Cystathionine gamma-lyase

Overview
NameCystathionine gamma-lyase
Smed IDSMED30018617
Length (bp)1316
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cystathionine gamma-lyase (SMED30018617) t-SNE clustered cells

Violin plots show distribution of expression levels for Cystathionine gamma-lyase (SMED30018617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cystathionine gamma-lyase (SMED30018617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cystathionine gamma-lyase (SMED30018617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30018617SMESG000054395.1 dd_Smed_v4_2859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018617SMESG000054395.1 dd_Smed_v4_2859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018617SMESG000054395.1 dd_Smed_v4_2859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018617SMESG000054395.1 dd_Smed_v6_2859_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018617SMESG000054395.1 OX_Smed_1.0.20380ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cystathionine gamma-lyase vs. Ensembl Human
Match: CTH (cystathionine gamma-lyase [Source:HGNC Symbol;Acc:HGNC:2501])

HSP 1 Score: 367.081 bits (941), Expect = 5.633e-124
Identity = 177/365 (48.49%), Postives = 254/365 (69.59%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVG 1240
             AT AIH G    +   T   V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKYC +++SGLA   +IT LLK+GD ++  +DVYGGT RYF +VA++F +    +D   + L++ ++ P TK+VWIETP+NP  +++DIE    I  + + D I+VVDNTF++P FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N + +   L+  Q  +GAVPSP DC+L  RGL+TL VRM  H  +G+AVA FL  +P +EKV++P L S  + +++++Q TG +GM++ Y+KG+ +    F+++LK F +AESLGG+ESL E+P++MTHASV    R +LGI+D L+R+SVG
Sbjct:   18 FATQAIHVGQDPEQ--WTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHK-HGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVG 379          
BLAST of Cystathionine gamma-lyase vs. Ensembl Human
Match: CTH (cystathionine gamma-lyase [Source:HGNC Symbol;Acc:HGNC:2501])

HSP 1 Score: 315.464 bits (807), Expect = 4.006e-104
Identity = 161/365 (44.11%), Postives = 230/365 (63.01%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVG 1240
             AT AIH G    +   T   V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKYC                                T RYF +VA++F +    +D   + L++ ++ P TK+VWIETP+NP  +++DIE    I  + + D I+VVDNTF++P FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N + +   L+  Q  +GAVPSP DC+L  RGL+TL VRM  H  +G+AVA FL  +P +EKV++P L S  + +++++Q TG +GM++ Y+KG+ +    F+++LK F +AESLGG+ESL E+P++MTHASV    R +LGI+D L+R+SVG
Sbjct:   18 FATQAIHVGQDPEQ--WTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYC--------------------------------TNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHK-HGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVG 347          
BLAST of Cystathionine gamma-lyase vs. Ensembl Human
Match: CTH (cystathionine gamma-lyase [Source:HGNC Symbol;Acc:HGNC:2501])

HSP 1 Score: 290.426 bits (742), Expect = 1.470e-94
Identity = 153/365 (41.92%), Postives = 221/365 (60.55%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVG 1240
             AT AIH G    +   T   V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKYC +++SGLA   +IT LLK+GD ++  +DVYGGT RYF +VA++F +    +D   + L++ ++                                             TP  + P+ LGADI M+S TKYMNGHSDV+MG  ++N + +   L+  Q  +GAVPSP DC+L  RGL+TL VRM  H  +G+AVA FL  +P +EKV++P L S  + +++++Q TG +GM++ Y+KG+ +    F+++LK F +AESLGG+ESL E+P++MTHASV    R +LGI+D L+R+SVG
Sbjct:   18 FATQAIHVGQDPEQ--WTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAI---------------------------------------------TPETKRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVG 335          
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Match: cth-2 (Putative cystathionine gamma-lyase 2 [Source:UniProtKB/Swiss-Prot;Acc:P55216])

HSP 1 Score: 404.831 bits (1039), Expect = 2.281e-139
Identity = 197/367 (53.68%), Postives = 269/367 (73.30%), Query Frame = 2
Query:  149 ATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAA-KFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
             T AIH G +  +     + V+PPISLS+T+ Q  P  P  +DYSRAGN  R++L+  +AA+E+AK+C  +SSGLA  S+I  LLK GDH++  +DVYGGT RY  +VA     +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF++P FQ P++LGAD+V+HS+TKY+NGHSDV+MGA   +N E  + L   QL VGAVPSPFDCFL  RGL+TL +RM  H  + LAVA +L  + +IE VL+PAL S  + +V EKQ  G SGM+S Y+KG  +++  F+ +LK F +AESLGGYESL E+PS+MTHASVP E R +LGITDNL+RISVG+E
Sbjct:    8 GTAAIHVGQEPEQ--WDMNQVVPPISLSSTYKQDNPGEPKGHDYSRAGNPTRDVLQKNLAALEDAKHCQVFSSGLAATSAIINLLKYGDHIVCSDDVYGGTQRYIRRVAVPNHGLEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKKANPEIVVVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAVITDNDEFQQHLFFMQLAVGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSHPQHEVHEKQTKGMSGMISFYLKGELQESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLGITDNLIRISVGIE 372          
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Match: cth-2 (Putative cystathionine gamma-lyase 2 [Source:UniProtKB/Swiss-Prot;Acc:P55216])

HSP 1 Score: 404.831 bits (1039), Expect = 2.281e-139
Identity = 197/367 (53.68%), Postives = 269/367 (73.30%), Query Frame = 2
Query:  149 ATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAA-KFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
             T AIH G +  +     + V+PPISLS+T+ Q  P  P  +DYSRAGN  R++L+  +AA+E+AK+C  +SSGLA  S+I  LLK GDH++  +DVYGGT RY  +VA     +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF++P FQ P++LGAD+V+HS+TKY+NGHSDV+MGA   +N E  + L   QL VGAVPSPFDCFL  RGL+TL +RM  H  + LAVA +L  + +IE VL+PAL S  + +V EKQ  G SGM+S Y+KG  +++  F+ +LK F +AESLGGYESL E+PS+MTHASVP E R +LGITDNL+RISVG+E
Sbjct:    8 GTAAIHVGQEPEQ--WDMNQVVPPISLSSTYKQDNPGEPKGHDYSRAGNPTRDVLQKNLAALEDAKHCQVFSSGLAATSAIINLLKYGDHIVCSDDVYGGTQRYIRRVAVPNHGLEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKKANPEIVVVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAVITDNDEFQQHLFFMQLAVGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSHPQHEVHEKQTKGMSGMISFYLKGELQESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLGITDNLIRISVGIE 372          
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Match: cth-1 (CystaTHionine gamma lyase [Source:UniProtKB/TrEMBL;Acc:O45391])

HSP 1 Score: 394.045 bits (1011), Expect = 4.347e-135
Identity = 188/347 (54.18%), Postives = 253/347 (72.91%), Query Frame = 2
Query:  209 VIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAK-FNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
            V+PPIS+STT+ Q  P  P +YDY+R GN  R++L+  +AA+E AK+C ++SSGLA  S++  LL  GDH++  +DVYGGT RY  ++A K + +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF+TP FQ P++LGADI +HS+TKY+NGHSD++MGAA  NN E  + L   Q  +G VPSPFDCFL  RGL+TL VRM  H  + LA+A FL  H  IE VL+PAL S  +  V  KQ  G SGM+S Y+KG    +  F+ +LK F +AESLGG ESL E+PS+MTHASVP   RA LGITDNL+RISVG+E
Sbjct:   26 VVPPISMSTTYKQDNPGEPKRYDYARGGNPTRDVLQKNLAALEGAKHCQAFSSGLAASSAVINLLNHGDHIVCSDDVYGGTIRYIRQIAVKKYGMEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKRANPEIVVVVDNTFMTPYFQRPLSLGADIAVHSITKYINGHSDIIMGAAITNNDEFQQHLHFMQRAIGGVPSPFDCFLVNRGLKTLHVRMKAHFENALAIAKFLEAHDCIESVLYPALPSHPQHTVHVKQTKGMSGMISFYLKGELCQSRAFLSALKVFTLAESLGGCESLAELPSIMTHASVPSATRAELGITDNLIRISVGIE 372          
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Match: cth-1 (CystaTHionine gamma lyase [Source:UniProtKB/TrEMBL;Acc:O45391])

HSP 1 Score: 394.045 bits (1011), Expect = 4.347e-135
Identity = 188/347 (54.18%), Postives = 253/347 (72.91%), Query Frame = 2
Query:  209 VIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAK-FNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
            V+PPIS+STT+ Q  P  P +YDY+R GN  R++L+  +AA+E AK+C ++SSGLA  S++  LL  GDH++  +DVYGGT RY  ++A K + +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF+TP FQ P++LGADI +HS+TKY+NGHSD++MGAA  NN E  + L   Q  +G VPSPFDCFL  RGL+TL VRM  H  + LA+A FL  H  IE VL+PAL S  +  V  KQ  G SGM+S Y+KG    +  F+ +LK F +AESLGG ESL E+PS+MTHASVP   RA LGITDNL+RISVG+E
Sbjct:   26 VVPPISMSTTYKQDNPGEPKRYDYARGGNPTRDVLQKNLAALEGAKHCQAFSSGLAASSAVINLLNHGDHIVCSDDVYGGTIRYIRQIAVKKYGMEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKRANPEIVVVVDNTFMTPYFQRPLSLGADIAVHSITKYINGHSDIIMGAAITNNDEFQQHLHFMQRAIGGVPSPFDCFLVNRGLKTLHVRMKAHFENALAIAKFLEAHDCIESVLYPALPSHPQHTVHVKQTKGMSGMISFYLKGELCQSRAFLSALKVFTLAESLGGCESLAELPSIMTHASVPSATRAELGITDNLIRISVGIE 372          
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Match: cth-1 (CystaTHionine gamma lyase [Source:UniProtKB/TrEMBL;Acc:O45391])

HSP 1 Score: 383.259 bits (983), Expect = 2.895e-131
Identity = 183/341 (53.67%), Postives = 247/341 (72.43%), Query Frame = 2
Query:  227 LSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAK-FNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
            +STT+ Q  P  P +YDY+R GN  R++L+  +AA+E AK+C ++SSGLA  S++  LL  GDH++  +DVYGGT RY  ++A K + +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF+TP FQ P++LGADI +HS+TKY+NGHSD++MGAA  NN E  + L   Q  +G VPSPFDCFL  RGL+TL VRM  H  + LA+A FL  H  IE VL+PAL S  +  V  KQ  G SGM+S Y+KG    +  F+ +LK F +AESLGG ESL E+PS+MTHASVP   RA LGITDNL+RISVG+E
Sbjct:    1 MSTTYKQDNPGEPKRYDYARGGNPTRDVLQKNLAALEGAKHCQAFSSGLAASSAVINLLNHGDHIVCSDDVYGGTIRYIRQIAVKKYGMEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKRANPEIVVVVDNTFMTPYFQRPLSLGADIAVHSITKYINGHSDIIMGAAITNNDEFQQHLHFMQRAIGGVPSPFDCFLVNRGLKTLHVRMKAHFENALAIAKFLEAHDCIESVLYPALPSHPQHTVHVKQTKGMSGMISFYLKGELCQSRAFLSALKVFTLAESLGGCESLAELPSIMTHASVPSATRAELGITDNLIRISVGIE 341          
BLAST of Cystathionine gamma-lyase vs. Ensembl Fly
Match: Eip55E (gene:FBgn0000566 transcript:FBtr0345422)

HSP 1 Score: 407.912 bits (1047), Expect = 1.842e-140
Identity = 198/383 (51.70%), Postives = 267/383 (69.71%), Query Frame = 2
Query:  140 SKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLD 1288
            S  AT +IHSG    +       VIPPISLSTTF Q  P     Y+YSR+GN  R +LE   AA++NAKY  ++SSGL   +++  +L SGDH+++ +DVYGGT R   +VA +  I    +D   LDL+K+S+KP TK+VWIE+P+NPL+++ DIEAI ++      D ++ VDNTFLT  FQ P+ LGAD+V +SLTKYMNGH+DV+MG   MN++++++SLK  Q  VG VPSPFDC+   R L+TL +RM  HQ + L VA +L  +P +EKVLHP+L S  + K+  KQ  GYSG+ S Y+KG  + +  F+++LK F +AESLGGYESL E+PS+MTHASVP E R  LGITD LVR+SVGLED   +++DLEQ L+
Sbjct:    8 SGFATKSIHSGQSPDQWKSAA--VIPPISLSTTFKQDAPGEHRGYEYSRSGNPTRNVLETCFAALDNAKYGLTFSSGLGATTAVLTMLSSGDHIIMGDDVYGGTNRLIRQVATRLGISATFVDPTKLDLIKSSIKPETKLVWIESPTNPLVKVADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMNSEKLYKSLKFLQNAVGIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSLPSHPQHKIALKQAYGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSIMTHASVPAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQALE 388          
BLAST of Cystathionine gamma-lyase vs. Ensembl Fly
Match: Eip55E (gene:FBgn0000566 transcript:FBtr0086710)

HSP 1 Score: 407.912 bits (1047), Expect = 1.842e-140
Identity = 198/383 (51.70%), Postives = 267/383 (69.71%), Query Frame = 2
Query:  140 SKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLD 1288
            S  AT +IHSG    +       VIPPISLSTTF Q  P     Y+YSR+GN  R +LE   AA++NAKY  ++SSGL   +++  +L SGDH+++ +DVYGGT R   +VA +  I    +D   LDL+K+S+KP TK+VWIE+P+NPL+++ DIEAI ++      D ++ VDNTFLT  FQ P+ LGAD+V +SLTKYMNGH+DV+MG   MN++++++SLK  Q  VG VPSPFDC+   R L+TL +RM  HQ + L VA +L  +P +EKVLHP+L S  + K+  KQ  GYSG+ S Y+KG  + +  F+++LK F +AESLGGYESL E+PS+MTHASVP E R  LGITD LVR+SVGLED   +++DLEQ L+
Sbjct:    8 SGFATKSIHSGQSPDQWKSAA--VIPPISLSTTFKQDAPGEHRGYEYSRSGNPTRNVLETCFAALDNAKYGLTFSSGLGATTAVLTMLSSGDHIIMGDDVYGGTNRLIRQVATRLGISATFVDPTKLDLIKSSIKPETKLVWIESPTNPLVKVADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMGGITMNSEKLYKSLKFLQNAVGIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETNPFVEKVLHPSLPSHPQHKIALKQAYGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGGYESLAELPSIMTHASVPAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQALE 388          
BLAST of Cystathionine gamma-lyase vs. Ensembl Zebrafish
Match: cth (cystathionase (cystathionine gamma-lyase) [Source:ZFIN;Acc:ZDB-GENE-030131-774])

HSP 1 Score: 394.815 bits (1013), Expect = 4.848e-135
Identity = 197/384 (51.30%), Postives = 263/384 (68.49%), Query Frame = 2
Query:  134 INSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
            I    AT AIH G +  +   +   V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKYC + +SGLA   +IT L KSGD +L  NDVYGGT RYF KVA++  +     D+  L+ +K  LKPNTKMVWIETP+NP M++VDI+A   I  + N DTIVVVDNTF++  FQ P+ LGADI M+S TKYMNGHSDV+MG  +++  +++E LK  Q  +GAVPSPFDC++  RGL+TL +RM  H  + LA A FL   P++++V+ P L S  + ++ ++Q TG  GM++ Y+KG  E   TF+ +LK F +AESLGGYESL E P++MTHASV  E+R  LGI+D L+R+SVGLED   I+ DL+Q L
Sbjct:   16 IYKSFATDAIHVGSEPEQ--WSSMAVVPPISLSTTFKQHGPGKHAGFEYSRSGNPTRNCLEKAVAALDGAKYCLAVASGLAATLTITHLFKSGDGILCMNDVYGGTNRYFRKVASEVGLDISFADLTKLEELKAGLKPNTKMVWIETPTNPTMKVVDIQACADIVHKHNKDTIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLISLSRDDLYERLKFLQNSLGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAAAQFLEADPRVDRVIFPGLPSHPQHELTKRQCTGCPGMITFYIKGKLEHASTFLSNLKLFALAESLGGYESLAEHPAIMTHASVCEEERKKLGISDTLIRLSVGLEDEEDIIADLDQAL 397          
BLAST of Cystathionine gamma-lyase vs. Ensembl Zebrafish
Match: cthl (cystathionase (cystathionine gamma-lyase), like [Source:ZFIN;Acc:ZDB-GENE-040905-3])

HSP 1 Score: 368.622 bits (945), Expect = 9.109e-125
Identity = 182/380 (47.89%), Postives = 255/380 (67.11%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH G +  +   +   V+PPISLSTTF Q  P     Y+Y + GN  R  LE  +A ++ AKYC +++SG+A  ++IT LLK GD ++   D+YGGT  YF ++  +F+I    +D   L+ +K +LK NTKMVW ETP+NP +++VDI+A   I  + N DT+VVVDNTF++P FQ P+ LGADI M S TKYMNGHSDVLMG  ++N +++++ LK  Q  VGAVPSPFDC++  RGL+TL +RM  H  + LAVA FL   P+++ V+ P L S  + ++ ++Q  G SGM+S Y+KG  E   TF+ +LK   +AESLGG ESL ++P+ M H S+  ++R  LGI+D L+R+SVGLED   I+ DL+Q L
Sbjct:   20 FATNAIHVGSEPEQ--WSSMAVVPPISLSTTFKQHGPGKHEGYEYIKTGNPTRNCLERAVACLDGAKYCVAFASGIAATATITHLLKHGDGIVCMYDIYGGTKEYFREIITEFDIDASFVDFTKLEELKAALKQNTKMVWFETPTNPTLKVVDIQACADIVHKHNKDTLVVVDNTFMSPYFQRPLALGADICMCSGTKYMNGHSDVLMGLISVNREDLYKRLKVLQNAVGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAVAQFLEADPRVDSVIFPGLPSHPQHELAKRQCRGCSGMVSFYIKGQLEHASTFLSNLKVVALAESLGGIESLAKLPATMPHVSLSKDEREKLGISDTLIRLSVGLEDEEDIIADLDQAL 397          
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Match: smim12 (small integral membrane protein 12 [Source:Xenbase;Acc:XB-GENE-5841153])

HSP 1 Score: 385.185 bits (988), Expect = 2.920e-131
Identity = 189/380 (49.74%), Postives = 263/380 (69.21%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH+G +  +       V+PPI+LSTTF Q  P     Y+YSR+GN  R  LE  +AA++ AKYC SY+SGLA   +I  LLK+GD ++   DVYGGT RYF +VA++  +    +D  +L  ++ ++  NTK+VWIETP+NP + ++DI+    I  + + D I+ VDNTFL+  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N  +++E LK  Q  +GAVPSPFDC+L  RGL+TL +RM  H  + LAVA FL   P+++KVL+P L S  + ++ ++Q TG SGM++ Y+KG+ E   TF++SLK F +AESLGGYESL E P++MTHA+VP E RA L I+D L+R+S+GLED+  I+ DL+Q L
Sbjct:   11 FATEAIHAGQEPEQWKSMA--VVPPITLSTTFKQFGPGEHAGYEYSRSGNPTRNSLEKAVAALDGAKYCLSYASGLAATMNIAHLLKAGDQIICTKDVYGGTNRYFRRVASEMGLKVAFVDCSDLKSLEAAIAANTKLVWIETPTNPTLTVIDIKGCADIIHK-HKDIILAVDNTFLSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSVNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRVDKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYESLAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQAL 387          
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Match: smim12 (small integral membrane protein 12 [Source:Xenbase;Acc:XB-GENE-5841153])

HSP 1 Score: 385.185 bits (988), Expect = 4.242e-131
Identity = 189/380 (49.74%), Postives = 263/380 (69.21%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH+G +  +       V+PPI+LSTTF Q  P     Y+YSR+GN  R  LE  +AA++ AKYC SY+SGLA   +I  LLK+GD ++   DVYGGT RYF +VA++  +    +D  +L  ++ ++  NTK+VWIETP+NP + ++DI+    I  + + D I+ VDNTFL+  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N  +++E LK  Q  +GAVPSPFDC+L  RGL+TL +RM  H  + LAVA FL   P+++KVL+P L S  + ++ ++Q TG SGM++ Y+KG+ E   TF++SLK F +AESLGGYESL E P++MTHA+VP E RA L I+D L+R+S+GLED+  I+ DL+Q L
Sbjct:   11 FATEAIHAGQEPEQWKSMA--VVPPITLSTTFKQFGPGEHAGYEYSRSGNPTRNSLEKAVAALDGAKYCLSYASGLAATMNIAHLLKAGDQIICTKDVYGGTNRYFRRVASEMGLKVAFVDCSDLKSLEAAIAANTKLVWIETPTNPTLTVIDIKGCADIIHK-HKDIILAVDNTFLSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSVNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRVDKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYESLAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQAL 387          
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Match: smim12 (small integral membrane protein 12 [Source:Xenbase;Acc:XB-GENE-5841153])

HSP 1 Score: 384.8 bits (987), Expect = 5.397e-131
Identity = 189/380 (49.74%), Postives = 263/380 (69.21%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH+G +  +       V+PPI+LSTTF Q  P     Y+YSR+GN  R  LE  +AA++ AKYC SY+SGLA   +I  LLK+GD ++   DVYGGT RYF +VA++  +    +D  +L  ++ ++  NTK+VWIETP+NP + ++DI+    I  + + D I+ VDNTFL+  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N  +++E LK  Q  +GAVPSPFDC+L  RGL+TL +RM  H  + LAVA FL   P+++KVL+P L S  + ++ ++Q TG SGM++ Y+KG+ E   TF++SLK F +AESLGGYESL E P++MTHA+VP E RA L I+D L+R+S+GLED+  I+ DL+Q L
Sbjct:   17 FATEAIHAGQEPEQWKSMA--VVPPITLSTTFKQFGPGEHAGYEYSRSGNPTRNSLEKAVAALDGAKYCLSYASGLAATMNIAHLLKAGDQIICTKDVYGGTNRYFRRVASEMGLKVAFVDCSDLKSLEAAIAANTKLVWIETPTNPTLTVIDIKGCADIIHK-HKDIILAVDNTFLSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSVNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRVDKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYESLAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQAL 393          
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Match: smim12 (small integral membrane protein 12 [Source:Xenbase;Acc:XB-GENE-5841153])

HSP 1 Score: 348.591 bits (893), Expect = 4.573e-117
Identity = 179/379 (47.23%), Postives = 255/379 (67.28%), Query Frame = 2
Query:  149 ATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
            AT AIH+G +  +       V+PPI+LSTTF Q  P     Y+YSR+GN  R  LE  +AA++ AKYC SY+SGLA   +I  LLK+GD ++   DVYGGT RYF +VA++  +    +D  +L  ++ ++  NTK+VWIETP+NP + ++DI+    I  + + D I+ VDNTFL  +FQL         M+ L  +++GHSDV+MG  ++N  +++E LK  Q  +GAVPSPFDC+L  RGL+TL +RM  H  + LAVA FL   P+++KVL+P L S  + ++ ++Q TG SGM++ Y+KG+ E   TF++SLK F +AESLGGYESL E P++MTHA+VP E RA L I+D L+R+S+GLED+  I+ DL+Q L
Sbjct:   12 ATEAIHAGQEPEQWKSMA--VVPPITLSTTFKQFGPGEHAGYEYSRSGNPTRNSLEKAVAALDGAKYCLSYASGLAATMNIAHLLKAGDQIICTKDVYGGTNRYFRRVASEMGLKVAFVDCSDLKSLEAAIAANTKLVWIETPTNPTLTVIDIKGCADIIHK-HKDIILAVDNTFL--IFQLIQR------MYCL--FVSGHSDVVMGLVSVNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRVDKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYESLAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQAL 377          
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Match: smim12 (small integral membrane protein 12 [Source:Xenbase;Acc:XB-GENE-5841153])

HSP 1 Score: 348.591 bits (893), Expect = 5.099e-117
Identity = 179/380 (47.11%), Postives = 255/380 (67.11%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH+G +  +       V+PPI+LSTTF Q  P     Y+YSR+GN  R  LE  +AA++ AKYC SY+SGLA   +I  LLK+GD ++   DVYGGT RYF +VA++  +    +D  +L  ++ ++  NTK+VWIETP+NP + ++DI+    I  + + D I+ VDNTFL  +FQL         M+ L  +++GHSDV+MG  ++N  +++E LK  Q  +GAVPSPFDC+L  RGL+TL +RM  H  + LAVA FL   P+++KVL+P L S  + ++ ++Q TG SGM++ Y+KG+ E   TF++SLK F +AESLGGYESL E P++MTHA+VP E RA L I+D L+R+S+GLED+  I+ DL+Q L
Sbjct:   11 FATEAIHAGQEPEQWKSMA--VVPPITLSTTFKQFGPGEHAGYEYSRSGNPTRNSLEKAVAALDGAKYCLSYASGLAATMNIAHLLKAGDQIICTKDVYGGTNRYFRRVASEMGLKVAFVDCSDLKSLEAAIAANTKLVWIETPTNPTLTVIDIKGCADIIHK-HKDIILAVDNTFL--IFQLIQR------MYCL--FVSGHSDVVMGLVSVNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRVDKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYESLAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQAL 377          
BLAST of Cystathionine gamma-lyase vs. Ensembl Mouse
Match: Cth (cystathionase (cystathionine gamma-lyase) [Source:MGI Symbol;Acc:MGI:1339968])

HSP 1 Score: 375.941 bits (964), Expect = 1.264e-127
Identity = 182/380 (47.89%), Postives = 263/380 (69.21%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH G +  +       V+ PISL+TTF Q +P     ++YSR+GN  R  LE  +AA++ AK+  +++SGLA   +IT LLK+GD ++  ++VYGGT RYF +VA++F +    +D     L++ ++ P TK+VWIETP+NP +++ DI A  +I  +   D I+VVDNTF++  FQ P+ LGADI M S TKYMNGHSDV+MG  ++N+ ++   L+  Q  +GAVPSPFDC+L  RGL+TL VRM  H  +G+AVA FL  +P++EKV++P L S  + ++ ++Q +G  GM+S Y+KG+ +    F+++LK F +AESLGGYESL E+P++MTHASVP + RA LGI D L+R+SVGLED   +LEDL++ L
Sbjct:   17 FATQAIHVGQEPEQW--NSRAVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCLEKAVAALDGAKHSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIGACAQIVHK-RGDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYPGLPSHPQHELAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPEKDRATLGINDTLIRLSVGLEDEQDLLEDLDRAL 393          
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Match: sp|Q55DV9|CGL_DICDI (Cystathionine gamma-lyase OS=Dictyostelium discoideum OX=44689 GN=cysA PE=1 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 5.764e-148
Identity = 212/393 (53.94%), Postives = 285/393 (72.52%), Query Frame = 2
Query:  116 ITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNC-PLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDK 1291
            +T P+  N KI T  IH+G  A ++ G    VI PISLSTTF Q  P     +YDYSR+GN  R+  E  IAA ENAKY  S++SGLATL++IT LLKSGD V+  +DVYGGT RYF++VAA F++ F  +D+  LD +KN+    T++VWIETP+NPL+++ DI+A+        +   +VVDNTF++P FQ P++LGADIVMHS+TKY+NGHSD +MG  A NN E++  LK  Q  +GAVPSPFDCFLALRGL+TL VRM  HQ +  A+  FL  HPK+E+V++P L S  + ++ ++QM GY GM+  +VKGS + + +F++++K F +AESLGG ESLIE+PS+MTHASVP E+RA LGI+D L+R+SVG+EDI  +L D+ Q LDK
Sbjct:    1 MTQPN--NYKIGTNVIHAGQSADKNTGA---VIVPISLSTTFLQPSPGVLHSEYDYSRSGNPTRKAFEECIAACENAKYALSFASGLATLTTITHLLKSGDEVISIDDVYGGTRRYFTRVAANFDLKFSFVDLSTLDDLKNAFTDKTRLVWIETPTNPLLKVADIKAVADYVHSRGA--TLVVDNTFMSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVLATNNDELYAKLKFLQNSIGAVPSPFDCFLALRGLKTLHVRMEAHQKNAFAICNFLEKHPKVERVIYPGLPSHPQHEICKRQMKGYGGMVVFFVKGSIDQSRSFLENIKLFALAESLGGVESLIELPSVMTHASVPAEERAKLGISDTLIRLSVGIEDINDLLADISQALDK 386          
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Match: sp|P55216|CGL2_CAEEL (Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans OX=6239 GN=cth-2 PE=3 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.902e-138
Identity = 197/367 (53.68%), Postives = 269/367 (73.30%), Query Frame = 2
Query:  149 ATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAA-KFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLE 1246
             T AIH G +  +     + V+PPISLS+T+ Q  P  P  +DYSRAGN  R++L+  +AA+E+AK+C  +SSGLA  S+I  LLK GDH++  +DVYGGT RY  +VA     +  D++D+ ++  ++ ++KPNTKMVW E+PSNPL+++VDI A+V+  K+AN + +VVVDNTF++P FQ P++LGAD+V+HS+TKY+NGHSDV+MGA   +N E  + L   QL VGAVPSPFDCFL  RGL+TL +RM  H  + LAVA +L  + +IE VL+PAL S  + +V EKQ  G SGM+S Y+KG  +++  F+ +LK F +AESLGGYESL E+PS+MTHASVP E R +LGITDNL+RISVG+E
Sbjct:    8 GTAAIHVGQEPEQ--WDMNQVVPPISLSSTYKQDNPGEPKGHDYSRAGNPTRDVLQKNLAALEDAKHCQVFSSGLAATSAIINLLKYGDHIVCSDDVYGGTQRYIRRVAVPNHGLEVDSVDLTDVQNLEKAIKPNTKMVWFESPSNPLLKVVDIAAVVQTAKKANPEIVVVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAVITDNDEFQQHLFFMQLAVGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSHPQHEVHEKQTKGMSGMISFYLKGELQESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLGITDNLIRISVGIE 372          
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Match: sp|Q60HG7|CGL_MACFA (Cystathionine gamma-lyase OS=Macaca fascicularis OX=9541 GN=CTH PE=2 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 2.707e-131
Identity = 187/380 (49.21%), Postives = 267/380 (70.26%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH G +  +   T   V+P ISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKYC +++SGLA   +IT LLK+GD ++  +DVYGGT RYF +VA++F +    +D   + L++ ++ P TK+VWIETP+NP+++++DIEA   I  +   D I+VVDNTF++P FQ P+ LGADI M S TKYMNGHSDV+MG  ++N + +   L+  Q  +GAVPSP DC+L  RGL+TL VRM  H  +G+AVA FL  +P +EKV++P L S  + ++ ++Q TG +GM++ Y+KG+ +    F+++LK F +AESLGG+ESL+E+P++MTHASVP   R +LGI+D L+R+SVGLED   +LEDL+Q L
Sbjct:   18 FATQAIHVGQEPEQ--WTSRAVVPLISLSTTFKQAAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPVLKMIDIEACAHIVHK-RGDIILVVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPGVEKVIYPGLPSHPQHELAKRQCTGCTGMITFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLVELPAIMTHASVPKNDRDVLGISDTLIRLSVGLEDEKDLLEDLDQAL 394          
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Match: sp|Q19QT7|CGL_PIG (Cystathionine gamma-lyase OS=Sus scrofa OX=9823 GN=CTH PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 3.175e-129
Identity = 186/380 (48.95%), Postives = 264/380 (69.47%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH+G +  +       V+PPISLSTTF Q+ P     ++YSR+GN     LE  +A ++ AKY  +++SGLA   +IT LLK+G  ++  +DVYGGT RYF +VAA+F +    +D     L++ ++ P TK+VWIETP+NP+++++DIEA  +I  + + D I+VVDNTF++  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N++ +   L+  Q  +GAVPSP DC+L  RGL+TL VRM  H  +G+AVA FL  HP +EKV++P L S  + ++ ++Q TG  GM+S Y+KGS     TF++SLK F +AESLGGYESL E+P++MTH+SVP   R +LGI D L+R+SVGLED   +++DL+Q L
Sbjct:   18 FATQAIHAGQEPEQWASKA--VVPPISLSTTFKQEAPGQHSGFEYSRSGNPTXNCLEKAVAVLDGAKYSLAFASGLAATVTITHLLKAGXQIISMDDVYGGTNRYFRQVAAEFGLKISFVDCSKSKLLEAAITPETKLVWIETPTNPILKMIDIEACAQIVHK-HGDIILVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSLNSETLHSRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYPGLPSHPQHELAKRQCTGCPGMISFYIKGSLHHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLGIRDTLIRLSVGLEDKQDLMDDLDQAL 394          
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Match: sp|P18757|CGL_RAT (Cystathionine gamma-lyase OS=Rattus norvegicus OX=10116 GN=Cth PE=1 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 8.914e-128
Identity = 183/380 (48.16%), Postives = 265/380 (69.74%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT AIH G +  +   +   V+ PISL+TTF Q  P     + YSR+GN  R  LE  +AA++ AK+C +++ GLA  ++IT LLK+GD V+  ++VYGGT RYF +VA++F +    +D     L++ ++ P TK+VWIETP+NP +++ DI+A  +I  + + D I+VVDNTF++  FQ P+ LGADI M S TKYMNGHSDV+MG  ++ + ++ E L+  Q  +GAVPSPFDC+L  RGL+TL +RM  H  +G+AVA FL  +P++EKV++P L S  + ++ ++Q TG  GM+S Y+KG+ +    F++++K F +AESLGGYESL E+P++MTHASVP + RA LGI+D L+R+SVGLED   +LEDL Q L
Sbjct:   17 FATQAIHVGPEPEQW--SSRAVVLPISLATTFKQDSPGQSSGFVYSRSGNPTRNCLEKAVAALDGAKHCLTFARGLAATTTITHLLKAGDEVICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIKACAQIVHK-HKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVTSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSHPQHELAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGYESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQAL 393          
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Match: A0A0R3UNP5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9431 PE=3 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 3.364e-147
Identity = 210/385 (54.55%), Postives = 277/385 (71.95%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNN--QEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            I T   H GHK  E P  GHPV+ PI+LSTTF Q  P    KY+Y+R+GNY+R +LE  I+ IEN++    ++SGLA L +   LL  GDH++ F+D+YGGT RYF K+A++  + F  +DMRN +L+K  LKPNTKMV+IETPSNPLMR+VDI  + +I  +A+ + +VVVDNTF++P FQ P+ LGADI + SLTKYMNGHSDV+MG+ A+     E+   LK  Q   GAVPSPFDCFL LRGLRTL VRM  H  +GL +A FL+ HPK+E VLHP L S  + ++  +QM G+SGM+  ++K   + T  F+++LK F +AESLGGYESLIEIPSLMTHASVP E R +LGIT++++R+SVGLED   + +DL   L+K+
Sbjct:   29 IETSLTHGGHKPLELPDMGHPVVTPITLSTTFQQLKPATG-KYEYARSGNYSRHVLESCISTIENSEGAFVFASGLAALGACLDLLSHGDHIISFDDLYGGTGRYFRKIASRHGLEFSYVDMRNPELIKTELKPNTKMVFIETPSNPLMRLVDIVEVSRIAHEADPNILVVVDNTFMSPYFQRPLELGADISLASLTKYMNGHSDVIMGSVAIRKGLPEVQSQLKFIQNAAGAVPSPFDCFLCLRGLRTLAVRMQAHMRNGLTIASFLSQHPKVEAVLHPGLKSHPQWELARRQMRGFSGMICVFLKADAKQTADFVKNLKLFLLAESLGGYESLIEIPSLMTHASVPEETRRVLGITNSMLRLSVGLEDCRDLAKDLFDQLEKL 412          
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Match: A0A0R3STD8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8661 PE=3 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 3.135e-145
Identity = 211/413 (51.09%), Postives = 288/413 (69.73%), Query Frame = 2
Query:   74 MDKYTATISKARSMITDPSTINSK----IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQ--EIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            MD +     +A     D + I  K    I T   H GH     P  GHPV+ PI+LSTTF Q  P    KY+YSR+GNY+R  LE  +A ++N     +++SGLA L+S+ Q+L++G+H++ F+D+YGG+ RYF K+A++F + F  +DMR+ +  KN++KPNTKMV+IETPSNPLMR+VDI  + +I  +AN + +VVVDNTFLTP FQ P++LGADI + SLTKY+NGHSDV+MG+  +     E+   LK  Q   GA+ SPFD +L LRGLRTL VRM  H ++GL +A FLA HPK+E VLHP L +  + ++  KQM G+SGM+  Y+K   + T  F+++LK F +AESLGGYESLIEIPS+MTHASVP E R +LGI+D+++RISVGLED   + +DL  GL+K+
Sbjct:    1 MDSFEELFEQAVKRARDINDITLKPIEGIETIITHGGHDPLALPDMGHPVVSPITLSTTFQQLAPATG-KYEYSRSGNYSRYALEKCLAELDNGSAGFAFASGLAALNSLLQILETGNHIVAFDDLYGGSGRYFRKIASRFGLEFSYVDMRDPEATKNAIKPNTKMVFIETPSNPLMRLVDIAEVSRIAHEANPEILVVVDNTFLTPYFQRPLDLGADITLSSLTKYINGHSDVVMGSLVIRKGLPEVEAQLKFTQNAAGAIASPFDSYLCLRGLRTLAVRMRAHMMNGLTIANFLAAHPKVETVLHPGLKTHPQHELACKQMGGFSGMICVYLKSDAKGTGDFVKNLKYFALAESLGGYESLIEIPSIMTHASVPEEHRRMLGISDSMIRISVGLEDCRDLAKDLYDGLEKL 412          
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Match: A0A1S8WYK9 (Putative cystathionine beta-lyase OS=Opisthorchis viverrini OX=6198 GN=X801_04810 PE=3 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.895e-143
Identity = 213/405 (52.59%), Postives = 273/405 (67.41%), Query Frame = 2
Query:   83 YTATISKARSMITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQ-EIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            Y   + +A+  IT+       I T A H G    +    G PV+PPI LSTTF QK P    +YDYSRAGN++RE LE  IA +E   +C +YSSGLA L +I QLL +GDH++ F+D+YGG+ RY   +A +  I    +DMR+ D  K+ L+PNTK+V  ETPSNPLMR++DI  I  I    N D IV VDNTF+TP FQ P++ GADI  HSLTKYMNGHSDV+MGA       E+    K  QL  GAVPS FDCFL LRGLRTL VRM  H L+ L VA  L  HPK+EKV+HPAL S  + K+  +QM G+SG++S YVK + E+T+ F++++K F +AESLGGYESLIEIPS+MTH SVP E R   GI+DN++R+S+GLED   ++  L +GLD +
Sbjct:    8 YKEALHQAKIFITENFRPFESIETIATHGGFYPHDLSCMGSPVVPPICLSTTFEQKEPGVA-RYDYSRAGNFSRECLEKCIAELECGDHCSTYSSGLACLGAIVQLLSAGDHIVAFDDMYGGSGRYLRTIANRSGISCTLVDMRDEDAFKSVLQPNTKLVLAETPSNPLMRLIDIRRISDIAHNYNKDIIVAVDNTFMTPYFQRPLDFGADISWHSLTKYMNGHSDVVMGAVVTRGHPELPSKFKFAQLAGGAVPSSFDCFLCLRGLRTLPVRMRGHMLNALVVAKMLEKHPKVEKVIHPALPSHPQHKLALEQMRGFSGIISVYVKCTAEETVEFVKNIKVFALAESLGGYESLIEIPSIMTHISVPYEIRLQNGISDNMIRLSIGLEDPKDLVRALYEGLDAL 411          
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Match: A0A3Q0KIF2 (Putative cystathionine beta-lyase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.148e-142
Identity = 207/384 (53.91%), Postives = 273/384 (71.09%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQ-EIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            I T A H G+        G PV+PPI+LS+TF Q  P    KYDYSR+GN++RE LE  IA++E+   CC +SSGLA L ++ Q+L S DH++ F+D+YGG  RY  ++A+K  I    +DMR+L L + +L+ NT++V IE+PSNPLMR+VDI A+  IT + N + IVVVDNTF++  FQ P++ GAD+V+HSLTKYMNGHSD++MGA    NQ E+ + L+  Q   GAVPSPFDCFL LRGLRTL +RM  H  +GL VA+ L  HP +EKVLHP L S  +  +I KQM G+SGM++ Y++ + E T TF  +LK F +AESLGGYESLIEIPS+MTHASVP E R   GIT+N++R+SVGLED   +  DL + LDK+
Sbjct:   29 IDTVATHGGYDPVYLEEVGRPVVPPITLSSTFQQLSPGIA-KYDYSRSGNFSRECLEKCIASLEDGHDCCVFSSGLAALGTLIQILSSNDHIVAFDDLYGGNGRYLRQLASKSGITSTFVDMRDLKLFQQALQKNTRLVLIESPSNPLMRLVDISAVASITHKFNKEIIVVVDNTFMSSYFQRPLDHGADVVLHSLTKYMNGHSDLVMGALVTRNQSELHKQLRFIQYAAGAVPSPFDCFLCLRGLRTLPIRMKTHMQNGLIVAMMLEKHPMVEKVLHPGLESFPQSDIIVKQMRGFSGMITVYLRCTGEQTKTFTTNLKLFTLAESLGGYESLIEIPSIMTHASVPAEVREANGITENMLRLSVGLEDPKDLSLDLYEALDKL 411          
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Match: A0A182EEW0 (Uncharacterized protein OS=Onchocerca ochengi OX=42157 GN=NOO_LOCUS6621 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.162e-142
Identity = 211/382 (55.24%), Postives = 279/382 (73.04%), Query Frame = 2
Query:  149 ATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNIL-FDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDK 1291
             T AIH+G +A E   T   +IPPISLSTTF Q  P  P+K+DYSRA N +R++LE  +A++E+A+YC  YSSGLA   +IT  LKS DHV+  +DVYGGT RYF KV+   + L    +DM +L +   +LK NTKM+WIETPSNPL++++DI AIV+ITK   SD ++VVDNTF++P FQ P++ GAD V+HS+TKY+NGHSDV+MGA   N + + E+LK QQL VGAVPSPFDCFL  RG++TL VRM  H  + L +A FL  +P+IE+VL+P L S  + ++ +KQ  G SGM+S Y+KG  E++  F+ SLK F +AESLGG+ESL E+P+ MTHASVP E R  LGI DNL+RISVG+ED   +++DL+Q L K
Sbjct:   33 GTNAIHAGQEA-EQWDTNQ-IIPPISLSTTFKQPKPGKPVKHDYSRASNPSRDVLERCLASLEDAEYCRVYSSGLAASMAITNTLKSSDHVVCCDDVYGGTQRYFRKVSVLHHGLEISFVDMTDLKVFSQALKSNTKMIWIETPSNPLLKVMDIAAIVEITKTFRSDILIVVDNTFMSPYFQHPLSFGADAVLHSITKYINGHSDVVMGAVMTNIKSLDENLKFQQLAVGAVPSPFDCFLVNRGVKTLHVRMQAHMANALQIATFLESNPRIERVLYPELQSHPQHEIHKKQTKGMSGMMSFYLKGGLEESEEFLSSLKIFTLAESLGGFESLAELPAAMTHASVPAEDRIKLGIGDNLIRISVGIEDAEDLIQDLDQALKK 412          
BLAST of Cystathionine gamma-lyase vs. Ensembl Cavefish
Match: cthl (cystathionine gamma-lyase [Source:NCBI gene;Acc:103034904])

HSP 1 Score: 391.734 bits (1005), Expect = 6.439e-134
Identity = 190/382 (49.74%), Postives = 263/382 (68.85%), Query Frame = 2
Query:  140 SKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
            S  AT AIH G +  +       V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +A+++ AK+C + +SGLA   ++T +LKSGD ++  NDVYGGT RYF ++A +        D    +++K +LKPNTKM+WIETPSNP M++VDI+A   +  + N D IVVVDNTF++  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N ++++E LK  Q  +GAVPSPFDC++  RGL+TL +RM  H  + +AVA FL   P+++KV+ P L S  + ++++KQ TG  GM++ Y+KG  E    F+ +LK F +AESLGGYESL E P++MTHASVP  +R +LGI+D L+R+SVGLED   I+ DL+Q L
Sbjct:   16 SSFATDAIHVGQEPEQW--NSMAVVPPISLSTTFKQYGPGKHAGFEYSRSGNPTRNCLEKAVASLDGAKHCVALASGLAATVTVTHMLKSGDGIVCMNDVYGGTNRYFQRIAKEIGYDISFADCTKPEVLKAALKPNTKMLWIETPSNPTMKVVDIQACSDLAHEQNKDIIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLISVNREDLYERLKFLQNALGAVPSPFDCYMCNRGLKTLHLRMKQHFKNAMAVAEFLERDPRVDKVIFPGLPSHPQHELMKKQCTGCPGMITFYIKGKLEHATAFLNNLKLFALAESLGGYESLAEHPAIMTHASVPENERVVLGISDTLIRLSVGLEDEEDIIADLDQAL 395          
BLAST of Cystathionine gamma-lyase vs. Ensembl Cavefish
Match: cthl (cystathionine gamma-lyase [Source:NCBI gene;Acc:103034904])

HSP 1 Score: 363.999 bits (933), Expect = 1.531e-122
Identity = 183/383 (47.78%), Postives = 254/383 (66.32%), Query Frame = 2
Query:  140 SKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIE-TPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
            S  AT AIH G +  +       V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +A+++ AK+C + +SGLA   ++T +LKSGD ++  NDVYGGT RYF ++A +        D    +++K         VW E TPSNP M++VDI+A   +  + N D IVVVDNTF++  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++N ++++E LK  Q  +GAVPSPFDC++  RGL+TL +RM  H  + +AVA FL   P+++KV+ P L S  + ++++KQ TG  GM++ Y+KG  E    F+ +LK F +AESLGGYESL E P++MTHASVP  +R +LGI+D L+R+SVGLED   I+ DL+Q L
Sbjct:   16 SSFATDAIHVGQEPEQWNSMA--VVPPISLSTTFKQYGPGKHAGFEYSRSGNPTRNCLEKAVASLDGAKHCVALASGLAATVTVTHMLKSGDGIVCMNDVYGGTNRYFQRIAKEIGYDISFADCTKPEVLKAG-------VWSERTPSNPTMKVVDIQACSDLAHEQNKDIIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLISVNREDLYERLKFLQNALGAVPSPFDCYMCNRGLKTLHLRMKQHFKNAMAVAEFLERDPRVDKVIFPGLPSHPQHELMKKQCTGCPGMITFYIKGKLEHATAFLNNLKLFALAESLGGYESLAEHPAIMTHASVPENERVVLGISDTLIRLSVGLEDEEDIIADLDQAL 389          
BLAST of Cystathionine gamma-lyase vs. Ensembl Sea Lamprey
Match: cthl (cystathionase (cystathionine gamma-lyase), like [Source:ZFIN;Acc:ZDB-GENE-040905-3])

HSP 1 Score: 340.887 bits (873), Expect = 1.550e-114
Identity = 178/381 (46.72%), Postives = 248/381 (65.09%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIP-SLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
             AT A+H+G +  +       V+PPIS++TTF Q+ P     ++YSR+GN  R  LE  +A ++ AKY  ++SSGLA   +IT LLK+GD V+   DVYG             ++       R    + N + P   MVW+E+P+NPL++++DI A   +   A  D ++VVDNTF++  FQ P++LGAD+ M+S TKYMNGHSDV+MG  ++N  ++FE LK  Q  VGAVPSPFDCFL  RGL+TL VRM  H  S  AVA FL   P++ +VL+P L S  + +V  KQ +G SGM++ Y++G  +++ TF+ SLK F +AESLGGYESL E P +LMTHASVP + RA LGI+D L+R+SVGLE+   I+ D++ GL
Sbjct:   18 FATDAVHAGQEPEQW--NSMAVVPPISMATTFKQRGPGEHAGFEYSRSGNPTRNCLEKAVATLDGAKYAMAFSSGLAATVTITHLLKAGDGVICMEDVYGANTDSSRSSPPPHSV-------RVSRCMCNPINP--LMVWVESPTNPLLKVLDIRACADVV-HAKGDILLVVDNTFMSAYFQRPLSLGADLCMYSATKYMNGHSDVVMGLVSLNRDDVFEKLKFLQNAVGAVPSPFDCFLVSRGLKTLPVRMKQHFHSAKAVATFLEQDPRVTRVLYPGLPSHPQYEVSLKQTSGASGMVTFYIQGGLKESRTFLSSLKVFTLAESLGGYESLAEHPWALMTHASVPDDVRATLGISDTLIRLSVGLEETEDIIADIDMGL 386          
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Match: CYS3 (Cystathionine gamma-lyase; catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000010])

HSP 1 Score: 334.724 bits (857), Expect = 1.285e-112
Identity = 182/389 (46.79%), Postives = 246/389 (63.24%), Query Frame = 2
Query:  143 KIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPL-KYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQ--ANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFL-ADHPKIEKVLHPALFSSSEKKVIEKQMTGY--SGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDK 1291
            K AT AIH+G    EH      VI PISLSTTF Q  P  P+  Y+YSR+ N NRE LE  +AA+ENA+Y  ++SSG AT ++I Q L  G H +   DVYGGT RYF+KVA    +     +    DL +  +K NTK+VWIETP+NP +++ DI+ +  + K+  A  D I+VVDNTFL+P    P+N GADIV+HS TKY+NGHSDV++G  A NN+ ++E L+  Q  +GA+PSPFD +L  RGL+TL +R+    LS   +A FL AD   +  V +P L +     V+ KQ       GM+S  +KG  E    F  S + F +AESLGG ESL+E+P++MTH  +P E R   G+ D+LVRISVG+ED   +LED++Q L +
Sbjct:    8 KFATKAIHAG----EHVDVHGSVIEPISLSTTFKQSSPANPIGTYEYSRSQNPNRENLERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLNDLPQ-LIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391          
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Match: STR3 (Peroxisomal cystathionine beta-lyase; converts cystathionine into homocysteine; may be redox regulated by Gto1p; involved in the release of the aromatic thiol 3-mercaptohexanol during wine fermentation [Source:SGD;Acc:S000003152])

HSP 1 Score: 160.999 bits (406), Expect = 4.913e-45
Identity = 124/402 (30.85%), Postives = 199/402 (49.50%), Query Frame = 2
Query:  143 KIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLK-YDYSRAGNYNREILEITIAAIENA--KYCCSYSSGLATLSSITQ---LLKSGDH----VLLFNDVYGGTFR---YFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNL--GADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADH--------PKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQS--LKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDL 1273
            ++ T  +++G +  +H  +    +PP+ LSTTF     N   + YDYSR+GN  R +L+  I  +     +   + SSG+  L  I +   LL   D+    ++  +D+YGGT R   +F + +   ++  D  D      V  SL      V +E+P+NPL ++VDI  I++  K  + DT VVVDNT ++ +   P+ L  G D+V  S TKY+NGH D++ G       EI   L       GA  SP D +L +RGL+TL VR+   Q + + +A +L +          K  K     L S+ + K + K      G + ++  GS E +   + S  L  + +  S G   SL+ +P  M+HAS+  E R      ++LVR+  G+E+I  + +DL
Sbjct:    5 RLDTVVVNTGSQNDQHSAS----VPPVYLSTTFKVDLNNEDAQNYDYSRSGNPTRSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLD-KVDCVLLESPTNPLCKVVDIPRILRFVKCISPDTTVVVDNTMMSGLNCNPLQLNPGCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRTNKATKTRFVGLRSNPDFK-LHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDL 400          
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Match: IRC7 (Beta-lyase involved in the production of thiols; null mutant displays increased levels of spontaneous Rad52p foci; expression induced by nitrogen limitation in a GLN3, GAT1-dependent manner and by copper levels in a Mac1-dependent manner [Source:SGD;Acc:S000001952])

HSP 1 Score: 140.584 bits (353), Expect = 1.875e-38
Identity = 91/288 (31.60%), Postives = 150/288 (52.08%), Query Frame = 2
Query:  278 YSRAGNYNREILEITIAAIENAKYCCSYSSGLATLS-SITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKG--SPEDTITFIQSLKCFQMAESLGG 1132
            Y  AG+   + LE     +         +SGL ++S ++  L K+GDH+L+ + VY  T      + AKF +  D  D      ++  +KPNT ++++E+P +  M + DI A+V + K+    TI+  DNT+ TP+F      G DI + + TKY+ GHSD+L+G A+ N +E +  L+     +  +P   DC LALRG+RTL +R+   +   L +A +L +  ++EKVLHPA       +   +   G SG+ S  +K   +       ++ +K  Q+  S GG
Sbjct:   56 YGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKTIL--DNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASAN-EECWPLLRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVRDYKGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340          
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Match: YHR112C_mRNA (Protein of unknown function; localizes to the cytoplasm and nucleus; overexpression affects protein trafficking through the endocytic pathway [Source:SGD;Acc:S000001154])

HSP 1 Score: 129.413 bits (324), Expect = 4.141e-34
Identity = 116/387 (29.97%), Postives = 178/387 (45.99%), Query Frame = 2
Query:  209 VIPPISLSTTFSQKYPNCPL--------------KYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTK------MVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADH-PKIEKVLHPALFSSSE-KKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILG--ITDNLVRISVGLEDIYSILEDLEQGLDKIK 1297
            V PPI++STTF  +Y +  L              K  YSR  + N   LE   + I +  Y   YSSGLA   +   ++      +     Y G       V A  NIL      RN  + ++ L+   K      +V +E+P NP     DIE++ +  +      +++VD+TF +P  Q   N GADIV++S TKY  GHSD+L G   +  +     LK  ++ +G   +  + F+ LR LRT  +R+     +   +  FL+DH  + +KVL     SS + ++ ++KQ+ G  G + A    + E        LK F  A SLGG ESL             VE RA+    I   L+R+SVG E    +++DL   L +++
Sbjct:   21 VAPPINVSTTF--RYDDDDLIPWTERENLDFMEKKPVYSRLAHPNSTRLESIFSEILDG-YAVIYSSGLAAFYA--AMVHYNPKKIFIGQSYHG-------VRAIANIL-----TRNYGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLAR--RAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESL-------------VEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQ 375          
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Match: MET17 (O-acetyl homoserine-O-acetyl serine sulfhydrylase; required for Methionine and cysteine biosynthesis [Source:SGD;Acc:S000004294])

HSP 1 Score: 125.946 bits (315), Expect = 2.024e-32
Identity = 110/387 (28.42%), Postives = 176/387 (45.48%), Query Frame = 2
Query:  272 YDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLS-SITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTF-LTPVFQLPMNLGADIVMHSLTKYM---------------------------------NGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMT-GYSGMLSAYVKGSP---EDTITF-------IQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            Y YSR  N    +LE  IAA+E      + SSG A  + +I  L  +GD+++  + +YGGT+  F     +F I    ++  N +  +      TK V++ET  NP   + D E IV I  +      VVVDNTF     F  P+  GADIV HS TK++                                  G+   +   A  N   I     +    +G + +PF  FL L+G+ TL +R   H  + L +A +L   P +  V +P L S S  +  +K ++ G+ G+LS  VK  P   ++T  F       + +LK      ++G  ++L+  P   TH  +  +++   G+T +L+R+SVG+E I  I+ D +Q  + +
Sbjct:   54 YVYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHG--IPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438          
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Match: EDO42530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S143])

HSP 1 Score: 377.867 bits (969), Expect = 5.353e-129
Identity = 187/381 (49.08%), Postives = 251/381 (65.88%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKV-AAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
              T AIH+G +      T   V+PPISLSTTF Q  P    +Y+YSR+GN  R   E  +AA+E  K+  + SSGLA    +   LKSGDH+   +DVYGGT RYFS++      I     D  NLD +K ++KPNTKMVW+ETP+NP +++ DI+    I  Q +   ++VVDNTF++  FQ P++LGAD VMHS+TKYMNGHSDV MG  A NN E+ + LK  Q   G VPSPFDC+LA RGL+TL VRM  H+ +  AVA FL   P++  V +P L S  + ++ ++QMTG+ GM++ Y+KG       F++ +K F +AESLGG+ESL E P++MTHASVP  QR +LGI+D L+R+SVGLED   ++ DL+Q L
Sbjct:   15 FGTLAIHAGQEP--EKWTSRAVVPPISLSTTFKQDAPGVYKQYEYSRSGNPTRTCFEECVAALEGGKHGIATSSGLAATMLLVHTLKSGDHIACIDDVYGGTNRYFSRIMTPSMGIEVTFHDYTNLDNLKKAIKPNTKMVWVETPTNPTLKLTDIQGAADIVHQ-HEGVMMVVDNTFMSSYFQRPLSLGADAVMHSVTKYMNGHSDVCMGVIATNNDELAKKLKFLQFASGPVPSPFDCYLANRGLKTLHVRMREHERNAKAVASFLEKDPRVTAVKYPGLQSHPQHELAKRQMTGFGGMVTFYIKGDLNTATEFLKQVKVFTLAESLGGFESLCEHPAVMTHASVPPAQREVLGISDTLIRLSVGLEDTKDLINDLDQAL 392          
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Match: EDO25544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW64])

HSP 1 Score: 155.221 bits (391), Expect = 1.349e-44
Identity = 85/245 (34.69%), Postives = 140/245 (57.14%), Query Frame = 2
Query:  560 VWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            ++ ETP+NP + ++D++ +  I K+ N   ++++DN F TP  Q P++ GADIV+HS TK ++G   VL G  A+  + +   +       G   SPF+ ++  + L TLVVR+  H  + L VA FL  H K+  V HP L S  + ++ +KQM     +++  V G  E    F+ ++K   ++ +LG   +++  P+  TH+ +  E R   GITD LVR+SVGLE +  I+ DL+Q L+ +
Sbjct:    1 LYAETPTNPGVDVLDLDLLGNIAKKHN--LLLIIDNCFATPYLQKPIDFGADIVLHSATKLIDGQGRVL-GGVAVGKETLIREIYLFSRNTGPAMSPFNAWILSKSLETLVVRVEKHCENALKVAQFLEGHSKVNLVKHPFLASHPQYEIAKKQMRLGGNIVAFEVTGGVEAGREFLNAIKLCSLSANLGDTRTIVTHPASTTHSKLTNEDRLEAGITDGLVRVSVGLEHVEDIINDLKQALENV 242          
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Match: EDO41564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3X8])

HSP 1 Score: 150.214 bits (378), Expect = 1.288e-41
Identity = 106/344 (30.81%), Postives = 169/344 (49.13%), Query Frame = 2
Query:  272 YDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSS-ITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHAS--VPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKI 1294
            Y YSR  N   +    T+ A+E       +SSG+A +S+ +  LLK+GDHV+    VY GT      V  ++ I    +   +++  + ++KP+TK+++ ETP NP M ++D+EA  ++          +VD+TF +P  Q P+   A   ++                           LK Q          FD  + +RG          H           AD  K+  V +P L S+    + +KQM G+SGM+S  VKG  ++ + F +SLK  ++A SLGG +SL+E+ S MTH    V  E +A  G++D+L+RISVGLE +  + +D+ Q LD++
Sbjct:   54 YLYSRWNNPTVDAAAQTLNALEGGVGTLLFSSGMAAISTALLSLLKAGDHVVAPKIVYSGTLALLQTVLPRYGIEVTLVTGDSMESYQEAVKPSTKVIYGETPCNPTMAVLDLEAFAQLGMSLGEGVATMVDSTFGSPFNQAPLRHAAAAALY---------------------------LKCQ----------FDGLVVIRGFGN-----QCH-----------AD--KVSVVNYPGLPSNPGHLIAKKQMRGFSGMVSFEVKGGLQEAVKFAESLKLVKLAVSLGGTDSLVEVVSCMTHPDKYVTPEMKAEAGVSDSLIRISVGLEHVEDLKQDIAQALDQM 342          
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Match: EDO26655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBF2])

HSP 1 Score: 110.153 bits (274), Expect = 2.243e-29
Identity = 49/99 (49.49%), Postives = 72/99 (72.73%), Query Frame = 2
Query:  989 SSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGL 1285
            S  + ++ ++QMTG+ GM++ Y+KG       F++ +K F +AESLGG+ESL E P++MTHASVP  QR +LGI+D L+R+SVGLED   ++ DL+Q L
Sbjct:    3 SHPQHELAKRQMTGFGGMVTFYIKGDLNTATEFLKQVKVFTLAESLGGFESLCEHPAVMTHASVPPAQREVLGISDTLIRLSVGLEDTKDLINDLDQAL 101          
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Match: EDO27139 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA32])

HSP 1 Score: 46.9802 bits (110), Expect = 2.345e-6
Identity = 45/169 (26.63%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  152 TYAIHSGHKAFEHPGTGHPVIPPISLSTTFS--------QKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCS-----------YSSGLATLSS-ITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNT--KMVWIETPSNPLM 592
            T  IH GH+  +     H  + PI  S+T++          +      Y Y R GN      E  IA +E      S           +SSG+A +++ +   LK+G+ ++    +YGGT     KV     I     D  NLD V+ +++ ++   +++IETP+NP +
Sbjct:   11 TICIHGGHQ--QENNRAH--LTPIYASSTYTFDSAEQAVNIFQGKEEGYVYGRFGNPTIREAEEKIALMEAYGLQDSNGDNLELKAILHSSGMAAITTMLLSNLKAGEKIITHYSLYGGTQELIDKVLPDMGIEVIIADFNNLDKVEAAIQADSAINLMYIETPANPTL 175          
BLAST of Cystathionine gamma-lyase vs. Ensembl Medaka
Match: cthl (cystathionine gamma-lyase [Source:NCBI gene;Acc:101164297])

HSP 1 Score: 396.741 bits (1018), Expect = 9.910e-136
Identity = 194/381 (50.92%), Postives = 264/381 (69.29%), Query Frame = 2
Query:  146 IATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLD 1288
             AT AIH G +  +       V+PPISLSTTF Q  P     ++YSR+GN  R  LE  +AA++ AKY  +++SGLAT  ++T LLKSGD ++  +DVYGGT RYF ++AA   +     D    +L+K +LKPNTK+VWIETP+NP M++VDI+A   +  + N D +VVVDNTF++  FQ P+ LGADI M+S TKYMNGHSDV+MG  ++NN+ + E L+  Q  +G VPSPFDCFL  RGL+TL +RM  H  +G+A A FL   P++E+V+ P L S  +  ++++Q TG  GM++ Y+KG  E+   F+ +LK F +AESLGGYESL E P++MTHASVP  +R ILGITD L+R+SVGLED   I+EDL+Q L+
Sbjct:   24 FATDAIHVGQEPEQWKSMA--VVPPISLSTTFKQYSPGDHAGFEYSRSGNPTRNCLEKAVAALDGAKYSLAFASGLATTVTVTHLLKSGDGIVCMDDVYGGTNRYFRRIAAGLGVDVSFADCTKPELLKAALKPNTKLVWIETPTNPTMKVVDIKACSDLVHEHNKDIVVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGMLSLNNEGLCERLRFLQNALGGVPSPFDCFLCNRGLKTLHLRMEQHFKNGMAAAKFLEADPRVERVIFPGLPSHPQYDIMKRQCTGCPGMIAFYIKGKLENAKAFLCNLKLFAVAESLGGYESLAEHPAIMTHASVPENERTILGITDTLIRLSVGLEDEADIIEDLDQALN 402          
BLAST of Cystathionine gamma-lyase vs. Planmine SMEST
Match: SMESG000054395.1 (SMESG000054395.1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 408/408 (100.00%), Postives = 408/408 (100.00%), Query Frame = 2
Query:   74 MDKYTATISKARSMITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK 1297
            MDKYTATISKARSMITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK
Sbjct:    1 MDKYTATISKARSMITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK 408          
BLAST of Cystathionine gamma-lyase vs. Planmine SMEST
Match: SMESG000054395.1 (SMESG000054395.1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 395/395 (100.00%), Postives = 395/395 (100.00%), Query Frame = 2
Query:  113 MITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK 1297
            MITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK
Sbjct:    1 MITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPISLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGLATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLDLVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTFLTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQLMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVLHPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAESLGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDLEQGLDKIK 395          
The following BLAST results are available for this feature:
BLAST of Cystathionine gamma-lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CTH5.633e-12448.49cystathionine gamma-lyase [Source:HGNC Symbol;Acc:... [more]
CTH4.006e-10444.11cystathionine gamma-lyase [Source:HGNC Symbol;Acc:... [more]
CTH1.470e-9441.92cystathionine gamma-lyase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cth-22.281e-13953.68Putative cystathionine gamma-lyase 2 [Source:UniP... [more]
cth-22.281e-13953.68Putative cystathionine gamma-lyase 2 [Source:UniP... [more]
cth-14.347e-13554.18CystaTHionine gamma lyase [Source:UniProtKB/TrEMB... [more]
cth-14.347e-13554.18CystaTHionine gamma lyase [Source:UniProtKB/TrEMB... [more]
cth-12.895e-13153.67CystaTHionine gamma lyase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Eip55E1.842e-14051.70gene:FBgn0000566 transcript:FBtr0345422[more]
Eip55E1.842e-14051.70gene:FBgn0000566 transcript:FBtr0086710[more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cth4.848e-13551.30cystathionase (cystathionine gamma-lyase) [Source:... [more]
cthl9.109e-12547.89cystathionase (cystathionine gamma-lyase), like [S... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smim122.920e-13149.74small integral membrane protein 12 [Source:Xenbase... [more]
smim124.242e-13149.74small integral membrane protein 12 [Source:Xenbase... [more]
smim125.397e-13149.74small integral membrane protein 12 [Source:Xenbase... [more]
smim124.573e-11747.23small integral membrane protein 12 [Source:Xenbase... [more]
smim125.099e-11747.11small integral membrane protein 12 [Source:Xenbase... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cth1.264e-12747.89cystathionase (cystathionine gamma-lyase) [Source:... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q55DV9|CGL_DICDI5.764e-14853.94Cystathionine gamma-lyase OS=Dictyostelium discoid... [more]
sp|P55216|CGL2_CAEEL2.902e-13853.68Putative cystathionine gamma-lyase 2 OS=Caenorhabd... [more]
sp|Q60HG7|CGL_MACFA2.707e-13149.21Cystathionine gamma-lyase OS=Macaca fascicularis O... [more]
sp|Q19QT7|CGL_PIG3.175e-12948.95Cystathionine gamma-lyase OS=Sus scrofa OX=9823 GN... [more]
sp|P18757|CGL_RAT8.914e-12848.16Cystathionine gamma-lyase OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UNP53.364e-14754.55Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3STD83.135e-14551.09Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S8WYK91.895e-14352.59Putative cystathionine beta-lyase OS=Opisthorchis ... [more]
A0A3Q0KIF21.148e-14253.91Putative cystathionine beta-lyase OS=Schistosoma m... [more]
A0A182EEW01.162e-14255.24Uncharacterized protein OS=Onchocerca ochengi OX=4... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cthl6.439e-13449.74cystathionine gamma-lyase [Source:NCBI gene;Acc:10... [more]
cthl1.531e-12247.78cystathionine gamma-lyase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cthl1.550e-11446.72cystathionase (cystathionine gamma-lyase), like [S... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CYS31.285e-11246.79Cystathionine gamma-lyase; catalyzes one of the tw... [more]
STR34.913e-4530.85Peroxisomal cystathionine beta-lyase; converts cys... [more]
IRC71.875e-3831.60Beta-lyase involved in the production of thiols; n... [more]
YHR112C_mRNA4.141e-3429.97Protein of unknown function; localizes to the cyto... [more]
MET172.024e-3228.42O-acetyl homoserine-O-acetyl serine sulfhydrylase;... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425305.353e-12949.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255441.349e-4434.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO415641.288e-4130.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266552.243e-2949.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271392.345e-626.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cthl9.910e-13650.92cystathionine gamma-lyase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cystathionine gamma-lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000054395.10.000e+0100.00SMESG000054395.1[more]
SMESG000054395.10.000e+0100.00SMESG000054395.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018617 ID=SMED30018617|Name=Cystathionine gamma-lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1316bp
GGTAATTGTTAAATTAGTTAAACTATACAATTTACGAAACAGTCACAATC
ATTATTTTAAAATTGTTATTTAAATGGATAAATACACAGCTACTATATCA
AAAGCTAGATCTATGATCACAGATCCATCAACGATTAATTCCAAAATAGC
TACATATGCTATTCATTCCGGCCACAAGGCTTTTGAACATCCTGGAACAG
GCCATCCAGTAATTCCTCCAATTTCTTTGTCGACTACTTTTAGTCAAAAA
TACCCTAATTGTCCACTTAAATATGATTACTCTAGAGCAGGAAATTATAA
TCGAGAAATATTAGAAATTACAATAGCCGCAATTGAAAATGCGAAATATT
GCTGTTCGTACTCATCTGGTCTAGCTACACTAAGCTCTATCACACAATTG
TTGAAATCTGGGGATCATGTTTTATTATTTAACGATGTATATGGCGGCAC
GTTTCGATATTTCAGTAAAGTAGCTGCAAAATTCAACATACTTTTTGATG
CCATAGATATGCGAAATCTTGACCTAGTTAAGAATTCACTGAAGCCTAAT
ACCAAAATGGTGTGGATTGAAACTCCATCAAATCCATTAATGCGCATTGT
CGATATTGAGGCAATCGTTAAGATTACTAAGCAAGCCAATAGTGATACAA
TTGTTGTAGTCGATAACACTTTCTTGACACCCGTATTTCAACTGCCGATG
AACTTAGGGGCGGACATTGTCATGCATTCTCTCACCAAATACATGAACGG
CCACTCCGATGTTTTAATGGGCGCTGCTGCAATGAACAATCAGGAGATTT
TTGAATCTTTAAAACAGCAGCAGCTTATGGTTGGTGCAGTTCCTTCTCCA
TTTGATTGCTTTTTGGCTTTGCGTGGTTTACGCACTCTAGTTGTGCGAAT
GAATCATCATCAGTTAAGTGGCCTTGCAGTGGCTCTGTTTCTGGCTGATC
ATCCGAAAATTGAAAAAGTTTTGCATCCCGCATTATTCTCATCTTCGGAG
AAAAAGGTAATTGAAAAACAAATGACGGGGTACAGCGGCATGTTATCTGC
TTATGTGAAAGGTTCTCCTGAAGATACTATTACTTTTATCCAGAGTTTAA
AATGTTTTCAAATGGCTGAAAGTTTAGGTGGTTATGAAAGTCTAATAGAA
ATACCGTCATTAATGACCCATGCTTCCGTACCCGTTGAACAACGTGCCAT
ATTGGGAATTACTGATAATCTCGTCAGAATTTCTGTAGGTTTGGAAGATA
TCTATTCGATTCTCGAGGATCTAGAACAAGGACTTGATAAGATCAAATAA
ATAAATTTAGCTTGTG
back to top

protein sequence of SMED30018617-orf-1

>SMED30018617-orf-1 ID=SMED30018617-orf-1|Name=SMED30018617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MDKYTATISKARSMITDPSTINSKIATYAIHSGHKAFEHPGTGHPVIPPI
SLSTTFSQKYPNCPLKYDYSRAGNYNREILEITIAAIENAKYCCSYSSGL
ATLSSITQLLKSGDHVLLFNDVYGGTFRYFSKVAAKFNILFDAIDMRNLD
LVKNSLKPNTKMVWIETPSNPLMRIVDIEAIVKITKQANSDTIVVVDNTF
LTPVFQLPMNLGADIVMHSLTKYMNGHSDVLMGAAAMNNQEIFESLKQQQ
LMVGAVPSPFDCFLALRGLRTLVVRMNHHQLSGLAVALFLADHPKIEKVL
HPALFSSSEKKVIEKQMTGYSGMLSAYVKGSPEDTITFIQSLKCFQMAES
LGGYESLIEIPSLMTHASVPVEQRAILGITDNLVRISVGLEDIYSILEDL
EQGLDKIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015421PyrdxlP-dep_Trfase_major
IPR000277Cys/Met-Metab_PyrdxlP-dep_enz
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0030170pyridoxal phosphate binding
GO:0003962cystathionine gamma-synthase activity
GO:0004123cystathionine gamma-lyase activity
GO:0016829lyase activity
GO:0044540L-cystine L-cysteine-lyase (deaminating)
GO:0080146L-cysteine desulfhydrase activity
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006534cysteine metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0019343cysteine biosynthetic process via cystathionine
GO:0019344cysteine biosynthetic process
GO:0019346transsulfuration
GO:0071266'de novo' L-methionine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 390..408
NoneNo IPR availablePANTHERPTHR11808:SF15CYSTATHIONINE GAMMA-LYASEcoord: 12..407
IPR000277Cys/Met metabolism, pyridoxal phosphate-dependent enzymePFAMPF01053Cys_Met_Meta_PPcoord: 27..404
e-value: 1.8E-128
score: 428.3
IPR000277Cys/Met metabolism, pyridoxal phosphate-dependent enzymePIRSFPIRSF001434CGScoord: 14..408
e-value: 5.4E-128
score: 424.7
IPR000277Cys/Met metabolism, pyridoxal phosphate-dependent enzymePANTHERPTHR11808TRANS-SULFURATION ENZYME FAMILY MEMBERcoord: 12..407
IPR000277Cys/Met metabolism, pyridoxal phosphate-dependent enzymePROSITEPS00868CYS_MET_METAB_PPcoord: 214..228
IPR000277Cys/Met metabolism, pyridoxal phosphate-dependent enzymeCDDcd00614CGS_likecoord: 44..405
e-value: 7.60085E-166
score: 467.835
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 273..408
e-value: 3.2E-46
score: 158.9
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 23..272
e-value: 1.4E-80
score: 272.0
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 39..407