ATP dependent RNA helicase DDX5

Overview
NameATP dependent RNA helicase DDX5
Smed IDSMED30018602
Uniprot Best hitATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1 (E=2.22871e-45)
Length (bp)607
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP dependent RNA helicase DDX5 (SMED30018602) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP dependent RNA helicase DDX5 (SMED30018602) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP dependent RNA helicase DDX5 (SMED30018602) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP dependent RNA helicase DDX5 (SMED30018602) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: QA3qT4bj

 

back to top

Expression Details

ATP dependent RNA helicase DDX5 ( DDX5-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system, embryonic pharynx, primitive ectoderm, primitive ectoderm cell and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30018602

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
blastomereSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 4fluorescence in situ hybridization evidence
primitive ectodermSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
embryonic pharynxSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
blastomereSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
primitive ectodermSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
blastomereSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
embryonic pharynxSMED30018602SMESG000033916.1 SMESG000033908.1 SMESG000033907.1 SMED30018602smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
neoblastSMED30018602SMESG000033916.1 SMESG000033908.1 dd_Smed_v6_68664_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 4.570e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 4.615e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 4.755e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 4.802e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 148.288 bits (373), Expect = 1.495e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  252 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 395          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 151.754 bits (382), Expect = 4.988e-43
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 151.754 bits (382), Expect = 4.988e-43
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 151.754 bits (382), Expect = 4.988e-43
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 151.754 bits (382), Expect = 4.988e-43
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 151.754 bits (382), Expect = 4.988e-43
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0302597)

HSP 1 Score: 161.77 bits (408), Expect = 1.579e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078653)

HSP 1 Score: 161.77 bits (408), Expect = 1.579e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078649)

HSP 1 Score: 161.384 bits (407), Expect = 1.733e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078651)

HSP 1 Score: 161.384 bits (407), Expect = 1.733e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078654)

HSP 1 Score: 161.384 bits (407), Expect = 1.733e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 148.673 bits (374), Expect = 4.707e-42
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDK+Q +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 149.058 bits (375), Expect = 1.516e-41
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDK+Q +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 145.976 bits (367), Expect = 2.867e-40
Identity = 68/144 (47.22%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N + AR LV+V+EEA Q+++  L  L
Sbjct:  332 QLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL 475          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Match: si:dkey-156n14.5 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 145.591 bits (366), Expect = 3.357e-40
Identity = 68/144 (47.22%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N + AR LV+V+EEA Q+++  L  L
Sbjct:  343 QLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL 486          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 135.576 bits (340), Expect = 1.551e-36
Identity = 70/151 (46.36%), Postives = 99/151 (65.56%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ T +D + +VF ETK+ AD +  FL  + +   ++HGD+SQ DRE  L+ FR     ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G++ +FFN KN    + L+ ++ EA Q V   L  LAY
Sbjct:  458 DKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVPSWLESLAY 608          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 152.14 bits (383), Expect = 1.454e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L 
Sbjct:  279 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQLV 423          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 152.14 bits (383), Expect = 2.867e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L 
Sbjct:  306 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQLV 450          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 152.14 bits (383), Expect = 4.549e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L 
Sbjct:  321 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQLV 465          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 151.754 bits (382), Expect = 5.758e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L 
Sbjct:  310 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQLV 454          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 151.754 bits (382), Expect = 6.173e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L 
Sbjct:  333 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQLV 477          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 154.451 bits (389), Expect = 2.070e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  329 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 472          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 154.451 bits (389), Expect = 2.103e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  329 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 472          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 148.673 bits (374), Expect = 1.854e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  331 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 474          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Match: Ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:MGI Symbol;Acc:MGI:3642857])

HSP 1 Score: 134.42 bits (337), Expect = 2.999e-36
Identity = 63/137 (45.99%), Postives = 92/137 (67.15%), Query Frame = 1
Query:   40 TPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +P+DK+IVF   K  AD + S L  +   V ++HG++ QSDRE  L  F+   + IL+ATD+ASRGLDV DI  V NYDFP   E+Y+HR+GRTGR G++G+S T   R + + A +L+ ++E ANQ++ + L  +A
Sbjct:  483 SPKDKVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRVATELINILERANQNIPEELVLMA 619          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 133.65 bits (335), Expect = 7.183e-36
Identity = 66/159 (41.51%), Postives = 105/159 (66.04%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNR-KNSKSARQLVKVMEEANQSVSDSLYDLA---YIPRS 465
            YSK ++L+E++     ++ +VF ETK+KAD I +FL  ++    ++HGD+ Q +RE  L  FR     +LVAT VA+RGLD+++++ VIN+D P   ++Y+HRIGRTGR G +G + +FF+   ++  A+ LVKV+ +A Q V   L ++A   Y+P S
Sbjct:  498 YSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPS 656          
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Match: sp|P46942|DB10_NICSY (ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.229e-45
Identity = 79/149 (53.02%), Postives = 107/149 (71.81%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K +R+ +++ SK P  K+I+F  TK+  D +   L ++ F   A+HGDKSQ +R+Y+L+ FR     +LVATDVA+RGLD+ DI+VVINYDFP   EDY+HRIGRTGR G SG++YTFF+ ++SK A  LVKV+E ANQ V   L D+A
Sbjct:  376 KQRRVEQILRSKEPGSKIIIFCSTKKMCDQLSRNL-TRNFGAAAIHGDKSQGERDYVLSQFRAGRSPVLVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGASGLAYTFFSDQDSKHALDLVKVLEGANQCVPTELRDMA 523          
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Match: sp|Q5VQL1|RH14_ORYSJ (DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0172200 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.870e-45
Identity = 79/148 (53.38%), Postives = 108/148 (72.97%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            K +RL +++ S+ P  K+I+F  TKR  D +   L ++Q+   A+HGDKSQ++R+ +L+ FR     ILVATDVA+RGLD+ DI+VV+NYDFP   EDY+HRIGRTGR G +GV+YTFF  ++SK A  LVK++E ANQSVS  L D+
Sbjct:  411 KSRRLDQILRSQEPGSKIIIFCSTKRMCDQLARNL-ARQYGASAIHGDKSQAERDSVLSEFRSGRCPILVATDVAARGLDIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFCDQDSKYASDLVKILEGANQSVSQQLRDM 557          
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Match: sp|P19109|DDX17_DROME (ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3)

HSP 1 Score: 161.384 bits (407), Expect = 6.468e-45
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  510 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 664          
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Match: sp|Q501J6|DDX17_MOUSE (Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus OX=10090 GN=Ddx17 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.448e-42
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  329 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 472          
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Match: sp|Q9LYJ9|RH46_ARATH (DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana OX=3702 GN=RH46 PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 1.737e-42
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K  RL +++ S+ P  K+I+F  TKR  D +   L ++ F   A+HGDKSQ++R+ +LN FR     +LVATDVA+RGLDV DI+VV+NYDFP   EDY+HRIGRTGR G +G++YTFF  +++K A  L+K++E ANQ V   + ++A
Sbjct:  392 KHSRLEQILRSQEPGSKIIIFCSTKRMCDQLARNL-TRTFGAAAIHGDKSQAERDDVLNQFRSGRTPVLVATDVAARGLDVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQKVPPQVREMA 539          
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Match: gnl|BL_ORD_ID|16253250 (tr|A0A183A0V7|A0A183A0V7_9TREM Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS592 PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.218e-52
Identity = 87/161 (54.04%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNF 483
            ++K++RL+E+++   R + +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L+ FR   +N+LVATDVASRGLD+DDI+ VIN DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR L+ ++EEANQ V+  LY+++ +  + R+ +F
Sbjct:  287 WNKEQRLIELLTMFGRSRCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLSSFRDGRINVLVATDVASRGLDIDDIQYVINVDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNMKQARDLIDILEEANQEVNPELYNMSGLSAASRKPSF 447          
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Match: gnl|BL_ORD_ID|22927170 (tr|A0A4S2LF31|A0A4S2LF31_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007596 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.348e-51
Identity = 86/163 (52.76%), Postives = 117/163 (71.78%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNR 489
            + K++RL+++++   R++ +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L  FR   L++LVATDVASRGLD+DDI+ VIN+DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR+L++++EEANQ V+  L+ ++ I  + RR  + +
Sbjct:  319 WDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGLDIDDIQYVINFDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNIKQARELIEILEEANQEVNPELFRMSGISDAGRRNKYQK 481          
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Match: gnl|BL_ORD_ID|20717998 (tr|A0A504YTU3|A0A504YTU3_FASGI ATP dependent RNA helicase DDX5 OS=Fasciola gigantica OX=46835 GN=FGIG_08208 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 4.301e-51
Identity = 88/161 (54.66%), Postives = 115/161 (71.43%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNF 483
            ++K++RL+E+++   R + +VF ETKRK D I   LR + F VGAMHGDK Q DRE  LN FR   +N+LVATDVASRGLD+DDI+ VIN DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR L+ ++EEA Q V+  LY+++ +  + R+ NF
Sbjct:  329 WNKEQRLIELLTMFGRARCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLNSFREGRINVLVATDVASRGLDIDDIQYVINVDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNMKQARDLIDILEEAGQEVNPELYNMSGVSAASRKTNF 489          
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Match: gnl|BL_ORD_ID|16786211 (tr|A0A2H1CFJ4|A0A2H1CFJ4_FASHE DEAD-box ATP-dependent RNA helicase 30 OS=Fasciola hepatica OX=6192 GN=D915_003901 PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.410e-50
Identity = 88/161 (54.66%), Postives = 114/161 (70.81%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNF 483
            ++K+ RL+E+++   R + +VF ETKRK D I   LR + F VGAMHGDK Q DRE  LN FR   +N+LVATDVASRGLD+DDI+ VIN DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR L+ ++EEA Q V+  LY+++ +  + R+ NF
Sbjct:  317 WNKELRLIELLTMFGRARCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLNSFREGRINVLVATDVASRGLDIDDIQYVINVDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNMKQARDLIDILEEAGQEVNPELYNMSGVSAASRKTNF 477          
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Match: gnl|BL_ORD_ID|20361388 (tr|G7YD59|G7YD59_CLOSI ATP-dependent RNA helicase DDX5/DBP2 OS=Clonorchis sinensis OX=79923 GN=CLF_105191 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.349e-50
Identity = 85/163 (52.15%), Postives = 117/163 (71.78%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNR 489
            + K++RL+++++   R++ +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L  FR   L++LVATDVASRGLD+DDI+ VIN+DFP Q EDYIHRIGRT R  K G ++TFF  KN + AR+L++++EEANQ V+  L+ ++ I  + RR  + +
Sbjct:  603 WDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGLDIDDIQYVINFDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNLRQARELIEILEEANQEVNPELFRMSGISDAGRRNKYQK 765          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 151.754 bits (382), Expect = 1.308e-42
Identity = 72/145 (49.66%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K A  L+ V+ EANQ+++  L  +A
Sbjct:  331 RLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQANDLISVLREANQAINPKLLQMA 475          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Match: ENSAMXT00000004594.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:19468841:19477092:-1 gene:ENSAMXG00000042015.1 transcript:ENSAMXT00000004594.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.821 bits (364), Expect = 3.934e-42
Identity = 68/145 (46.90%), Postives = 95/145 (65.52%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +L+E +     +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N + AR LV+V+EEA Q+++  L  L 
Sbjct:  163 QLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQLV 307          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103024726])

HSP 1 Score: 150.214 bits (378), Expect = 3.952e-42
Identity = 72/145 (49.66%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 138.658 bits (348), Expect = 5.825e-38
Identity = 72/151 (47.68%), Postives = 100/151 (66.23%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ T +D + +VF ETK+ AD +  FL  + +   ++HGD+SQ DRE  LN FR     ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G++ +FFN KNS   + L+ ++ EA Q V   L  LAY
Sbjct:  382 DKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAY 532          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 135.576 bits (340), Expect = 9.960e-37
Identity = 66/152 (43.42%), Postives = 100/152 (65.79%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFF-NRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            YSK ++LLE++  T  ++ +VF ETKR AD I +FL  ++    ++HGD+ Q +RE  L+ FR     +LVAT VA+RGLD++ ++ V+N+D P   E+Y+HRIGRTGR G +G + +FF    ++  AR LVKV+  A Q V   L ++A+
Sbjct:  452 YSKREQLLELLKTTGTERTMVFVETKRSADFIATFLCQEKVPTTSIHGDREQREREKALSDFRTGQCPVLVATSVAARGLDIEHVQHVVNFDLPNNIEEYVHRIGRTGRCGNTGRAVSFFYPESDTPLARSLVKVLTGAQQEVPPWLEEIAF 603          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 2.770e-37
Identity = 72/156 (46.15%), Postives = 103/156 (66.03%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSE 468
            DKR  LL++++ T RD + +VF ETK+ AD +  FL S+ +   ++HGD+SQ DRE  L+ FR     ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G + +F+N KN    R+L+ ++ EA+Q V   L  +A   RS+
Sbjct:  308 DKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNENMTRELLHLLVEAHQEVPSWLETMAQEHRSK 463          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Match: DDX41 (DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:18674])

HSP 1 Score: 113.235 bits (282), Expect = 7.183e-32
Identity = 61/141 (43.26%), Postives = 86/141 (60.99%), Query Frame = 1
Query:   19 LLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVK-VMEEANQSVSDSL 438
            LLE + K+    +++FAE K   D I  +L  K     A+HG K Q +R   +  FR    ++LVATDVAS+GLD  +I+ VINYD P + E+Y+HRIGRTGR GK+G++ TF N+   +S    +K ++ EA Q V   L
Sbjct:   38 LLECLQKS-SPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAMESFREGKKDVLVATDVASKGLDFPNIQHVINYDMPEEIENYVHRIGRTGRSGKTGIATTFINKSCDESVLMDLKALLMEAKQKVPPVL 177          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 114.775 bits (286), Expect = 5.235e-30
Identity = 61/157 (38.85%), Postives = 89/157 (56.69%), Query Frame = 1
Query:    4 SKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERR 474
             K K+LLE++S+     +I+F   K+  D++   L    F    +HG K Q  RE+ L+  +    +ILVATDVA RG+D+ D+ +V+NYD     EDY HRIGRTGR GKSGVS TF  ++++     L + M      VS    +LA  P ++ +
Sbjct:  579 EKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDLKQAM--LGSPVSQCPPELANHPDAQHK 733          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 112.079 bits (279), Expect = 5.406e-29
Identity = 55/141 (39.01%), Postives = 86/141 (60.99%), Query Frame = 1
Query:   28 VVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +V  T    +++F   K  ++ + + L  + F+VG +HGD  QS+R  +++ F+ + + I+VATDVA+RGLD+  IK V+NYD     + + HR+GRTGR G+ G ++T    K+   A  LV+ +E ANQ V   L DLA
Sbjct:  488 LVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVRNLEGANQHVHKELMDLA 628          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 2.170e-26
Identity = 52/120 (43.33%), Postives = 74/120 (61.67%), Query Frame = 1
Query:    7 KDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNR 366
            KD  L+ ++++   +  I+F  T      I   LR+  F    +HG  SQ+ R   LN F+G+  +IL+ATDVASRGLD+  + VVIN+D P   +DYIHR+GRT R G+SG S TF ++
Sbjct:  221 KDSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQ 340          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 141.354 bits (355), Expect = 9.365e-40
Identity = 66/148 (44.59%), Postives = 98/148 (66.22%), Query Frame = 1
Query:    7 KDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K   LL+++S   +   ++F ETKR AD +  FL  + F+  A+HGD++Q++RE  L+ F+    +ILVAT VA+RGLD+ ++  VINYD P   +DY+HRIGRTGR G +GV+ +FFN  N    + L++++ EANQ V   L DL+
Sbjct:  398 KKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTFLSDLS 545          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 139.813 bits (351), Expect = 2.604e-39
Identity = 73/165 (44.24%), Postives = 101/165 (61.21%), Query Frame = 1
Query:    7 KDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYD-LAYIPRS---ERRQNFNR 489
            K   LL+++S +     ++F ETKR AD +  FL  + FR  A+HGD++QS+RE  L  FR     +LVAT VA+RGLD+ ++  VINYD P   +DY+HRIGRTGR G +G++  FFN +NS   + L +++ EANQ V   L D +   P S    RR  F R
Sbjct:  386 KKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFLKDAMMSAPGSRSNSRRGGFGR 550          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 134.42 bits (337), Expect = 1.496e-37
Identity = 64/141 (45.39%), Postives = 88/141 (62.41%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSL 438
            + LE  S+    K ++FA TKR  D I  +LR   +   A+HGDK Q +R+++L  FR     I+VATDVA+RG+DV  I  VINYD P   EDY+HRIGRTGR G +G + +FF  +N     +L+ +M EANQ++   L
Sbjct:  350 KYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIPPEL 490          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 125.946 bits (315), Expect = 2.082e-34
Identity = 64/149 (42.95%), Postives = 96/149 (64.43%), Query Frame = 1
Query:    7 KDKRLLEVVSK---TPR--DKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSL 438
            K+++LLE++ K    P+  +K+++FA  K++A  +   L+   + V A+HGD SQ  R   LN F+    N+L+ATDVA+RGLD+ ++K VIN  FP+  EDY+HRIGRTGR G++G ++T F  +    A  LV V+  ANQ V + L
Sbjct:  341 KERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDL 489          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 105.145 bits (261), Expect = 2.313e-27
Identity = 47/116 (40.52%), Postives = 73/116 (62.93%), Query Frame = 1
Query:   52 KMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVK 399
            + ++F  TK+K D +   L    F V +MHGD  Q +R+ ++N FR  +  +L++TDV +RG+DV  + +VINYD P   E+YIHRIGR+GR G+ GV+  F  + +    R++ K
Sbjct:  267 QCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEK 382          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 153.295 bits (386), Expect = 1.263e-44
Identity = 74/150 (49.33%), Postives = 104/150 (69.33%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRS 465
            +LLE +     +K ++F ETKR+AD +   LRS  +    +HGDK+Q +R+++L+ FR  +  ILVATDVASRGLD+ DIK VIN+DFP   EDY+HRIGRT R  ++G SYTFF   N+K A++LV V++EA Q V+  L +L  + R+
Sbjct:  295 KLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEAKQHVNPKLLNLQDMARN 444          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 136.346 bits (342), Expect = 1.795e-37
Identity = 69/149 (46.31%), Postives = 99/149 (66.44%), Query Frame = 1
Query:    7 KDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNR-KNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K  RL +++     D+ +VF E+KR AD +  FL  + F   ++HGD+ Q +RE  L+ FR     +L+AT+VA+RGLD+DD+K VIN+D P   ++Y+HRIGRTGR G  G + TFF R ++ K AR LVKV+ EANQ V + L ++A
Sbjct:  457 KRDRLTQILGDA--DRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIGRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEANQEVPEWLEEIA 603          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 136.732 bits (343), Expect = 1.821e-37
Identity = 67/151 (44.37%), Postives = 101/151 (66.89%), Query Frame = 1
Query:   10 DKR--LLEVVSKT-PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ + P+   +VF ETK+ AD +  FL    +   ++HGD+SQ +RE  L  FR  +  ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G +G++ +FFN KN   A++L+ ++EE+ Q +   L  +AY
Sbjct:  434 DKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESMAY 584          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 127.102 bits (318), Expect = 1.982e-35
Identity = 71/165 (43.03%), Postives = 100/165 (60.61%), Query Frame = 1
Query:    7 KDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFN-RKNSKSARQLVKVMEEANQSVS---DSLYDLAYIPR-SERRQNFN 486
            K  +L E++S T  D+ +VF E KR AD + ++L    F   ++  D+ QS+RE  L  FR    NILVAT VA+RGLD+ ++K VINYD P   E+Y+HR+GRTGR G  G +  F+   ++ + AR LVKV+ EA Q V    D   ++A+  R SER+  F 
Sbjct:  195 KRDKLHEILSATGTDRTLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFYEVGRDDRLARSLVKVLSEALQEVPAWLDEAAEVAFGTRNSERKTLFG 359          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 120.168 bits (300), Expect = 4.538e-32
Identity = 64/138 (46.38%), Postives = 88/138 (63.77%), Query Frame = 1
Query:   19 LLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSA-RQLVKVMEEANQSVS 429
            LLE + KTP   +++FAE K   D I  +L  K     A+HGDKSQ +R + +  F   N ++LVATDVAS+GLD  DI+ VIN+D P   E+Y+HRIGRTGR GK+GV+ TF N+   +S    L  ++ EA Q ++
Sbjct:  290 LLECLQKTP-PPVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVHRIGRTGRCGKTGVATTFINKSCEESVLLDLKHLLMEAKQKIT 426          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 152.14 bits (383), Expect = 9.932e-43
Identity = 73/145 (50.34%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K A  L+ V+ EANQ+++  L  +A
Sbjct:  337 RLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAGDLISVLREANQAINPKLIQMA 481          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101160075])

HSP 1 Score: 151.369 bits (381), Expect = 1.960e-42
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N + A  L+ V+ EANQ+++  L  +A
Sbjct:  339 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTARSSKTGTAYTFFTANNMRQASDLIAVLREANQAINPKLLQMA 483          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Match: ENSORLT00000031911.1 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101171584])

HSP 1 Score: 146.747 bits (369), Expect = 7.801e-41
Identity = 68/144 (47.22%), Postives = 97/144 (67.36%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L+ FR     +L+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R    G +YTFF   N + AR+LV+V+EEA Q+++  L  L
Sbjct:  330 QLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPVLIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTNKGTAYTFFTPGNVRQARELVRVLEEARQAINPKLLQL 473          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Match: si:dkey-156n14.5 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101158507])

HSP 1 Score: 145.591 bits (366), Expect = 2.618e-40
Identity = 70/151 (46.36%), Postives = 99/151 (65.56%), Query Frame = 1
Query:    7 KDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            KD +LL+++ +      +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N + AR LV+V+EEA Q+++  L  L 
Sbjct:  327 KDNKLLQLMEEIMAEKENKTIIFVETKKRCDDLTRKMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQLV 477          
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 137.502 bits (345), Expect = 1.826e-37
Identity = 71/151 (47.02%), Postives = 101/151 (66.89%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ T +D + +VF ETK+ AD +  FL  + +   ++HGD+SQ DRE  L+ FR  +  ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G++ +FFN KNS   + L+ ++ EA Q V   L  LAY
Sbjct:  393 DKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNSNITKDLLDILVEAKQEVPSWLESLAY 543          
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 370.933 bits (951), Expect = 1.923e-127
Identity = 200/202 (99.01%), Postives = 202/202 (100.00%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNRXXXXXXXXXXXXXXXXXXXGGNNMYPQPDLYMQNGAAHH 606
            YSKDKRLLEVVSKTPRDKMIVFAETK+KADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSER+QNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNGAAHH
Sbjct:  368 YSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERKQNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNGAAHH 569          
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 360.918 bits (925), Expect = 1.107e-123
Identity = 196/198 (98.99%), Postives = 198/198 (100.00%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNRXXXXXXXXXXXXXXXXXXXGGNNMYPQPDLYMQNG 594
            YSKDKRLLEVVSKTPRDKMIVFAETK+KADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSER+QNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNG
Sbjct:  362 YSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERKQNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNG 559          
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Match: SMESG000033907.1 (SMESG000033907.1)

HSP 1 Score: 320.472 bits (820), Expect = 3.648e-108
Identity = 180/202 (89.11%), Postives = 181/202 (89.60%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNRXXXXXXXXXXXXXXXXXXXGGNNMYPQPDLYMQNGAAHH 606
            YSKDKRLLEVVSKTPRDKMIVFAETK+KADMICSFLRSKQFRVGAMHGDKSQSDREYILN                    DVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNRPPMPV QVNNYQVPPPQYNGGNNMYPQPDLYMQNGAAHH
Sbjct:  350 YSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILN--------------------DVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNRPPMPVLQVNNYQVPPPQYNGGNNMYPQPDLYMQNGAAHH 531          
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 238.81 bits (608), Expect = 1.266e-75
Identity = 116/170 (68.24%), Postives = 137/170 (80.59%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGL-------------------DVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            ++KDKRLLE+VSK P DKMIVFAETK+KAD+IC FLRSKQFRVGAMHGDKSQSDR+YIL GFRG++LNILVATDVASRGL                   ++DDIK+VINYDFP QFEDYIHRIGRTGR+ K+G+SYTFFN  NS+SA  LVKVME++NQ V ++LY+  +
Sbjct:  415 HAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLVIPNYKWVINLNLLAYRYSNIDDIKIVINYDFPNQFEDYIHRIGRTGRKDKTGLSYTFFNENNSRSAASLVKVMEKSNQIVPEALYNFIH 584          
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Match: SMESG000033348.1 (SMESG000033348.1)

HSP 1 Score: 238.424 bits (607), Expect = 1.639e-75
Identity = 116/170 (68.24%), Postives = 137/170 (80.59%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGL-------------------DVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            ++KDKRLLE+VSK P DKMIVFAETK+KAD+IC FLRSKQFRVGAMHGDKSQSDR+YIL GFRG++LNILVATDVASRGL                   ++DDIK+VINYDFP QFEDYIHRIGRTGR+ K+G+SYTFFN  NS+SA  LVKVME++NQ V ++LY+  +
Sbjct:  408 HAKDKRLLEIVSKNPNDKMIVFAETKKKADIICYFLRSKQFRVGAMHGDKSQSDRDYILKGFRGQHLNILVATDVASRGLVIPNYKWVINLNLLAYRYSNIDDIKIVINYDFPNQFEDYIHRIGRTGRKDKTGLSYTFFNENNSRSAASLVKVMEKSNQIVPEALYNFIH 577          
The following BLAST results are available for this feature:
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX174.570e-4350.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX174.615e-4350.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX174.755e-4350.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX174.802e-4350.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX51.495e-4149.31DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-174.988e-4347.06DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-174.988e-4347.06DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-174.988e-4347.06DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-174.988e-4347.06DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-174.988e-4347.06DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rm621.579e-4651.92gene:FBgn0003261 transcript:FBtr0302597[more]
Rm621.579e-4651.92gene:FBgn0003261 transcript:FBtr0078653[more]
Rm621.733e-4651.92gene:FBgn0003261 transcript:FBtr0078649[more]
Rm621.733e-4651.92gene:FBgn0003261 transcript:FBtr0078651[more]
Rm621.733e-4651.92gene:FBgn0003261 transcript:FBtr0078654[more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx54.707e-4248.97DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx51.516e-4148.97DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
DDX172.867e-4047.22si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:dkey-156n14.53.357e-4047.22si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
ddx3xb1.551e-3646.36DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx171.454e-4350.34DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx172.867e-4350.34DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx174.549e-4350.34DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx175.758e-4350.34DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx176.173e-4350.34DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx172.070e-4350.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx172.103e-4350.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx51.854e-4149.31DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx432.999e-3645.99DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
Ddx47.183e-3641.51DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46942|DB10_NICSY2.229e-4553.02ATP-dependent RNA helicase-like protein DB10 OS=Ni... [more]
sp|Q5VQL1|RH14_ORYSJ4.870e-4553.38DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sa... [more]
sp|P19109|DDX17_DROME6.468e-4551.92ATP-dependent RNA helicase p62 OS=Drosophila melan... [more]
sp|Q501J6|DDX17_MOUSE1.448e-4250.00Probable ATP-dependent RNA helicase DDX17 OS=Mus m... [more]
sp|Q9LYJ9|RH46_ARATH1.737e-4249.66DEAD-box ATP-dependent RNA helicase 46 OS=Arabidop... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|162532502.218e-5254.04tr|A0A183A0V7|A0A183A0V7_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|229271702.348e-5152.76tr|A0A4S2LF31|A0A4S2LF31_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|207179984.301e-5154.66tr|A0A504YTU3|A0A504YTU3_FASGI ATP dependent RNA h... [more]
gnl|BL_ORD_ID|167862111.410e-5054.66tr|A0A2H1CFJ4|A0A2H1CFJ4_FASHE DEAD-box ATP-depend... [more]
gnl|BL_ORD_ID|203613883.349e-5052.15tr|G7YD59|G7YD59_CLOSI ATP-dependent RNA helicase ... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX51.308e-4249.66probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ENSAMXT00000004594.23.934e-4246.90pep primary_assembly:Astyanax_mexicanus-2.0:13:194... [more]
ddx53.952e-4249.66probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx3xb5.825e-3847.68DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx49.960e-3743.42DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.12.770e-3746.15pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
DDX417.183e-3243.26DEAD-box helicase 41 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx235.235e-3038.85DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx425.406e-2939.01DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ENSPMAT00000000216.12.170e-2643.33pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP19.365e-4044.59Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED12.604e-3944.24ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP21.496e-3745.39ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP32.082e-3442.95RNA-Dependent ATPase, member of DExD/H-box family;... [more]
FAL12.313e-2740.52Nucleolar protein required for maturation of 18S r... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380611.263e-4449.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277081.795e-3746.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PL101.821e-3744.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS11.982e-3543.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492474.538e-3246.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX59.932e-4350.34probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx51.960e-4248.97probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ENSORLT00000031911.17.801e-4147.22probable ATP-dependent RNA helicase DDX17 [Source:... [more]
si:dkey-156n14.52.618e-4046.36probable ATP-dependent RNA helicase DDX17 [Source:... [more]
ddx3xa1.826e-3747.02DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATP dependent RNA helicase DDX5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033908.11.923e-12799.01SMESG000033908.1[more]
SMESG000033916.11.107e-12398.99SMESG000033916.1[more]
SMESG000033907.13.648e-10889.11SMESG000033907.1[more]
SMESG000033348.11.266e-7568.24SMESG000033348.1[more]
SMESG000033348.11.639e-7568.24SMESG000033348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018602 ID=SMED30018602|Name=ATP dependent RNA helicase DDX5|organism=Schmidtea mediterranea sexual|type=transcript|length=607bp
TATTCAAAAGATAAACGATTGTTAGAAGTTGTTAGCAAAACTCCACGGGA
CAAAATGATTGTGTTCGCAGAAACGAAAAGGAAAGCTGATATGATTTGTT
CTTTCCTACGTTCAAAACAATTCAGAGTTGGTGCAATGCATGGAGATAAG
TCACAGAGCGACAGAGAATATATTCTTAATGGGTTTCGAGGTGAAAATTT
AAATATTCTCGTGGCAACAGATGTAGCAAGCAGGGGTTTAGATGTTGATG
ATATTAAAGTTGTAATCAATTACGACTTCCCTATTCAATTTGAAGATTAC
ATTCATAGAATCGGTAGGACAGGCCGACGAGGAAAATCCGGTGTGTCTTA
TACATTTTTCAATAGAAAGAATTCGAAAAGTGCTCGTCAATTGGTGAAAG
TGATGGAAGAAGCTAATCAATCAGTTTCAGATAGTTTGTATGATCTTGCA
TATATACCAAGAAGTGAGCGTAGACAAAATTTCAATCGTCCGCCAATGCC
AGTGCCGCAAGTAAATAATTATCAAGTACCTCCGCCTCAATATAATGGTG
GAAATAACATGTATCCGCAACCAGATTTATATATGCAAAACGGAGCAGCA
CATCACA
back to top

protein sequence of SMED30018602-orf-1

>SMED30018602-orf-1 ID=SMED30018602-orf-1|Name=SMED30018602-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDK
SQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDY
IHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA
YIPRSERRQNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNGAA
HH
back to top
Aliases
The feature 'ATP dependent RNA helicase DDX5' has the following synonyms
Synonym
DDX5-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
PLANA:0000029primitive ectoderm
PLANA:0004517blastomere
PLANA:0000211primitive ectoderm cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0006364rRNA processing
GO:0010501RNA secondary structure unwinding
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000003Stage 3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 30..111
e-value: 6.7E-32
score: 122.0
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 3..111
e-value: 5.3E-30
score: 104.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 6..150
score: 22.918
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..152
e-value: 2.0E-51
score: 175.8
NoneNo IPR availablePANTHERPTHR24031:SF683coord: 3..158
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 3..158
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 3..120
e-value: 6.79843E-54
score: 166.529
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..143