SMED30018606
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30018606 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of SMED30018606 vs. Planmine SMEST
Match: SMESG000017693.1 (SMESG000017693.1) HSP 1 Score: 102.064 bits (253), Expect = 1.269e-28 Identity = 53/74 (71.62%), Postives = 61/74 (82.43%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNYY 1354 CKK QL TLYTLP+DK+ L+FKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFTG++ Y Sbjct: 483 CKKNQLGTTLYTLPKDKDKYLQFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTMNY 556 HSP 2 Score: 102.064 bits (253), Expect = 1.269e-28 Identity = 53/74 (71.62%), Postives = 61/74 (82.43%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNYY 1354 CKK QL TLYTLP+DK+ L+FKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFTG++ Y Sbjct: 1104 CKKNQLGTTLYTLPKDKDKYLQFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTMNY 1177 HSP 3 Score: 43.8986 bits (102), Expect = 1.269e-28 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 1 Query: 1048 NCNVRIRSIWC*NCLNGFRKPNTF*EPH 1131 +CNVRIR WC NCLNGFRKP +F E H Sbjct: 453 DCNVRIRCKWCENCLNGFRKPKSF-EKH 479 HSP 4 Score: 43.8986 bits (102), Expect = 1.269e-28 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 1 Query: 1048 NCNVRIRSIWC*NCLNGFRKPNTF*EPH 1131 +CNVRIR WC NCLNGFRKP +F E H Sbjct: 1074 DCNVRIRCKWCENCLNGFRKPKSF-EKH 1100
BLAST of SMED30018606 vs. Planmine SMEST
Match: SMESG000017693.1 (SMESG000017693.1) HSP 1 Score: 102.064 bits (253), Expect = 1.345e-28 Identity = 53/74 (71.62%), Postives = 61/74 (82.43%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNYY 1354 CKK QL TLYTLP+DK+ L+FKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFTG++ Y Sbjct: 483 CKKNQLGTTLYTLPKDKDKYLQFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTMNY 556 HSP 2 Score: 43.8986 bits (102), Expect = 1.345e-28 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 1 Query: 1048 NCNVRIRSIWC*NCLNGFRKPNTF*EPH 1131 +CNVRIR WC NCLNGFRKP +F E H Sbjct: 453 DCNVRIRCKWCENCLNGFRKPKSF-EKH 479 HSP 3 Score: 97.8265 bits (242), Expect = 2.403e-27 Identity = 51/68 (75.00%), Postives = 57/68 (83.82%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFT 1336 CKK QL TLYTLP+DK+ L+FKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFT Sbjct: 1104 CKKNQLGTTLYTLPKDKDKYLQFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFT 1171 HSP 4 Score: 43.8986 bits (102), Expect = 2.403e-27 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 1 Query: 1048 NCNVRIRSIWC*NCLNGFRKPNTF*EPH 1131 +CNVRIR WC NCLNGFRKP +F E H Sbjct: 1074 DCNVRIRCKWCENCLNGFRKPKSF-EKH 1100
BLAST of SMED30018606 vs. Planmine SMEST
Match: SMESG000071708.1 (SMESG000071708.1) HSP 1 Score: 97.4413 bits (241), Expect = 3.897e-24 Identity = 49/84 (58.33%), Postives = 60/84 (71.43%), Query Frame = 2 Query: 1100 FESQIHFKNLTNYCKKYQLDKTLYTLPEDKNLEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNY 1351 F + I C K QL TLYTLP +KNLEFKN +KT TPPF++Y FE+ILP ++I+FQ H+PISAG LLINNFTG +Y Sbjct: 1492 FRNIISLNKHKGLCDKNQLGTTLYTLPLNKNLEFKNWAKTVTPPFVLYADFEAILPSDDIHFQIHMPISAGLLLINNFTGEKSY 1575 HSP 2 Score: 33.113 bits (74), Expect = 3.897e-24 Identity = 11/17 (64.71%), Postives = 14/17 (82.35%), Query Frame = 1 Query: 1054 NVRIRSIWC*NCLNGFR 1104 + R++SIWC CLNGFR Sbjct: 1477 DTRVQSIWCHRCLNGFR 1493 HSP 3 Score: 20.0162 bits (40), Expect = 3.897e-24 Identity = 7/16 (43.75%), Postives = 12/16 (75.00%), Query Frame = 3 Query: 888 LVQMQNHSFTDRKFRT 935 L+ +NHSFTD + ++ Sbjct: 1467 LLNYRNHSFTDTRVQS 1482
BLAST of SMED30018606 vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1) HSP 1 Score: 106.301 bits (264), Expect = 5.460e-24 Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNYYQ 1357 CKK QL TLYTLP+DK+ LEFKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFTG+++Y+ Sbjct: 423 CKKNQLGTTLYTLPKDKDKYLEFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTSYHH 497
BLAST of SMED30018606 vs. Planmine SMEST
Match: SMESG000076702.1 (SMESG000076702.1) HSP 1 Score: 105.916 bits (263), Expect = 6.021e-24 Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = 2 Query: 1139 CKKYQLDKTLYTLPEDKN--LEFKN*SKT*TPPFIIYEYFESILPKENIYFQ*HLPISAGYLLINNFTGISNYYQ 1357 CKK QL TLYTLP+DK+ LEFKN SKT TPPF+IY FESILPK++IYFQ HLPISAG LLINNFTG+++Y+ Sbjct: 423 CKKNQLGTTLYTLPKDKDKYLEFKNWSKTITPPFVIYADFESILPKDDIYFQKHLPISAGLLLINNFTGMTSYHH 497 The following BLAST results are available for this feature:
BLAST of SMED30018606 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30018606 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30018606 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30018606 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30018606 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30018606 ID=SMED30018606|Name=SMED30018606|organism=Schmidtea mediterranea sexual|type=transcript|length=1421bpback to top Annotated Terms
The following terms have been associated with this transcript:
|