  +     + + + +  +W  T  FPRV  C   +R LGN+ + H  QCVL IN+ NEKI++FL+ W     ++++   + WI I+       + ++ YL  + +     +PI D     KF   F+R DG+F+L+MI  +AG+++++ ++  LW      +  +D S T+  D +  
Sbjct:  132 ALYPRLD-----DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIP--REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGF--SLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNI-HRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYL--RVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ----DFNNVDRSPTQFWDAEHG 517          
BLAST of smedxin-11 vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.450e-34
Identity = 104/406 (25.62%), Postives = 195/406 (48.03%), Query Frame = 3
Query:  318 DLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDA-PKVLNFENYMTSFCWVNGIVPLGPDE---LMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVL------TKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPG 1505
            D +D+++  +T  IL  FS LI++K +   P+EC+  +  P   ++E Y  ++CW      + P +   L+  +  +     + ++YY W+P  L +Q  FF  P   W+ Y S   G  +H +++ +K ++    E R  ++  +   + +      + +  ++     ++ K V  L +   SG  I  +Y+  K++Y      QLY M   L  +   W  F  V Q I  G  W  + YFPR   C   +R + N+   +  QCVL INI NEKI++ L+ W  +L++ S V L+ W  ++ F C  +  +K +L    +       ++ E+  + KF+T+++  DG+F+L+M+  +AG +    +V+ L+  Y  + +  D   +   D  + ++   E  
Sbjct:   21 DWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG--SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERY--TPDRQLSYYQWVPFFLLLQAAFFRAPSYLWK-YFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKV-----QVHKTVTFLNFQYSSG-FISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFG-VVQDIVQGEPWERSGYFPRAAVCDFEVRQVANI-QRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDLQTISTGAESS 413          
BLAST of smedxin-11 vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 137.117 bits (344), Expect = 9.041e-34
Identity = 120/434 (27.65%), Postives = 203/434 (46.77%), Query Frame = 3
Query:  318 DLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASK-APIESRSNSVKDIATMVENLFHLHRDNQHGRISE---LKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWI-----------YIICF----RCPKQNMIKLYLKGKNV-----LTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPS 1547
            D  D+++   T  IL +   +I+ K Y  +P+EC  +   +  + E Y+ S+CW+     +   E +P+D      + K I YY W+P IL  + L F LP ++W+  CS++ G ++  LI+ +  A        R  +V+ I     +   L   N  GRI     + R  F R         SG  I  VY   KL+Y    V Q + +   L+  ++F     QV   I+ G  W  T +FPRV  C   +R L N+ N +  QC L INI+NEK++ FL+ W  +L +++    + WI           Y++ F       +   ++ + K   V     +      ++D F+++F++ DGI +L+MI  +AGD++   +V NLW  Y+ +  + +F   E  + K+    R++    +I I +  Q  S
Sbjct:   22 DAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPHSRE-SMEEYIESYCWIQNTYWIPMYENVPDDHT--AREEKQIGYYQWVPFILIAEALMFSLPCIFWR-LCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPN--GRIRARGWIARIKFSRF-------LSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANL-NRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER-NWREFEEHE--EMKDVEMRRIQGTRERIVIANPGQTKS 437          
BLAST of smedxin-11 vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 5.348e-33
Identity = 100/367 (27.25%), Postives = 172/367 (46.87%), Query Frame = 3
Query:  312 LQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLW 1412
              D  D++S   T  +L  FS +++ K Y  S ++C      K   +E Y   +C++     +     +P D      +   I YY W+PI+L IQ   FYLP   W      + G D  ++I  ++       E+R+  V  +   + ++      N++GR    +           +GK  G+    +Y+ +KLMY+A    Q   + K L  +   W  FH  F  ++ G +W  +  FPRV  C  ++R L N+ + +  QCVL IN+ NEKIY+F++ W   +++ + +  L  IY + F   + N I+  L G     K E+ +I  F    ++ DG+ L++ I  +AG ++T  + E L+
Sbjct:   20 FDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVE--DRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYK-QCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWG-FH-TFADLYAGREWQDSGVFPRVTLCDFSVRKLANV-HRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELF 368          
BLAST of smedxin-11 vs. TrEMBL
Match: A7RDN9 (Innexin OS=Schmidtea mediterranea OX=79327 GN=inx PE=2 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 3
Query:  267 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL
Sbjct:    3 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 437          
BLAST of smedxin-11 vs. TrEMBL
Match: Q2L6M4 (Innexin OS=Dugesia japonica OX=6161 GN=inx11 PE=2 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 287/435 (65.98%), Postives = 356/435 (81.84%), Query Frame = 3
Query:  270 DIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVT-LRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            D+F   P  + R  LQD AD+M STVTV ILFIFS+L+AYKTYFISPMEC ++DAP + N + Y+TS+CWV G V L  D+  P D  W+  K KSINYYPWIPIILGIQC FFYLP L W+EYC YKGGTDL NLI++S  ASKA +  R + +KDI++++ENLFHLHR+N+HG I E++R +FK++PLL+WGKRSGN ILG+YM++KL++I IS+FQ +FM KVLQLDN F S+F+ VF HIF+G DW +TKYFPRVGYC++T +RS+G + N ++ QCVLPINILNEKI+IFLFLW+++LI+LS++Y L+WI+IIC + PK  MIKLYLKGKN+ +K+EEP+IDKFI EFIRLDGIFLLKMIRIN GDV+TA VVE LWS+YK+KYRY+DFS  E  DQKENL LRLEPG+ KIS KSKI  PSAP+KD FL
Sbjct:    4 DLFEFIPWKESRAHLQDFADRMCSTVTVIILFIFSTLVAYKTYFISPMECFSTDAPNIQNLDKYITSYCWVEGTVDLAADKRTPTDNEWDTMKLKSINYYPWIPIILGIQCAFFYLPNLIWREYCFYKGGTDLQNLIEMSLNASKASMNERPSMIKDISSLIENLFHLHRENRHGLIPEVRRIVFKKMPLLIWGKRSGNAILGMYMVIKLLFIGISIFQCFFMVKVLQLDNSFMSVFYDVFGHIFHGIDWRATKYFPRVGYCRLTGMRSVGVINNKYVAQCVLPINILNEKIFIFLFLWMFMLIILSLIYFLSWIHIICCQPPKIRMIKLYLKGKNIFSKVEEPLIDKFINEFIRLDGIFLLKMIRINVGDVVTAGVVEQLWSLYKSKYRYVDFSCMESSDQKENLTLRLEPGEQKISTKSKIHTPSAPSKDSFL 438          
BLAST of smedxin-11 vs. TrEMBL
Match: Q2L6M7 (Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 5.601e-81
Identity = 142/388 (36.60%), Postives = 238/388 (61.34%), Query Frame = 3
Query:  306 VDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRN----WNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYC-KVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSN 1454
            V ++D ADKM+   +V ++ +   ++  K+YF  P+ C  +  P    F+NY+ ++CWV+G +P+ P E +P   N    W+    K I YY W+P ILG+QC+ FY PK+ WQ  C  K GT+L NL++ ++ ASK+P E R   +  I+  +E++ + HRD + G+I+  +R ++ R   LV+ K  G  ++  Y  +K++Y    + QLY MK  L  DN      + + +++  G +W+ T  FPRV YC    +R LG+  N++++QC LPIN+LNEKIY+FL+ W+ L+ +++++ +++W+  + F   + + IK  LK      + ++ ++++FI E++R DG+FL++MI INAGD++TA ++  LW IYK KY   DF N
Sbjct:   19 VGVEDFADKMNFMFSVVLIILSMMVVTVKSYFFKPLSCYIATTPSGSGFDNYIENYCWVHGTIPILPGENIPQKTNEWAEWD--ANKRITYYQWVPFILGLQCIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKSPPEDRKALLDRISRTIEDMLYQHRDYRQGKIANTRRALYSRCNFLVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFDNSLTYFGYTILENMLNGKEWHQTGIFPRVSYCYNADIRHLGST-NAYVSQCTLPINMLNEKIYVFLWFWVLLVGIITLISIISWLIKMVFLSKRSSFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLIRMICINAGDIVTAEILGTLWEIYKEKYIDSDFRN 403          
BLAST of smedxin-11 vs. TrEMBL
Match: Q2L6M6 (Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.124e-80
Identity = 146/393 (37.15%), Postives = 239/393 (60.81%), Query Frame = 3
Query:  285 FPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPN-DRNWNIA-KTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKV-TLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSN 1454
            F LT + V ++D ADK++   +V IL I   ++  K+YF  P+ C  +  P   NF+NY+ ++CWV+G + + P E +P  D +W I  +TK I YY W+P ILG+QC+ FY+P++ WQ  C  K GT+L +L   +  AS +P   R + ++ I   +E++   HRD + G++++++R ++K     V+ K  G  ++  Y+LMK MY    + QL+ MKK L  ++   S  + +  +I  G +W+ T  FPRV YC +  ++ LG   N ++ QC LPIN+LNEKIY+FL+ W++L+ +++ + +  W + I     + + IK +L       + ++ +I+ FI EF+R DG+FL++MI INAGD++TA +V  LW IYK  Y+ +DF N
Sbjct:   13 FKLTSY-VGVEDFADKLNFLFSVVILIISMMVVTVKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDADWAIVDQTKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPSERKDKIERIVRTIEDMLFQHRDYRQGKMADMRRNIYKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLG-ASNKYVGQCALPINMLNEKIYVFLWFWVFLVGIITAISIPMWFFRIAILSRRSSFIKKFLMMHQAYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKNMDFLN 403          
BLAST of smedxin-11 vs. TrEMBL
Match: A0A564YPR7 (Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.701e-80
Identity = 159/430 (36.98%), Postives = 252/430 (58.60%), Query Frame = 3
Query:  291 LTDHRVD----LQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMP-NDRNWNIA-KTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIA-TMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVT-LRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPT 1556
            LT  RV+    L+D ADKMS   +V IL + +++IA K Y ++ + C     P   +F+ ++ +FCWV+G +PL   E +P N   W+ A K   INYY W+P +LG+QC+ FY+P++ WQ  C  + GTDL NLI ++  AS      R + VK +A TM E LF  HRD + GR+++ +RK FK   + V  KR G  ++  Y+ +K +Y+A ++ QLY M+  L  +    +  ++V +++  G DW+ T+ FPRV +C V  +R LG   N ++ QCVLP+N+LNEK+YIFL+ W  ++   + V +  WI  +  +  K++ IK +L+ + +    +  I+  F ++F+R DG+FLL+MI +NAGDV+TA V+  +W IYK K++     N    D   N  ++LE G      +S  +  S+  
Sbjct:   10 LTKLRVNDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFDKFLQNFCWVHGTIPLLEGEHIPQNFSEWDEADKNLRINYYQWVPFMLGLQCILFYIPRVIWQIICYNRTGTDLENLISIANKASNTIEGDRQSLVKHVAGTMAEMLFQ-HRDYRVGRVADARRKAFKFCGVFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMTNFGYEVAKYMINGKDWDETRIFPRVSFCYVEHVRHLGTT-NRYVAQCVLPVNMLNEKLYIFLWFWTAIVAFCTAVSIPLWIMRLGRQKNKEHFIKKFLRLQEIYNTKDREILHNFTSDFLRHDGVFLLRMISMNAGDVVTADVIVKMWDIYKTKFKNRIMLNDIARDIM-NQKMQLESGGETTQRRSPYEKKSSAV 436          
BLAST of smedxin-11 vs. Planmine SMEST
Match: SMESG000034762.1 (SMESG000034762.1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 3
Query:  267 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL
Sbjct:    3 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 437          
BLAST of smedxin-11 vs. Planmine SMEST
Match: SMESG000034762.1 (SMESG000034762.1)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 3
Query:  267 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL
Sbjct:   52 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 486          
BLAST of smedxin-11 vs. Planmine SMEST
Match: SMESG000034762.1 (SMESG000034762.1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 3
Query:  267 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL
Sbjct:   58 TDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFLWIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 492          
BLAST of smedxin-11 vs. Planmine SMEST
Match: SMESG000055270.1 (SMESG000055270.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 281/435 (64.60%), Postives = 341/435 (78.39%), Query Frame = 3
Query:  270 DIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCK-VTLRSLGNMGNSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTECLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL 1571
            DIF+LFPL + RV LQDL DKMSS VTVA+LF+ S+L AYKTYFISP+EC  SD P   NF  YMTS+CWV+GI+P    E +P+ + WN AK++SINYYPWIPIILGIQC  FYLPKL+WQEYCS+K G+DL N+ID S +AS+A IE+R  +VK I+T +E LF+ HRD ++G I  LKRK FK  PLL+WGKR GNGILGVYM +KL  I+I+ FQLYFMK+VLQLDN+F S+F  VF HIF+G  WNSTKYFPRVG C+ V +RS G   NS+++QCVLPINILNEKIYIFLF+W+ LLI  S  YL  W+YII FR PKQ MI  YL GKN  +K+E+PII KFITEF+RLDGIFLLKMIRIN+GDVLTAC+VENLW+ Y  KYR+IDFSN+   DQ EN A++L P + K+ I  K + PSAP K+M++
Sbjct:    4 DIFSLFPLKESRVHLQDLGDKMSSAVTVALLFLLSTLTAYKTYFISPLECFTSDGPNHPNFVQYMTSYCWVDGIIPFEVGESLPDRKYWNNAKSRSINYYPWIPIILGIQCFLFYLPKLFWQEYCSFKAGSDLQNIIDSSISASRASIEARDQAVKIISTRIEYLFNFHRDYENGIIPVLKRKCFKSCPLLIWGKRFGNGILGVYMFVKLSNISIACFQLYFMKRVLQLDNEFLSVFGHVFAHIFHGHSWNSTKYFPRVGNCRLVGIRSAGVSDNSYVSQCVLPINILNEKIYIFLFMWMLLLIAFSSFYLFYWLYIISFRAPKQKMIAKYLNGKNTFSKIEKPIIGKFITEFLRLDGIFLLKMIRINSGDVLTACIVENLWNTYTTKYRFIDFSNSRSSDQAENFAIKLIPVNQKMLINPKTEVPSAPLKEMYI 438          
BLAST of smedxin-11 vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 275.404 bits (703), Expect = 2.682e-86
Identity = 148/401 (36.91%), Postives = 243/401 (60.60%), Query Frame = 3
Query:  306 VDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISPMECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMP-NDRNWNIAK-TKSINYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAPIESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRSGNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYGSDWNSTKYFPRVGYCKVTLRSLGNMG--NSHITQCVLPINILNEKXXXXXXXXXXXXXXXXXXXXXNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDKFITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSN----TECLDQKENL 1484
            V ++D ADK+S   +V +L +   ++  K+Y   P+ C  + AP   NFENY+ ++CWV+G +   P E +P ND +W  A  T+ INYY W+P ILG+QC  FY+PK+ WQ  C  K GT+L ++++ +  A+  P   R + ++ IA  +E++   HRD + G  ++L+RK++      V+ K  G  ++  Y+L+K +Y    + QL+ MKK L  +N   S  + V  ++  G +W+ T  FPRV YC V  R++ ++G  N ++ QC LP+N+LNEKIY+FL+ W+ L+ +++ + +  W Y + F   +   IK +L       + ++P+I+ FI EF+R DG+FL++M+ INAGD++TA +V  L  IYK  Y+++DF N    T+ LD+  +L
Sbjct:   19 VGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYV--RNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDL 417          
The following BLAST results are available for this feature:
BLAST of smedxin-11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-12.930e-4830.13Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.930e-4830.13Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-91.444e-4529.08Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-11.781e-4429.77Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-95.658e-4029.10Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
back to top
BLAST of smedxin-11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zpg4.687e-1122.26gene:FBgn0024177 transcript:FBtr0076983[more]
zpg4.687e-1122.26gene:FBgn0024177 transcript:FBtr0330185[more]
Inx21.878e-824.56gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.878e-824.56gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.878e-824.56gene:FBgn0027108 transcript:FBtr0332314[more]
back to top
BLAST of smedxin-11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.837e-4429.08Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL9.812e-3526.54Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL1.450e-3425.62Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR9.041e-3427.65Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|Q19746|INX3_CAEEL5.348e-3327.25Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of smedxin-11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RDN90.000e+0100.00Innexin OS=Schmidtea mediterranea OX=79327 GN=inx ... [more]
Q2L6M40.000e+065.98Innexin OS=Dugesia japonica OX=6161 GN=inx11 PE=2 ... [more]
Q2L6M75.601e-8136.60Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 S... [more]
Q2L6M61.124e-8037.15Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 S... [more]
A0A564YPR71.701e-8036.98Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=... [more]
back to top
BLAST of smedxin-11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of smedxin-11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034762.10.000e+0100.00SMESG000034762.1[more]
SMESG000034762.10.000e+0100.00SMESG000034762.1[more]
SMESG000034762.10.000e+0100.00SMESG000034762.1[more]
SMESG000055270.10.000e+064.60SMESG000055270.1[more]
SMESG000080788.12.682e-8636.91SMESG000080788.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018622
GenBankABI30950.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018622 ID=SMED30018622|Name=smedxin-11|organism=Schmidtea mediterranea sexual|type=transcript|length=1733bp
TATCATTGAGATAAAATTTATTTACTAGTAAATAAAATACAAAAGGGTAT
CCCAAAAGAATGACATTATAAATTAAATTTATATACATATTCCAAATACC
ATTCTCTGATTATCAAACCATCTAGCTTCAAAAGTATAATTAATTTTGAA
TTATTTCTTGAAATAAGATTTTCTTTGCTATAAAAGTAGTATTATTTTTT
TACTATGTATTTTTAGTTCGATTTTTGAATTTTTTTATAATTAAAAAGCA
AAAAATAAAAATGATAACCGATATTTTCACTCTTTTCCCACTGACAGATC
ATCGGGTAGATCTGCAGGATTTAGCAGATAAAATGTCATCAACAGTTACT
GTGGCAATATTGTTCATCTTTTCTTCTTTGATTGCATATAAAACATATTT
CATTTCTCCAATGGAATGCCTTGCTTCTGATGCGCCGAAAGTTTTAAATT
TCGAAAATTACATGACGAGCTTTTGTTGGGTTAATGGAATAGTGCCACTG
GGCCCCGATGAATTGATGCCCAATGATAGAAATTGGAATATCGCTAAAAC
TAAAAGTATAAATTATTATCCTTGGATTCCAATCATCCTCGGCATTCAAT
GCCTTTTTTTTTATTTACCCAAACTCTACTGGCAGGAATATTGTTCCTAT
AAAGGTGGAACTGATTTGCATAACCTTATTGACCTATCGAAAACCGCATC
AAAAGCACCAATCGAATCTCGATCTAATTCAGTGAAAGATATTGCAACAA
TGGTGGAAAACCTATTCCATTTACATCGGGATAATCAACACGGTAGAATC
TCGGAATTGAAGCGAAAAATGTTTAAAAGGGTCCCTTTACTAGTATGGGG
AAAGCGATCGGGTAACGGGATTTTGGGTGTTTACATGCTCATGAAACTCA
TGTATATCGCAATATCAGTTTTCCAATTATATTTCATGAAAAAAGTTTTG
CAATTGGACAATAAATTCTGGTCGATTTTTCACCAGGTTTTCCAACATAT
TTTTTACGGATCTGACTGGAACTCAACGAAATATTTCCCTAGAGTAGGAT
ATTGTAAAGTCACATTAAGATCTCTTGGTAATATGGGAAATTCCCATATT
ACTCAATGCGTTCTTCCTATTAATATTCTCAATGAAAAAATCTACATATT
TCTTTTTCTCTGGATTTGGTTGCTAATAGTATTGTCGATAGTTTATTTGC
TCAATTGGATTTACATAATTTGTTTCCGGTGCCCTAAGCAAAATATGATA
AAGTTGTATCTGAAAGGGAAAAATGTTCTCACAAAACTCGAAGAGCCAAT
AATTGATAAATTTATCACAGAGTTCATTCGTCTCGATGGGATTTTTCTTT
TGAAAATGATTCGAATAAATGCTGGAGATGTTTTGACAGCTTGCGTCGTG
GAGAACCTTTGGAGTATCTATAAGGCTAAATATCGGTATATTGATTTTTC
TAATACTGAATGTCTTGACCAAAAAGAAAACTTGGCATTACGACTTGAGC
CTGGCGATCCGAAAATATCAATAAAATCCAAAATCCAGCCGCCTTCTGCT
CCAACAAAAGACATGTTTTTGTAGCAATTTTCTATTGTTATTTGTATTGA
AAATTTTTGTAACCAGCTTTTTTTAGGAATTTTTCAATTTATAAATAAAT
TTGGATATTTACTTTGCTTTTTACCTGAAATTTTGTCATTCAAATTTCAA
TAATTTAAGTGTTTATAATAAAATGTTTTGTTT
back to top

protein sequence of SMED30018622-orf-1

>SMED30018622-orf-1 ID=SMED30018622-orf-1|Name=SMED30018622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
MITDIFTLFPLTDHRVDLQDLADKMSSTVTVAILFIFSSLIAYKTYFISP
MECLASDAPKVLNFENYMTSFCWVNGIVPLGPDELMPNDRNWNIAKTKSI
NYYPWIPIILGIQCLFFYLPKLYWQEYCSYKGGTDLHNLIDLSKTASKAP
IESRSNSVKDIATMVENLFHLHRDNQHGRISELKRKMFKRVPLLVWGKRS
GNGILGVYMLMKLMYIAISVFQLYFMKKVLQLDNKFWSIFHQVFQHIFYG
SDWNSTKYFPRVGYCKVTLRSLGNMGNSHITQCVLPINILNEKIYIFLFL
WIWLLIVLSIVYLLNWIYIICFRCPKQNMIKLYLKGKNVLTKLEEPIIDK
FITEFIRLDGIFLLKMIRINAGDVLTACVVENLWSIYKAKYRYIDFSNTE
CLDQKENLALRLEPGDPKISIKSKIQPPSAPTKDMFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 102..124
score: 44.87
coord: 258..267
score: 47.6
coord: 283..299
score: 61.18
coord: 42..53
score: 34.33
coord: 208..222
score: 32.0
IPR000990InnexinPFAMPF00876Innexincoord: 20..387
e-value: 1.2E-91
score: 307.7
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 15..399
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 14..393
score: 26.868
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 26..48
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 100..119