Receptor expression-enhancing protein

Overview
NameReceptor expression-enhancing protein
Smed IDSMED30018603
Length (bp)1192
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor expression-enhancing protein (SMED30018603) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor expression-enhancing protein (SMED30018603) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor expression-enhancing protein (SMED30018603) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor expression-enhancing protein (SMED30018603) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018603

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018603SMESG000043862.1 dd_Smed_v4_838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018603SMESG000043862.1 dd_Smed_v4_838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018603SMESG000043862.1 dd_Smed_v4_838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018603SMESG000043862.1 dd_Smed_v4_838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018603SMESG000043862.1 dd_Smed_v4_838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018603SMESG000043862.1 Contig48113newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018603SMESG000043862.1 Contig48113uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30018603SMESG000043862.1 dd_Smed_v6_838_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP6 (receptor accessory protein 6 [Source:HGNC Symbol;Acc:HGNC:30078])

HSP 1 Score: 165.622 bits (418), Expect = 9.810e-49
Identity = 82/152 (53.95%), Postives = 109/152 (71.71%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKID 558
            +DG + ++E  L ++N  T+ L  +EAKTGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY S+KAIE+  KDDDT WLTYWVVYA F L EFF+D+ L W P Y + KC FL+FCMAP  WNG+L++Y+R+++P  LRH   +D
Sbjct:    1 MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVD 152          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP6 (receptor accessory protein 6 [Source:HGNC Symbol;Acc:HGNC:30078])

HSP 1 Score: 164.851 bits (416), Expect = 9.829e-49
Identity = 82/152 (53.95%), Postives = 109/152 (71.71%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKID 558
            +DG + ++E  L ++N  T+ L  +EAKTGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY S+KAIE+  KDDDT WLTYWVVYA F L EFF+D+ L W P Y + KC FL+FCMAP  WNG+L++Y+R+++P  LRH   +D
Sbjct:    1 MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVD 152          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP5 (receptor accessory protein 5 [Source:HGNC Symbol;Acc:HGNC:30077])

HSP 1 Score: 162.54 bits (410), Expect = 8.318e-48
Identity = 84/151 (55.63%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            + + ++ L EKN  TD LA +EAKTGV + ++  G+IG + LYL+ GYGA  L N IGF YPAY S+KAIE+  K+DDT+WLTYWVVY  FS+ EFF+DIFL W P Y +LKC FL++CMAP+  NG+ L+Y+R+I+PF L+HE ++DS +
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVV 156          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP5 (receptor accessory protein 5 [Source:HGNC Symbol;Acc:HGNC:30077])

HSP 1 Score: 141.739 bits (356), Expect = 4.182e-40
Identity = 61/102 (59.80%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  262 AQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            A  L N IGF YPAY S+KAIE+  K+DDT+WLTYWVVY  FS+ EFF+DIFL W P Y +LKC FL++CMAP+  NG+ L+Y+R+I+PF L+HE ++DS +
Sbjct:   46 ASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVV 147          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP6 (receptor accessory protein 6 [Source:HGNC Symbol;Acc:HGNC:30078])

HSP 1 Score: 116.316 bits (290), Expect = 9.131e-31
Identity = 51/107 (47.66%), Postives = 70/107 (65.42%), Query Frame = 1
Query:  319 AIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVL----GFTRK 627
            AIE+  KDDDT WLTYWVVYA F L EFF+D+ L W P Y + KC FL+FCMAP  WNG+L++Y+R+++P  LRH   +D       +++++ +   L    G TR 
Sbjct:    1 AIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVD-------RIMNDLSGRALDAAAGITRN 100          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: yop-1 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q9N4G8])

HSP 1 Score: 125.176 bits (313), Expect = 5.600e-34
Identity = 72/172 (41.86%), Postives = 112/172 (65.12%), Query Frame = 1
Query:  118 NQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRV 633
            + ++K+L E +  T+ LA VE KTGVK+++LV G++G   LYLI G+ AQ + NF+GF+YPAY S+KAIE+  K+DDT+WLTYWV++A  S++EFF+   +   P+Y L K IFL++   P ++ G+  +Y R +KP   RH   ID+ I   +  ++  A ++    R  +
Sbjct:   12 DDVDKQLHEPSTVTNVLATVEQKTGVKRLHLVLGVVGLQALYLIFGHSAQLVCNFMGFVYPAYMSIKAIESSNKEDDTQWLTYWVIFAILSVVEFFSVQIVAVFPVYWLFKSIFLLYLYLP-SFLGAAKLYHRFVKPVAARHSGSIDAKIGNFADRVNSAAGKLANEVRDHM 182          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T03F6.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q8WQD3])

HSP 1 Score: 101.293 bits (251), Expect = 7.760e-25
Identity = 62/157 (39.49%), Postives = 90/157 (57.32%), Query Frame = 1
Query:  175 VEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAADE 645
            +E  TG+K+  L  GLIG   +Y+I+G GA+F+ N IG  YPAY SVKAI T+  DDDT WL YW V+ AFS+++FF    + + P+Y + K  FL++   P T +GS +IY +LI PFV   EK +   +   +  +       L      +  D+
Sbjct:   48 LEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVCNLIGVAYPAYVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYLYLPET-HGSHVIYHQLIDPFVAHMEKSMSRKLPANAGTVPNDQGSALDANNNVIKPDQ 203          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T03F6.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q8WQD3])

HSP 1 Score: 101.293 bits (251), Expect = 7.760e-25
Identity = 62/157 (39.49%), Postives = 90/157 (57.32%), Query Frame = 1
Query:  175 VEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAADE 645
            +E  TG+K+  L  GLIG   +Y+I+G GA+F+ N IG  YPAY SVKAI T+  DDDT WL YW V+ AFS+++FF    + + P+Y + K  FL++   P T +GS +IY +LI PFV   EK +   +   +  +       L      +  D+
Sbjct:   48 LEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVCNLIGVAYPAYVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYLYLPET-HGSHVIYHQLIDPFVAHMEKSMSRKLPANAGTVPNDQGSALDANNNVIKPDQ 203          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: F56B3.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:O45108])

HSP 1 Score: 93.5893 bits (231), Expect = 4.270e-22
Identity = 56/149 (37.58%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKT-GVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKID 558
            +N +   L E +     +A++ A++ G K+ +L     G I  +L+ G  A+ L N IGF YP Y SVKAI +   DDDT WL YW  +A   L++FF++  L W P Y + K  FLV+   P T  GS++ YE ++ P V+  +K +D
Sbjct:   50 QNDIHNFLFESHGQIFDMAMMYAESAGFKRDHLSYAAFGLIAFFLVFGSVARLLCNLIGFGYPTYASVKAIRSPGGDDDTVWLIYWTCFAVLYLVDFFSEAILSWFPFYYIAKACFLVYLYLPQT-QGSVMFYETIVDPLVIFVDKNLD 197          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T19C3.4 (pep chromosome:WBcel235:III:618246:620254:-1 gene:WBGene00020562.1 transcript:T19C3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T19C3.4)

HSP 1 Score: 83.9593 bits (206), Expect = 1.928e-18
Identity = 40/93 (43.01%), Postives = 60/93 (64.52%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFL-FWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDS 561
            G LYPAY S KA+ TK+  +  KW+ YW+V+A +S LE   D+ L FW P Y  LK +F+ + ++P T  G+ ++Y + + P + RHEK ID+
Sbjct:   14 GTLYPAYRSYKAVRTKDTREYVKWMMYWIVFAIYSFLENLLDLVLAFWFPFYFQLKIVFIFWLLSPWT-KGASILYRKWVHPTLNRHEKDIDA 105          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0087525)

HSP 1 Score: 138.272 bits (347), Expect = 5.194e-39
Identity = 75/166 (45.18%), Postives = 106/166 (63.86%), Query Frame = 1
Query:   88 SIMNLVDGYKNQLEKKLSEKN-AFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
             +   ++GYK+ + K L + +  +T     VE KTGV +V +  G +G   +YLI G+GAQ L N IG LYPAY S+ AIE+  K DDTKWL YWV +  F+++EFF+ +    IP Y LLKC FL++CM PT  NGS +IY +L++P+ L+H + +D  I  G K
Sbjct:    4 QVKQFLNGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMK 169          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0302453)

HSP 1 Score: 138.272 bits (347), Expect = 5.194e-39
Identity = 75/166 (45.18%), Postives = 106/166 (63.86%), Query Frame = 1
Query:   88 SIMNLVDGYKNQLEKKLSEKN-AFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
             +   ++GYK+ + K L + +  +T     VE KTGV +V +  G +G   +YLI G+GAQ L N IG LYPAY S+ AIE+  K DDTKWL YWV +  F+++EFF+ +    IP Y LLKC FL++CM PT  NGS +IY +L++P+ L+H + +D  I  G K
Sbjct:    4 QVKQFLNGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMK 169          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0302452)

HSP 1 Score: 125.946 bits (315), Expect = 1.212e-34
Identity = 55/107 (51.40%), Postives = 73/107 (68.22%), Query Frame = 1
Query:  262 AQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
            AQ L N IG LYPAY S+ AIE+  K DDTKWL YWV +  F+++EFF+ +    IP Y LLKC FL++CM PT  NGS +IY +L++P+ L+H + +D  I  G K
Sbjct:   38 AQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMK 144          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0302451)

HSP 1 Score: 125.561 bits (314), Expect = 2.380e-34
Identity = 55/107 (51.40%), Postives = 73/107 (68.22%), Query Frame = 1
Query:  262 AQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
            AQ L N IG LYPAY S+ AIE+  K DDTKWL YWV +  F+++EFF+ +    IP Y LLKC FL++CM PT  NGS +IY +L++P+ L+H + +D  I  G K
Sbjct:   45 AQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMK 151          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: CG4960 (gene:FBgn0039371 transcript:FBtr0346108)

HSP 1 Score: 123.635 bits (309), Expect = 1.970e-33
Identity = 68/166 (40.96%), Postives = 98/166 (59.04%), Query Frame = 1
Query:   88 SIMNLVDGYKNQLEKKLSEKN-AFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
             +    +GYK  + + L + +  +T A   +E KTGV++V +  G I F   YL+ G+ AQ L N IG LYPAY S+  IE+  K DD +WL YWV +  F+++EF+  +    IP Y LLKC FL++CM PT  NGS LIY +L++P+ L+    +D   A   K
Sbjct:    7 QVQRFFNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVDMMSAGVPK 172          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep5 (receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9181])

HSP 1 Score: 168.703 bits (426), Expect = 2.724e-50
Identity = 89/151 (58.94%), Postives = 113/151 (74.83%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            K + +  L EKN  TD LA +EAKTGV + Y+   +I FI +YL++GYGA  L N IGF+YPAY S+KAIE+  KDDDTKWLTYWVVY  FS++EFF DIFL W P Y L KC FLV+CMAPT  NGS+++Y R+I+PF L++E KID+ +
Sbjct:    6 KQRFDNALHEKNMVTDLLAKIEAKTGVNRSYIAYAVIAFIAIYLVIGYGASLLCNLIGFVYPAYISIKAIESPAKDDDTKWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAKCAFLVWCMAPTPSNGSIMLYTRIIRPFFLKNEAKIDNVM 156          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: zgc:101744 (zgc:101744 [Source:ZFIN;Acc:ZDB-GENE-050320-111])

HSP 1 Score: 165.622 bits (418), Expect = 3.787e-49
Identity = 85/156 (54.49%), Postives = 112/156 (71.79%), Query Frame = 1
Query:  142 EKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            +KN  TD LA++E KTGV+K Y+  G++  +  YLI GYGA  L N IGF+YPAY S+KAIE+  K+DDTKWLTYWVVY  FS+ EFF+DIFLFW P Y   KC+FL++CMAP +WNGS +IY R+++PF L+HE   D+ ++  S      AE +
Sbjct:   15 QKNVLTDFLAVLEEKTGVQKQYIAAGVVSIVAFYLIFGYGASLLCNLIGFIYPAYASIKAIESNNKEDDTKWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCLFLLWCMAPISWNGSQVIYTRVVRPFFLKHEAAFDNVVSDLSGKAKSAAETM 170          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 162.54 bits (410), Expect = 9.791e-48
Identity = 83/165 (50.30%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K+++E  L+EKN  TD L  +E KTG+KK YL  G  G    +L++GYGA  + N IGF+YPAY S+KAIE+  K+DDT+WLTYWV+Y  FS+ EFF+DIFL W P Y + KC+FL++CMAP +WNGS ++Y  +++PF L+HE  +D  ++  S      AE V
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENV 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 162.54 bits (410), Expect = 9.791e-48
Identity = 83/165 (50.30%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K+++E  L+EKN  TD L  +E KTG+KK YL  G  G    +L++GYGA  + N IGF+YPAY S+KAIE+  K+DDT+WLTYWV+Y  FS+ EFF+DIFL W P Y + KC+FL++CMAP +WNGS ++Y  +++PF L+HE  +D  ++  S      AE V
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENV 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 162.54 bits (410), Expect = 9.791e-48
Identity = 83/165 (50.30%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K+++E  L+EKN  TD L  +E KTG+KK YL  G  G    +L++GYGA  + N IGF+YPAY S+KAIE+  K+DDT+WLTYWV+Y  FS+ EFF+DIFL W P Y + KC+FL++CMAP +WNGS ++Y  +++PF L+HE  +D  ++  S      AE V
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENV 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:496723])

HSP 1 Score: 162.925 bits (411), Expect = 5.587e-48
Identity = 85/165 (51.52%), Postives = 117/165 (70.91%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K+  EK L +KN  TD L  +EAKTGV + Y+   +IG + +YL++GYGA  L N IGF YPAY S+KAIE+  KDDDT+WLTYWVVY  FS++EFF DIFL W P Y ++KC FL++CM+P+  NG+ LIY+R+++PF L+HE ++D  +       SE A+ +
Sbjct:    6 KDSFEKFLHQKNVCTDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAYVSIKAIESATKDDDTQWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHEGEMDRLVKDIKDKASETADTI 170          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:496723])

HSP 1 Score: 162.925 bits (411), Expect = 6.225e-48
Identity = 85/165 (51.52%), Postives = 117/165 (70.91%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K+  EK L +KN  TD L  +EAKTGV + Y+   +IG + +YL++GYGA  L N IGF YPAY S+KAIE+  KDDDT+WLTYWVVY  FS++EFF DIFL W P Y ++KC FL++CM+P+  NG+ LIY+R+++PF L+HE ++D  +       SE A+ +
Sbjct:    6 KDSFEKFLHQKNVCTDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAYVSIKAIESATKDDDTQWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHEGEMDRLVKDIKDKASETADTI 170          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:548805])

HSP 1 Score: 159.458 bits (402), Expect = 1.203e-46
Identity = 84/152 (55.26%), Postives = 109/152 (71.71%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIA 570
            K +L+  L+  N  +  L   E KTG+KK YL  G I  + LYLI GYGA  + N IGF+YPAY SVKAIE+ +K DDT WLTYWVVY  FS++EFF+DIFLFW P Y L KC FL++CMAP +WNGS ++Y+R I+PF L+H + +DS ++
Sbjct:    5 KERLQNFLNGDNFVSRLLGKAEEKTGIKKYYLASGSICSLGLYLIFGYGASLVCNLIGFVYPAYVSVKAIESPDKKDDTIWLTYWVVYGVFSVVEFFSDIFLFWFPFYYLGKCCFLLWCMAPFSWNGSQILYDRFIRPFFLKHHRTVDSVVS 156          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:548805])

HSP 1 Score: 159.844 bits (403), Expect = 1.436e-46
Identity = 84/152 (55.26%), Postives = 109/152 (71.71%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIA 570
            K +L+  L+  N  +  L   E KTG+KK YL  G I  + LYLI GYGA  + N IGF+YPAY SVKAIE+ +K DDT WLTYWVVY  FS++EFF+DIFLFW P Y L KC FL++CMAP +WNGS ++Y+R I+PF L+H + +DS ++
Sbjct:    5 KERLQNFLNGDNFVSRLLGKAEEKTGIKKYYLASGSICSLGLYLIFGYGASLVCNLIGFVYPAYVSVKAIESPDKKDDTIWLTYWVVYGVFSVVEFFSDIFLFWFPFYYLGKCCFLLWCMAPFSWNGSQILYDRFIRPFFLKHHRTVDSVVS 156          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: sts (steroid sulfatase [Source:Xenbase;Acc:XB-GENE-1013410])

HSP 1 Score: 86.2705 bits (212), Expect = 1.094e-18
Identity = 42/94 (44.68%), Postives = 61/94 (64.89%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            G LYPAY S KA++TK   +  +W+ YW+V+A F  +E FTDIF+ W P Y  +K  F+V+ ++P T  G+ L+Y + I P +   EK+IDS I
Sbjct:   15 GLLYPAYASYKAVKTKNVREYVRWMMYWIVFALFMTVETFTDIFIAWFPFYYEIKMAFVVWLLSPYT-RGASLLYRKCIHPTLSLKEKEIDSYI 107          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 170.629 bits (431), Expect = 7.139e-51
Identity = 92/179 (51.40%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAA 639
            +DG + + E+ L +KN  T+AL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y   KC FL+FCM P  WNG+LL+Y R+I+P  L+H   +DSA ++ S    + A    G TR  + A
Sbjct:    1 MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAA---GITRDVLQA 176          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 170.629 bits (431), Expect = 7.139e-51
Identity = 92/179 (51.40%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAA 639
            +DG + + E+ L +KN  T+AL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y   KC FL+FCM P  WNG+LL+Y R+I+P  L+H   +DSA ++ S    + A    G TR  + A
Sbjct:    1 MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAA---GITRDVLQA 176          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 168.703 bits (426), Expect = 1.908e-50
Identity = 91/174 (52.30%), Postives = 119/174 (68.39%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTR 624
            +DG + + E+ L +KN  T+AL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y   KC FL+FCM P  WNG+LL+Y R+I+P  L+H   +DSA ++ S    + A    G TR
Sbjct:    1 MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAA---GITR 171          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep5 (receptor accessory protein 5 [Source:MGI Symbol;Acc:MGI:1270152])

HSP 1 Score: 160.999 bits (406), Expect = 2.162e-47
Identity = 82/151 (54.30%), Postives = 112/151 (74.17%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            + + ++ L EKN  TD LA +EAKTGV + ++  G+IG + LYL+ GYGA  L N IGF YPAY S+KAIE+  KDDDT+WLTYWVVY  FS+ EFF+D+FL W P Y +LKC FL++CMAP+  NG+ ++Y R+I+P  L+HE ++DS +
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLKHESQVDSVV 156          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 114.775 bits (286), Expect = 1.353e-30
Identity = 64/112 (57.14%), Postives = 82/112 (73.21%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLY 438
            +DG + + E+ L +KN  T+AL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y
Sbjct:    1 MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFY 112          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q5XI60|REEP6_RAT (Receptor expression-enhancing protein 6 OS=Rattus norvegicus OX=10116 GN=Reep6 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.568e-50
Identity = 93/179 (51.96%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAA 639
            +DG + + E+ L +KN  TDAL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y   KC FL+FCM P  WNG+LL+Y R+I+P  L+H   +DSA ++ S    + A    G TR  + A
Sbjct:    1 MDGLRQRFERFLEQKNVATDALGALEARTGVEKRYLAAGALTLLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHVALDSAASQLSGRALDIAA---GITRDVLQA 176          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q9JM62|REEP6_MOUSE (Receptor expression-enhancing protein 6 OS=Mus musculus OX=10090 GN=Reep6 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 4.994e-50
Identity = 92/179 (51.40%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVAA 639
            +DG + + E+ L +KN  T+AL  +EA+TGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY SVKAIE+  K+DDT WLTYWVVYA F L+EFF+D+ LFW P Y   KC FL+FCM P  WNG+LL+Y R+I+P  L+H   +DSA ++ S    + A    G TR  + A
Sbjct:    1 MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAA---GITRDVLQA 176          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q96HR9|REEP6_HUMAN (Receptor expression-enhancing protein 6 OS=Homo sapiens OX=9606 GN=REEP6 PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 4.711e-48
Identity = 82/152 (53.95%), Postives = 109/152 (71.71%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKID 558
            +DG + ++E  L ++N  T+ L  +EAKTGV+K YL  G +  + LYL+ GYGA  L N IGF+YPAY S+KAIE+  KDDDT WLTYWVVYA F L EFF+D+ L W P Y + KC FL+FCMAP  WNG+L++Y+R+++P  LRH   +D
Sbjct:    1 MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVD 152          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q60870|REEP5_MOUSE (Receptor expression-enhancing protein 5 OS=Mus musculus OX=10090 GN=Reep5 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.738e-47
Identity = 83/151 (54.97%), Postives = 113/151 (74.83%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            + + ++ L EKN  TD LA +EAKTGV + ++  G+IG + LYL+ GYGA  L N IGF YPAY S+KAIE+  KDDDT+WLTYWVVY  FS+ EFF+D+FL W+P Y +LKC FL++CMAP+  NG+ ++Y R+I+P  LRHE ++DS +
Sbjct:    2 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLRHESQVDSVV 152          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q5RE33|REEP5_PONAB (Receptor expression-enhancing protein 5 OS=Pongo abelii OX=9601 GN=REEP5 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.751e-47
Identity = 84/151 (55.63%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAI 567
            + + ++ L EKN  TD LA +EAKTGV + ++  G+IG + LYL+ GYGA  L N IGF YPAY S+KAIE+  K+DDT+WLTYWVVY  FS+ EFF+DIFL W P Y +LKC FL++CMAP+  NG+ L+Y+R+I+PF L+HE ++DS +
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQVDSVV 156          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: R7UL64 (Receptor expression-enhancing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_20933 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 7.297e-64
Identity = 110/169 (65.09%), Postives = 140/169 (82.84%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            ++ +K +L+K L EKNAFTD L  VEAKT V+++YLV GL  F+ LYL+VGYGAQFL NF+GFLYPAY SVKAIE+K KDDDTKWLTYWVVY+ FSL+EFFTDIFLFWIP Y LLKC+FL++CM PT+WNGS++IY ++I+PF+L+H+ K+D A+ K + V  E  +EV
Sbjct:    5 IEAFKAKLDKALHEKNAFTDILEKVEAKTNVRRLYLVMGLAAFLALYLMVGYGAQFLCNFLGFLYPAYASVKAIESKGKDDDTKWLTYWVVYSGFSLVEFFTDIFLFWIPFYWLLKCVFLLYCMVPTSWNGSIMIYNKVIRPFILKHQAKVDEALDKAAGVAQEVLDEV 173          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A2T7NF13 (Receptor expression-enhancing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20226 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 6.017e-59
Identity = 107/174 (61.49%), Postives = 134/174 (77.01%), Query Frame = 1
Query:  103 VDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISE---FAEEVLG 615
            ++ +KN+ +K L EKNA  D    +E+KTGV+++Y+  G IG + LYL+VGYGAQFL NFIGFLYPAY SVKAIE+K+KDDDTKWLTYWV Y+AFSL+EFF DIFLFWIP Y LLKC+FLV+C APT WNGS +IY R I+PF+LRH+ KID  + +   +I E    AEE + 
Sbjct:    8 IENWKNKFDKLLHEKNAVNDVFEKLESKTGVQRLYIALGFIGIVALYLMVGYGAQFLCNFIGFLYPAYASVKAIESKQKDDDTKWLTYWVTYSAFSLVEFFADIFLFWIPFYWLLKCVFLVWCFAPTEWNGSHVIYYRFIRPFILRHQDKIDKKLDEAKGIIKEAQDLAEETIA 181          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A1I8HYU1 (Receptor expression-enhancing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010854g1 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.632e-58
Identity = 110/192 (57.29%), Postives = 137/192 (71.35%), Query Frame = 1
Query:  112 YKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLG-FTRKRVAADEEVATVKESEELND 684
            Y  +LEK L++ NA   A  +VE KTGVK++Y   GLI F+ +YL+ GYG+ FLANFIGFLYPAY SVKAIET EKDDDTKWLTYWVVYAAFSLLE FTDIFL+WIPLYA LKCIFL++ M P + NGS+L+Y R+I+P VL+H+K ID+ + K      +   E  G   R+ V A  +  +   S+E  D
Sbjct:    3 YVKRLEKFLNQDNAIGQACKVVEEKTGVKRLYFALGLIAFLAIYLMFGYGSNFLANFIGFLYPAYASVKAIETHEKDDDTKWLTYWVVYAAFSLLETFTDIFLWWIPLYAFLKCIFLIYLMVPISANGSVLLYNRVIRPIVLKHQKSIDATLGKVHDAAGQLVTEAEGELKRRAVDAAADQISAPNSDETGD 194          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A2C9JDF9 (Receptor expression-enhancing protein OS=Biomphalaria glabrata OX=6526 GN=106054297 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 4.314e-57
Identity = 101/171 (59.06%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  106 DGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISE---FAEEV 609
            + +K +L+K L EKN   D L  +E KTGVK++Y+    I  I L+L+VGYGAQFL NFIGF+YPAY SVKAIE+++KDDDTKWLTYWVVY+ FSL+EFF+DIFLFWIP Y LLKC+FLV+C  P  WNGS+ +Y R I+PF+LRH+ +ID+A+ K  + ++E    AE+V
Sbjct:    7 EAFKARLDKVLHEKNKVNDILEKIELKTGVKRLYIALVFISIIALWLMVGYGAQFLCNFIGFIYPAYASVKAIESRDKDDDTKWLTYWVVYSVFSLVEFFSDIFLFWIPFYWLLKCVFLVWCFMPVPWNGSITLYYRFIRPFILRHQDRIDTALDKAKEAVAEAKDLAEDV 177          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A2C9JDG0 (Receptor expression-enhancing protein OS=Biomphalaria glabrata OX=6526 GN=106054297 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 7.555e-57
Identity = 98/163 (60.12%), Postives = 128/163 (78.53%), Query Frame = 1
Query:  106 DGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISE 594
            + +K +L+K L EKN   D L  +E KTGVK++Y+    I  I L+L+VGYGAQFL NFIGF+YPAY SVKAIE+++KDDDTKWLTYWVVY+ FSL+EFF+DIFLFWIP Y LLKC+FLV+C  P  WNGS+ +Y R I+PF+LRH+ +ID+A+ K  + ++E
Sbjct:    7 EAFKARLDKVLHEKNKVNDILEKIELKTGVKRLYIALVFISIIALWLMVGYGAQFLCNFIGFIYPAYASVKAIESRDKDDDTKWLTYWVVYSVFSLVEFFSDIFLFWIPFYWLLKCVFLVWCFMPVPWNGSITLYYRFIRPFILRHQDRIDTALDKAKEAVAE 169          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:103047111])

HSP 1 Score: 171.785 bits (434), Expect = 1.236e-51
Identity = 94/179 (52.51%), Postives = 121/179 (67.60%), Query Frame = 1
Query:  100 LVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVA 636
            +    K + E+ L EKN  TD L  +EAKTGV + Y+   +I  I +YL+VGYGA  L N IGF+YPAY S+KAIE+ +KDDDTKWLTYWVVY  FS+ EFF DIFL W P Y + KC FLV+CMAPT  NGS++IY R+I+PF LR+E KID  +       S+ A+++    +K  A
Sbjct:    1 MAQALKERFERFLYEKNMMTDVLGKIEAKTGVSRTYIALAVIALIAIYLVVGYGASLLCNLIGFVYPAYISIKAIESTDKDDDTKWLTYWVVYGVFSVAEFFADIFLSWFPFYYIGKCAFLVWCMAPTPANGSIMIYTRIIRPFFLRNEAKIDDVVKDIKGKASDAADKIRDEAKKATA 179          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep6 (receptor expression-enhancing protein 6 [Source:NCBI gene;Acc:103040819])

HSP 1 Score: 170.244 bits (430), Expect = 8.572e-51
Identity = 92/197 (46.70%), Postives = 126/197 (63.96%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVL-----GFTRKRVAADEEVATVKESEELNDNE 690
            K ++E  L+EKN  TD L  +E KTG+KK YL  G +    LYL+ GYGA  L N IGF+YPAY S+KAIE+  K+DDT+WLTYWVVY  F + EFF+DIFL+W P Y + KC+FL++CMAP +WNGS ++Y  L++PF L+HE  +D+ ++  S      AE V         + R+   E + T K+    + NE
Sbjct:    9 KTRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAIGAVSVTGLYLLFGYGASLLCNLIGFVYPAYFSIKAIESPNKEDDTQWLTYWVVYGFFGVGEFFSDIFLYWFPFYYVFKCLFLLWCMAPFSWNGSQVLYNHLVRPFFLKHEATVDNMVSDLSGKAMNAAESVTREVIQSLAKNRIPLSERMDTSKQLPSTSRNE 205          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041103.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000334.1:568138:578213:-1 gene:ENSAMXG00000033021.1 transcript:ENSAMXT00000041103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 5.533e-36
Identity = 57/101 (56.44%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  310 SVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVL 612
            S+KAIE++ K+DDT+WLTYWVVY  FS+ EFF+DIFLFW P Y   KC+FL++CMAP TWNGS +IY RL++PF L+HE   DS +   S      A+ V+
Sbjct:   50 SIKAIESRNKEDDTQWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCVFLLWCMAPVTWNGSQIIYTRLVRPFFLKHEAAFDSVVKDLSGKAKSAAQSVV 150          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054484.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000334.1:571283:578213:-1 gene:ENSAMXG00000033021.1 transcript:ENSAMXT00000054484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 6.258e-36
Identity = 57/101 (56.44%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  310 SVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVL 612
            S+KAIE++ K+DDT+WLTYWVVY  FS+ EFF+DIFLFW P Y   KC+FL++CMAP TWNGS +IY RL++PF L+HE   DS +   S      A+ V+
Sbjct:   50 SIKAIESRNKEDDTQWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCVFLLWCMAPVTWNGSQIIYTRLVRPFFLKHEAAFDSVVKDLSGKAKSAAQSVV 150          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep3b (receptor expression-enhancing protein 3 [Source:NCBI gene;Acc:103044975])

HSP 1 Score: 85.1149 bits (209), Expect = 1.249e-18
Identity = 37/96 (38.54%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAK 573
            G LYPAY S KA++TK   +  +W+ YW+V+A ++++E  TD+ + W PLY  +K  F+++ ++P T  G+ LIY R++ P +   E++ID  I +
Sbjct:   15 GTLYPAYNSYKAVKTKNVKEYVRWMMYWIVFALYTVVETITDLTVAWFPLYYEIKIAFVIWLLSPYT-RGASLIYRRILHPLLTSREREIDDYIVQ 109          
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Match: reep5 (receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9181])

HSP 1 Score: 162.54 bits (410), Expect = 8.756e-49
Identity = 91/165 (55.15%), Postives = 115/165 (69.70%), Query Frame = 1
Query:  115 KNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
            K   +  + EKN FT+AL +VE KTGV K  L  GL  FI +YLIVGYGA  L NFIGFLYPAY S+KAIE+  KDDDT+WL YWVVY  F ++EFF+DIFL+W+P Y  +KC+FLV+CMAP  +NG+  IY  LI+P+ L+HE K+D       K   E A+ +
Sbjct:    5 KEMFDNFVKEKNVFTEALDLVEKKTGVSKSILALGLSVFIGIYLIVGYGASLLCNFIGFLYPAYYSIKAIESVNKDDDTQWLIYWVVYGFFCVVEFFSDIFLYWVPFYYFIKCVFLVWCMAPVKYNGAQKIYTLLIRPWFLKHEGKLDDIANNLGKKAKEAADAI 169          
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Match: reep2 (receptor accessory protein 2 [Source:NCBI gene;Acc:568927])

HSP 1 Score: 64.6994 bits (156), Expect = 1.759e-12
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 1
Query:  352 KWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
            +W+ YW+V+A F+  E FTD+ L WIP Y  LK   +V+ ++P T  GS ++Y + + P +   E++ID  I +  +
Sbjct:    2 RWMMYWIVFALFTTFETFTDLLLSWIPFYYELKIALVVWLLSPYT-KGSSVLYRKFVHPMLSSREQEIDEYIVQAKE 77          
BLAST of Receptor expression-enhancing protein vs. Ensembl Yeast
Match: YOP1 (Reticulon-interacting protein; ER integral membrane protein involved in the generation of tubular ER morphology; promotes membrane curvature; forms tubules in vitro; regulates the ER asymmetry-induced inheritance block during ER stress; role in ER-derived peroxisomal biogenesis; interacts with Yip1p to mediate membrane traffic and with Sey1p to maintain ER morphology; facilitates lipid exchange between the ER and mitochondria; forms ER foci upon DNA replication stress [Source:SGD;Acc:S000006232])

HSP 1 Score: 84.3445 bits (207), Expect = 8.286e-20
Identity = 37/94 (39.36%), Postives = 62/94 (65.96%), Query Frame = 1
Query:  262 AQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRH 543
             + L+NF GF+ PAY S+ A++T    DDT+ LTYW+V++  S++EF++   L+ IP Y  LK +FL++   P T  G+ +IY++++ P   R+
Sbjct:   59 GEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQT-GGARMIYQKIVAPLTDRY 151          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO32055 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW66])

HSP 1 Score: 153.295 bits (386), Expect = 6.159e-45
Identity = 93/162 (57.41%), Postives = 121/162 (74.69%), Query Frame = 1
Query:  121 QLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEE 606
             LE  L EKN FTDAL  VE KT VKK+YL  GL+G   LYLI GYGA  +   +GF YPAY SVKA+E+ +KDDDT+WL YWVV+A+F+++EFF+DI L W PLY L K IFL +CMAP +WNGS  +Y+++IKPFVLRH+ +IDS + K  + + ++A+E
Sbjct:   14 NLENWLEEKNYFTDALGKVEEKTKVKKLYLFLGLVGVFSLYLIFGYGADLIVTVLGFAYPAYQSVKAVESVQKDDDTQWLIYWVVFASFNIVEFFSDILLSWFPLYFLTKLIFLGWCMAPVSWNGSDTLYQKVIKPFVLRHQSQIDSTLEKVGEKMDKYAKE 175          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO46781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP23])

HSP 1 Score: 108.227 bits (269), Expect = 1.737e-27
Identity = 66/206 (32.04%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  106 DGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAE-------------EVLGFTRKRVAADEEVATVKESEELND 684
            D    +++  L ++N FTD L  +E  T V +   V  ++ F +LY+  GY A    N I  ++P Y S+ AIE  + +  TKWL YWV++A  + +E    +F+ W+P + LLK +FLV+CMAP   +GS ++Y R+++P V+RH+ +++  I+  +K + + AE             +++GFT + V    E   +++ E   D
Sbjct:   23 DTIMEEIDSLLMQQNFFTDLLRKIENFTRVPRRIQVLLMVLFTLLYVAEGYAAACFCNVIAVVFPVYASISAIENPDYEIGTKWLMYWVIFAFVNFME----VFIAWLPSFYLLKFLFLVWCMAPGRVSGSEVMYFRVVRPLVMRHKARVNDVISDAAKRVRQVAERTVDDLVASRAAGKIIGFTHEGVT--NETPAIEQPENSID 222          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO40347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K3])

HSP 1 Score: 90.5077 bits (223), Expect = 6.987e-22
Identity = 43/100 (43.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFL-FWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK 582
            G LYPAY S KAI+TK   +  +W+ YW+V+A F   E FTD+ L  W P Y  +K IF+++ ++PTT  GS ++Y + + P + +HEK+IDS I +  +
Sbjct:   10 GTLYPAYNSYKAIKTKNVREYVRWMMYWIVFALFITAELFTDMLLGVWFPFYYEIKIIFMLWLLSPTT-KGSSVLYRKFVHPMLSKHEKEIDSYIEQAKE 108          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep6 (receptor expression-enhancing protein 6 [Source:NCBI gene;Acc:101164298])

HSP 1 Score: 174.866 bits (442), Expect = 4.042e-52
Identity = 95/199 (47.74%), Postives = 126/199 (63.32%), Query Frame = 1
Query:   88 SIMNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIA----KGSKVISEFAEEVLGFTRKRVAADEEVATVKESE 672
             ++++    K + EK L+EKN  TD L  VE KTG+KK ++  G +    LYL+ GYGA  L N IGF YPAY S+KAIE+  KDDDTKWLTYWVVY  FSL EFF+DIFL+W P Y   KC+FL++CMAP +WNGS +IY ++++P  LRHE  +D+ ++    K          EVL    K       +ATV +S+
Sbjct:    2 GLLDIFSSIKERAEKFLNEKNMVTDFLGKVEEKTGIKKKFIAAGAVSLTGLYLVYGYGASLLCNLIGFAYPAYYSIKAIESPCKDDDTKWLTYWVVYGVFSLGEFFSDIFLYWFPFYYAFKCLFLLWCMAPMSWNGSQIIYNKVVRPIFLRHEATVDNMVSDLSGKAMSAAENLTREVLSTLVKNKTLVTPMATVAQSD 200          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: zgc:101744 (receptor expression-enhancing protein 5 [Source:NCBI gene;Acc:101170803])

HSP 1 Score: 164.081 bits (414), Expect = 9.072e-49
Identity = 89/152 (58.55%), Postives = 120/152 (78.95%), Query Frame = 1
Query:  118 NQLEKK----LSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDS 561
            NQL+++    L+EKN  TD LA +E KTGVKK ++V GL GF++LYL+ GYGA  L+N IGF+YPAY S+KAIE+K K+DDT+WLTYWVVY  F+++E F+DIFLFW+P Y + KC+FLV+CMAP  WNGS ++Y R+I PF L+H+  +D+
Sbjct:    2 NQLKERFTAFLNEKNFVTDQLATLEQKTGVKKEFIVLGLFGFLVLYLLFGYGASLLSNLIGFIYPAYFSIKAIESKNKEDDTQWLTYWVVYGLFTVVEAFSDIFLFWLPFYYVGKCLFLVWCMAPVKWNGSNMLYSRVILPFFLKHQTAMDN 153          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep5 (receptor expression-enhancing protein 5 [Source:NCBI gene;Acc:101173158])

HSP 1 Score: 157.918 bits (398), Expect = 2.545e-46
Identity = 88/179 (49.16%), Postives = 120/179 (67.04%), Query Frame = 1
Query:  100 LVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRKRVA 636
            +  G + + E+ L + NA T  LA +EA++GV + Y+  G+IG I +YL++GYGA  L N IGF+YPAY S+KAIE+  K+DDTKWLTYWVVY  FS+ EFF DIFL W P Y + KC FLV+CMAP   NGS+ IY R+I+PF L++E  ID  +       S+ A+++    +K  A
Sbjct:    1 MAQGLRERFERFLHKDNALTAVLAKLEARSGVSRTYISLGVIGIIAVYLVIGYGASLLCNLIGFMYPAYISIKAIESATKEDDTKWLTYWVVYGIFSVAEFFADIFLSWFPFYYIGKCAFLVWCMAPIPSNGSVQIYHRIIRPFFLKNEATIDDTVKNLKDKASDAADKIRDEAKKATA 179          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep1 (receptor accessory protein 1 [Source:NCBI gene;Acc:101156617])

HSP 1 Score: 85.1149 bits (209), Expect = 6.763e-18
Identity = 44/114 (38.60%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEVLGFTRK 627
            G LYPAY S KA+++K+  +  KW+ YW+++A F  +E FTD+FL W+P Y  LK  F+V+ ++P T  GS ++Y + + P +   EK ID  I        +  + +L F RK
Sbjct:   73 GTLYPAYSSYKAVKSKDVKEYVKWMMYWIIFALFMTVEAFTDMFLCWLPFYYELKIAFVVWLLSPYT-KGSSVLYRKFVHPTLSSKEKDIDDYICHAK---DKSYDTLLHFGRK 182          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep2 (receptor accessory protein 2 [Source:NCBI gene;Acc:101159201])

HSP 1 Score: 83.1889 bits (204), Expect = 1.020e-17
Identity = 40/97 (41.24%), Postives = 60/97 (61.86%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKG 576
            G LYPAY S KA++TK   +  KW+ YW+V+A F+  E  TD+ L W P Y  LK  F+++ ++P T  GS ++Y + + P +   EK+ID  IA+ 
Sbjct:   15 GTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFALFTTAETATDLLLSWFPFYFELKIAFVIWLLSPYT-KGSSVLYRKFVHPTLSNKEKEIDEYIAQA 110          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000043862.1 (SMESG000043862.1)

HSP 1 Score: 299.671 bits (766), Expect = 9.102e-102
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 1
Query:   94 MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEE 606
            MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKVYLVGGLIGFIILYLIVGYGAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEE
Sbjct:    1 MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKVYLVGGLIGFIILYLIVGYGAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEE 171          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000036637.1 (SMESG000036637.1)

HSP 1 Score: 180.259 bits (456), Expect = 6.881e-55
Identity = 103/184 (55.98%), Postives = 130/184 (70.65%), Query Frame = 1
Query:   94 MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGS----KVISEFAEEVLGFTRKRV 633
            M   + Y+ +LE  L++KNAFTD LA +E K  V +V L  GLI  I LYLI GY   FLAN IGF++PAY S+KAIET +KDDDTKWLTYWVVYAAFSL+E  TDIFL WIPLYALLKC FLV+ M P  WNGS+ IY  +I+P+VL+++ KID  + + S    ++I +  E    F ++RV
Sbjct:    1 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGSIYIYYSIIRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERV 184          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000042627.1 (SMESG000042627.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.103e-34
Identity = 65/163 (39.88%), Postives = 101/163 (61.96%), Query Frame = 1
Query:  121 QLEKKLSEKNAFTDALAIVEAKTGVKKXXXXXXXXXXXXXXXXXXXXAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSKVISEFAEEV 609
             ++ KL  KN FT+ LA  E  TGV +  +  G+   +ILY++ G  A  + N IGF+YPAY S+  IE++ K +D KW+TYW +Y+   LLE F +  L  IP Y + KC FL+FCM    WNGSL+ Y+ +++P +++++  IDSA+   +   ++F  +V
Sbjct:   10 SIDSKLQGKNIFTNILAYFEKVTGVPRSKICVGICFVVILYVLFGPYAIAIVNLIGFIYPAYASLNEIESRNKTEDIKWMTYWTIYSYLILLESFLEKVLLSIPFYPIFKCAFLIFCMISNPWNGSLIFYKHILRPLIVQNKATIDSAVTTITNEANDFLTKV 172          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000044545.1 (SMESG000044545.1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.009e-17
Identity = 47/142 (33.10%), Postives = 78/142 (54.93%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK----VISEFAEEVLGFTRKRVAADEEVATVKESEELNDNESMN 699
              L+PAY S K++  K + D   W+ YW+V+A F+ +E  TDI L WIP Y  +K +F+++   P T  G  +I+ RL+ P +L+ E +ID  I K S+     + EF  + + F     AA   + T  + ++L  + S++
Sbjct:   15 AILHPAYKSYKSLRQKNQKDILTWMMYWIVFAIFTAVETVTDIILCWIPFYYEMKTLFVLWMALPIT-KGYSIIFRRLVHPELLKRELEIDQIIEKASEKGYNTLLEFGAKGINF-----AATTVLTTAVKGQQLLASRSLS 150          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000044545.1 (SMESG000044545.1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.593e-17
Identity = 47/142 (33.10%), Postives = 78/142 (54.93%), Query Frame = 1
Query:  286 GFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGSK----VISEFAEEVLGFTRKRVAADEEVATVKESEELNDNESMN 699
              L+PAY S K++  K + D   W+ YW+V+A F+ +E  TDI L WIP Y  +K +F+++   P T  G  +I+ RL+ P +L+ E +ID  I K S+     + EF  + + F     AA   + T  + ++L  + S++
Sbjct:   15 AILHPAYKSYKSLRQKNQKDILTWMMYWIVFAIFTAVETVTDIILCWIPFYYEMKTLFVLWMALPIT-KGYSIIFRRLVHPELLKRELEIDQIIEKASEKGYNTLLEFGAKGINF-----AATTVLTTAVKGQQLLASRSLS 150          
The following BLAST results are available for this feature:
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
REEP69.810e-4953.95receptor accessory protein 6 [Source:HGNC Symbol;A... [more]
REEP69.829e-4953.95receptor accessory protein 6 [Source:HGNC Symbol;A... [more]
REEP58.318e-4855.63receptor accessory protein 5 [Source:HGNC Symbol;A... [more]
REEP54.182e-4059.80receptor accessory protein 5 [Source:HGNC Symbol;A... [more]
REEP69.131e-3147.66receptor accessory protein 6 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yop-15.600e-3441.86Receptor expression-enhancing protein [Source:Uni... [more]
T03F6.67.760e-2539.49Receptor expression-enhancing protein [Source:Uni... [more]
T03F6.67.760e-2539.49Receptor expression-enhancing protein [Source:Uni... [more]
F56B3.64.270e-2237.58Receptor expression-enhancing protein [Source:Uni... [more]
T19C3.41.928e-1843.01pep chromosome:WBcel235:III:618246:620254:-1 gene:... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ReepB5.194e-3945.18gene:FBgn0033906 transcript:FBtr0087525[more]
ReepB5.194e-3945.18gene:FBgn0033906 transcript:FBtr0302453[more]
ReepB1.212e-3451.40gene:FBgn0033906 transcript:FBtr0302452[more]
ReepB2.380e-3451.40gene:FBgn0033906 transcript:FBtr0302451[more]
CG49601.970e-3340.96gene:FBgn0039371 transcript:FBtr0346108[more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep52.724e-5058.94receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-... [more]
zgc:1017443.787e-4954.49zgc:101744 [Source:ZFIN;Acc:ZDB-GENE-050320-111][more]
reep69.791e-4850.30receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep69.791e-4850.30receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep69.791e-4850.30receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep55.587e-4851.52receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep56.225e-4851.52receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep61.203e-4655.26receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep61.436e-4655.26receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
sts1.094e-1844.68steroid sulfatase [Source:Xenbase;Acc:XB-GENE-1013... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Reep67.139e-5151.40receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep67.139e-5151.40receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep61.908e-5052.30receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep52.162e-4754.30receptor accessory protein 5 [Source:MGI Symbol;Ac... [more]
Reep61.353e-3057.14receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XI60|REEP6_RAT1.568e-5051.96Receptor expression-enhancing protein 6 OS=Rattus ... [more]
sp|Q9JM62|REEP6_MOUSE4.994e-5051.40Receptor expression-enhancing protein 6 OS=Mus mus... [more]
sp|Q96HR9|REEP6_HUMAN4.711e-4853.95Receptor expression-enhancing protein 6 OS=Homo sa... [more]
sp|Q60870|REEP5_MOUSE2.738e-4754.97Receptor expression-enhancing protein 5 OS=Mus mus... [more]
sp|Q5RE33|REEP5_PONAB2.751e-4755.63Receptor expression-enhancing protein 5 OS=Pongo a... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UL647.297e-6465.09Receptor expression-enhancing protein OS=Capitella... [more]
A0A2T7NF136.017e-5961.49Receptor expression-enhancing protein OS=Pomacea c... [more]
A0A1I8HYU15.632e-5857.29Receptor expression-enhancing protein OS=Macrostom... [more]
A0A2C9JDF94.314e-5759.06Receptor expression-enhancing protein OS=Biomphala... [more]
A0A2C9JDG07.555e-5760.12Receptor expression-enhancing protein OS=Biomphala... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep51.236e-5152.51receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep68.572e-5146.70receptor expression-enhancing protein 6 [Source:NC... [more]
ENSAMXT00000041103.15.533e-3656.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000054484.16.258e-3656.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
reep3b1.249e-1838.54receptor expression-enhancing protein 3 [Source:NC... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
reep58.756e-4955.15receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-... [more]
reep21.759e-1236.36receptor accessory protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOP18.286e-2039.36Reticulon-interacting protein; ER integral membran... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO320556.159e-4557.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467811.737e-2732.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403476.987e-2243.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep64.042e-5247.74receptor expression-enhancing protein 6 [Source:NC... [more]
zgc:1017449.072e-4958.55receptor expression-enhancing protein 5 [Source:NC... [more]
reep52.545e-4649.16receptor expression-enhancing protein 5 [Source:NC... [more]
reep16.763e-1838.60receptor accessory protein 1 [Source:NCBI gene;Acc... [more]
reep21.020e-1741.24receptor accessory protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043862.19.102e-102100.00SMESG000043862.1[more]
SMESG000036637.16.881e-5555.98SMESG000036637.1[more]
SMESG000042627.11.103e-3439.88SMESG000042627.1[more]
SMESG000044545.12.009e-1733.10SMESG000044545.1[more]
SMESG000044545.13.593e-1733.10SMESG000044545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018603 ID=SMED30018603|Name=Receptor expression-enhancing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1192bp
CAATTCTTATCATAATAAACAAAAACACTTTGTCATTCTTAATTTAATTA
TTATTTTAATTGATTAAAAATTATCTCGTTGTAATTTTCCATAATGAATT
TGGTAGACGGTTACAAAAATCAATTAGAAAAAAAGTTGAGTGAAAAAAAT
GCCTTTACAGATGCTCTAGCTATTGTCGAAGCGAAAACAGGTGTGAAGAA
AGTTTACTTAGTTGGAGGGTTGATCGGATTCATTATTCTTTATTTAATAG
TTGGTTATGGTGCACAATTTTTAGCTAACTTCATCGGATTCCTTTATCCA
GCTTATTGTTCCGTGAAAGCTATAGAAACCAAAGAGAAAGATGACGATAC
AAAATGGTTGACATACTGGGTTGTATATGCAGCTTTCAGTTTGCTAGAAT
TTTTCACCGATATTTTCCTTTTCTGGATTCCACTTTATGCGCTCTTGAAA
TGCATATTTTTGGTTTTCTGCATGGCACCGACAACCTGGAATGGATCGCT
TTTGATCTATGAAAGACTGATAAAGCCGTTCGTCCTCCGACACGAAAAGA
AAATAGATTCGGCCATTGCAAAAGGATCAAAAGTTATTAGTGAATTCGCC
GAAGAAGTATTGGGCTTCACTAGAAAGCGAGTTGCCGCCGATGAGGAAGT
CGCAACTGTGAAAGAGTCGGAGGAATTAAATGATAATGAGAGTATGAACA
AGTAAATTTGTATTAGGGTTTCGGATTTTGTTTTAATTTCAATTGACTTT
TGTGAGGATGGGTTTATAATAGCTTTTTTTTATTTTGGCTCTTTCAAGAT
TTCCAGTCAATATGAAATATTTTTATTGTTCATTCAAATATTTTTAACAA
TTGGATTGGAGGGTGTTATAAAGTCGGATGTCTTCTTTTTTACACTCGGA
ACAGATCTTTTCCGTACAGTTCTCAAAGGGTTGTAGGTCTCAGATCAGAT
TGATAGCACTCAAATATATCGCTTTACAGGCAGAAGCGATTTGCAGGATA
TTGTCAAAAATGAAGAAAATTTTTAATTAGCAGTTTGCCATAGAAATTTA
ATAGTTCAATGAAAATATCGCATGCAAAAAATACGAAAATATTCTGTAAA
TTATTCCATTTCACATTTTTAAAAAATCAATATTTATTTACATTTTGCAC
AACGCTTCTTTGCATTCTTAGGCTGCACTTAGTTTTATTTCA
back to top

protein sequence of SMED30018603-orf-1

>SMED30018603-orf-1 ID=SMED30018603-orf-1|Name=SMED30018603-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKVYLVGGLIGFIILY
LIVGYGAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSL
LEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRH
EKKIDSAIAKGSKVISEFAEEVLGFTRKRVAADEEVATVKESEELNDNES
MNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004345TB2_DP1_HVA22
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane