ATP-dependent RNA helicase dbp2

Overview
NameATP-dependent RNA helicase dbp2
Smed IDSMED30018602
Uniprot Best hitATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 (E=9.61704e-45)
Length (bp)607
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase dbp2 (SMED30018602) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase dbp2 (SMED30018602) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase dbp2 (SMED30018602) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase dbp2 (SMED30018602) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 1.263e-42
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 154.451 bits (389), Expect = 1.285e-42
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  408 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 551          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 149.058 bits (375), Expect = 5.657e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  331 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 474          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 148.288 bits (373), Expect = 6.142e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  252 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 395          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 148.673 bits (374), Expect = 6.686e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  331 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 474          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:RefSeq peptide;Acc:NP_001041134])

HSP 1 Score: 151.754 bits (382), Expect = 1.916e-42
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:RefSeq peptide;Acc:NP_001041134])

HSP 1 Score: 151.754 bits (382), Expect = 1.916e-42
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:RefSeq peptide;Acc:NP_001041134])

HSP 1 Score: 151.754 bits (382), Expect = 1.916e-42
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:RefSeq peptide;Acc:NP_001041134])

HSP 1 Score: 151.754 bits (382), Expect = 1.916e-42
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:RefSeq peptide;Acc:NP_001041134])

HSP 1 Score: 151.754 bits (382), Expect = 1.916e-42
Identity = 72/153 (47.06%), Postives = 104/153 (67.97%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKT---PRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            ++K  +L+E+++        K I+F ETKRKAD +   +R   +    +HGDK+Q +R+++L  F+     I++ATDVA+RGLDVDDIK VINYD+P   EDY+HRIGRTGR  K G +YTFF   N+  A+ L+KV++EA Q+V  +L D+A
Sbjct:  358 HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFFTHTNASKAKDLLKVLDEAKQTVPQALRDMA 510          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Match: Rm62 (Rm62 [Source:FlyBase gene name;Acc:FBgn0003261])

HSP 1 Score: 161.77 bits (408), Expect = 8.432e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Match: Rm62 (Rm62 [Source:FlyBase gene name;Acc:FBgn0003261])

HSP 1 Score: 161.77 bits (408), Expect = 8.432e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Match: Rm62 (Rm62 [Source:FlyBase gene name;Acc:FBgn0003261])

HSP 1 Score: 161.384 bits (407), Expect = 9.217e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Match: Rm62 (Rm62 [Source:FlyBase gene name;Acc:FBgn0003261])

HSP 1 Score: 161.384 bits (407), Expect = 9.217e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Match: Rm62 (Rm62 [Source:FlyBase gene name;Acc:FBgn0003261])

HSP 1 Score: 161.384 bits (407), Expect = 9.217e-46
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  369 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 149.058 bits (375), Expect = 2.314e-41
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDK+Q +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 148.673 bits (374), Expect = 2.352e-41
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDK+Q +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 149.058 bits (375), Expect = 3.505e-41
Identity = 71/145 (48.97%), Postives = 97/145 (66.90%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RLLE +     +K I+F ETKR+ D +   +R   +    +HGDK+Q +R+++LN F+     IL+ATDVASRGLDV+D+K VIN+D+P   EDYIHRIGRT R  K+G +YTFF   N K A  LV V+ EANQ+++  L  +A
Sbjct:  333 RLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMA 477          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 145.976 bits (367), Expect = 6.552e-40
Identity = 68/144 (47.22%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETK++ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N + AR LV+V+EEA Q+++  L  L
Sbjct:  332 QLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL 475          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Match: ddx3b (DEAD (Asp-Glu-Ala-Asp) box helicase 3b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 135.576 bits (340), Expect = 4.355e-36
Identity = 70/151 (46.36%), Postives = 99/151 (65.56%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ T +D + +VF ETK+ AD +  FL  + +   ++HGD+SQ DRE  L+ FR     ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G++ +FFN KN    + L+ ++ EA Q V   L  LAY
Sbjct:  458 DKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVPSWLESLAY 608          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Match: ddx17 (DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Source:Xenbase;Acc:XB-GENE-1000758])

HSP 1 Score: 152.14 bits (383), Expect = 1.315e-42
Identity = 73/144 (50.69%), Postives = 97/144 (67.36%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++L  FR     IL+ATDVASRGLDV+DIK VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+LVKV+EEANQ+++  L  L
Sbjct:  324 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDIKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELVKVLEEANQTINPKLMQL 467          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:Xenbase;Acc:XB-GENE-1009995])

HSP 1 Score: 148.673 bits (374), Expect = 2.004e-41
Identity = 72/145 (49.66%), Postives = 95/145 (65.52%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            RL+E +     +K IVF ETKR+ D +   LR   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L 
Sbjct:  329 RLMEEIMSEKENKTIVFVETKRRCDDLTRRLRRDGWPAMGIHGDKSQQERDWVLNEFKHGKSPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSSKTGTAYTFFTPGNIKQVNDLISVLREANQAINPKLLQLV 473          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Match: ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:Xenbase;Acc:XB-GENE-988016])

HSP 1 Score: 135.191 bits (339), Expect = 2.580e-36
Identity = 69/150 (46.00%), Postives = 96/150 (64.00%), Query Frame = 1
Query:   34 SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNF 483
            S  P+DK+IVF   K  AD + S    +   V ++HG++ Q DRE  L+ F+   + ILVATD+ASRGLDV D+  V+N+DFP   E+Y+HR+GRTGR G++G S T   RK+ K A +L+ ++E ANQ V   L+D+A     ER Q F
Sbjct:  501 SLKPQDKVIVFVGKKLVADDLSSDFSLQGIPVQSLHGNREQCDREQALDDFKKGKVRILVATDLASRGLDVHDVTHVLNFDFPRNIEEYVHRVGRTGRAGRTGESITLVTRKDWKVAGELISILERANQEVPGDLFDMA-----ERYQQF 645          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Match: ddx3x (DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked [Source:Xenbase;Acc:XB-GENE-999731])

HSP 1 Score: 132.88 bits (333), Expect = 2.059e-35
Identity = 69/151 (45.70%), Postives = 100/151 (66.23%), Query Frame = 1
Query:   10 DKR--LLEVVSKTPRDKM-IVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            DKR  LL++++ T +D + +VF ETK+ AD +  FL  + +   ++HGD+SQ DRE  L+ FR     ILVAT VA+RGLD+ ++K VIN+D P   E+Y+HRIGRTGR G  G++ +FFN KN    + L+ ++ EA Q V   L ++AY
Sbjct:  469 DKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLDLLVEAKQEVPSWLENMAY 619          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 128.257 bits (321), Expect = 5.451e-34
Identity = 59/152 (38.82%), Postives = 99/152 (65.13%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFN-RKNSKSARQLVKVMEEANQSVSDSLYDLAY 453
            Y K  +L+E++  +  ++ ++F  TK+KAD+I  +L  + F   ++HGD+ Q  RE  +  FR     ++V T VA+RGLD+++++ VINYD P + ++Y+HRIGRTGR G  G + +FFN  ++   AR LVK++ +A+Q V   L ++A+
Sbjct:  440 YRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAF 591          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 154.451 bits (389), Expect = 5.099e-43
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  329 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 472          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 148.673 bits (374), Expect = 4.475e-41
Identity = 71/144 (49.31%), Postives = 95/144 (65.97%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            RL+E +     +K IVF ETKR+ D +   +R   +    +HGDKSQ +R+++LN F+     IL+ATDVASRGLDV+D+K VINYD+P   EDYIHRIGRT R  K+G +YTFF   N K    L+ V+ EANQ+++  L  L
Sbjct:  331 RLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQL 474          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Match: Ddx43 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:MGI Symbol;Acc:MGI:3642857])

HSP 1 Score: 134.42 bits (337), Expect = 7.413e-36
Identity = 63/137 (45.99%), Postives = 92/137 (67.15%), Query Frame = 1
Query:   40 TPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +P+DK+IVF   K  AD + S L  +   V ++HG++ QSDRE  L  F+   + IL+ATD+ASRGLDV DI  V NYDFP   E+Y+HR+GRTGR G++G+S T   R + + A +L+ ++E ANQ++ + L  +A
Sbjct:  483 SPKDKVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRVATELINILERANQNIPEELVLMA 619          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 133.65 bits (335), Expect = 2.262e-35
Identity = 66/159 (41.51%), Postives = 105/159 (66.04%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNR-KNSKSARQLVKVMEEANQSVSDSLYDLA---YIPRS 465
            YSK ++L+E++     ++ +VF ETK+KAD I +FL  ++    ++HGD+ Q +RE  L  FR     +LVAT VA+RGLD+++++ VIN+D P   ++Y+HRIGRTGR G +G + +FF+   ++  A+ LVKV+ +A Q V   L ++A   Y+P S
Sbjct:  498 YSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPS 656          
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 133.65 bits (335), Expect = 2.982e-35
Identity = 66/159 (41.51%), Postives = 105/159 (66.04%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNR-KNSKSARQLVKVMEEANQSVSDSLYDLA---YIPRS 465
            YSK ++L+E++     ++ +VF ETK+KAD I +FL  ++    ++HGD+ Q +RE  L  FR     +LVAT VA+RGLD+++++ VIN+D P   ++Y+HRIGRTGR G +G + +FF+   ++  A+ LVKV+ +A Q V   L ++A   Y+P S
Sbjct:  524 YSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPS 682          
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Match: sp|P46942|DB10_NICSY (ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.617e-45
Identity = 79/149 (53.02%), Postives = 107/149 (71.81%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K +R+ +++ SK P  K+I+F  TK+  D +   L ++ F   A+HGDKSQ +R+Y+L+ FR     +LVATDVA+RGLD+ DI+VVINYDFP   EDY+HRIGRTGR G SG++YTFF+ ++SK A  LVKV+E ANQ V   L D+A
Sbjct:  376 KQRRVEQILRSKEPGSKIIIFCSTKKMCDQLSRNL-TRNFGAAAIHGDKSQGERDYVLSQFRAGRSPVLVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGASGLAYTFFSDQDSKHALDLVKVLEGANQCVPTELRDMA 523          
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Match: sp|Q5VQL1|RH14_ORYSJ (DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.334e-44
Identity = 79/148 (53.38%), Postives = 108/148 (72.97%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            K +RL +++ S+ P  K+I+F  TKR  D +   L ++Q+   A+HGDKSQ++R+ +L+ FR     ILVATDVA+RGLD+ DI+VV+NYDFP   EDY+HRIGRTGR G +GV+YTFF  ++SK A  LVK++E ANQSVS  L D+
Sbjct:  411 KSRRLDQILRSQEPGSKIIIFCSTKRMCDQLARNL-ARQYGASAIHGDKSQAERDSVLSEFRSGRCPILVATDVAARGLDIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFCDQDSKYASDLVKILEGANQSVSQQLRDM 557          
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Match: sp|P19109|DDX17_DROME (ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3)

HSP 1 Score: 161.384 bits (407), Expect = 1.778e-44
Identity = 81/156 (51.92%), Postives = 111/156 (71.15%), Query Frame = 1
Query:    1 YSKDKRLLEVVS------KTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            +SK+++L  ++S      ++P  K+I+F ETKR+ D +  F+RS   R GA+HGDKSQS+R+++L  FR    NILVATDVA+RGLDVD IK VIN+D+P   EDYIHRIGRTGR    G S+ FF + N+K A+ LV V+ EANQ ++ +L +LA
Sbjct:  510 FSKEEKLKTLLSDIYDTSESP-GKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 664          
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Match: sp|Q501J6|DDX17_MOUSE (Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.929e-42
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   16 RLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDL 447
            +L+E +     +K I+F ETKR+ D +   +R   +    +HGDKSQ +R+++LN FR     IL+ATDVASRGLDV+D+K VINYD+P   EDY+HRIGRT R    G +YTFF   N K AR+L+KV+EEANQ+++  L  L
Sbjct:  329 QLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL 472          
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Match: sp|Q9LYJ9|RH46_ARATH (DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 4.759e-42
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 1
Query:    7 KDKRLLEVV-SKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            K  RL +++ S+ P  K+I+F  TKR  D +   L ++ F   A+HGDKSQ++R+ +LN FR     +LVATDVA+RGLDV DI+VV+NYDFP   EDY+HRIGRTGR G +G++YTFF  +++K A  L+K++E ANQ V   + ++A
Sbjct:  392 KHSRLEQILRSQEPGSKIIIFCSTKRMCDQLARNL-TRTFGAAAIHGDKSQAERDDVLNQFRSGRTPVLVATDVAARGLDVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQKVPPQVREMA 539          
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Match: tr|A0A183A0V7|A0A183A0V7_9TREM (Uncharacterized protein OS=Echinostoma caproni PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.327e-51
Identity = 87/161 (54.04%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNF 483
            ++K++RL+E+++   R + +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L+ FR   +N+LVATDVASRGLD+DDI+ VIN DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR L+ ++EEANQ V+  LY+++ +  + R+ +F
Sbjct:  287 WNKEQRLIELLTMFGRSRCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLSSFRDGRINVLVATDVASRGLDIDDIQYVINVDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNMKQARDLIDILEEANQEVNPELYNMSGLSAASRKPSF 447          
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Match: tr|G7YD59|G7YD59_CLOSI (ATP-dependent RNA helicase DDX5/DBP2 OS=Clonorchis sinensis GN=CLF_105191 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.104e-50
Identity = 85/163 (52.15%), Postives = 117/163 (71.78%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNR 489
            + K++RL+++++   R++ +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L  FR   L++LVATDVASRGLD+DDI+ VIN+DFP Q EDYIHRIGRT R  K G ++TFF  KN + AR+L++++EEANQ V+  L+ ++ I  + RR  + +
Sbjct:  603 WDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGLDIDDIQYVINFDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNLRQARELIEILEEANQEVNPELFRMSGISDAGRRNKYQK 765          
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Match: tr|A0A075A5Y3|A0A075A5Y3_9TREM (Uncharacterized protein OS=Opisthorchis viverrini GN=T265_02708 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.841e-49
Identity = 86/163 (52.76%), Postives = 116/163 (71.17%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSERRQNFNR 489
            + K++RL+++++   R++ +VF ETKRK D I   LR + F VGAMHGDK Q DRE  L  FR   L++LVATDVASRGLD+DDI+ VIN+DFP Q EDYIHRIGRT R  K G ++TFF  KN K AR+L+ ++EEANQ V+  L+ ++ I  + RR  + +
Sbjct:  287 WDKEQRLIQLLTMFGRERCLVFVETKRKTDQITYTLRRRGFAVGAMHGDKQQRDREMTLGSFRDGRLSVLVATDVASRGLDIDDIQYVINFDFPNQTEDYIHRIGRTARSDKKGTAFTFFTSKNMKQARELIDILEEANQEVNPELFRMSGISDAGRRNKYQK 449          
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Match: tr|A0A183TE80|A0A183TE80_SCHSO (Uncharacterized protein OS=Schistocephalus solidus PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 9.602e-49
Identity = 84/150 (56.00%), Postives = 107/150 (71.33%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA 450
            Y K+ RL E++      + +VFAETK+K D +  FLR + FRV AMHGDK+Q +R+  L  FR   + +LVATDVASRGLD+DDI+ V+NYDFP Q EDYIHRIGRT R  K G ++TFF RKNSK A  LV+++EEANQ V+  L  +A
Sbjct:  349 YDKENRLCELIQSFHGLRCLVFAETKKKTDQVAYFLRRRGFRVAAMHGDKAQRERDATLAAFRTAKITVLVATDVASRGLDIDDIEYVVNYDFPNQTEDYIHRIGRTARSNKKGTAFTFFTRKNSKQAADLVEILEEANQEVNPQLLRMA 498          
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Match: tr|A0A0X3NYM9|A0A0X3NYM9_SCHSO (Uncharacterized protein (Fragment) OS=Schistocephalus solidus GN=TR125121 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.510e-48
Identity = 87/164 (53.05%), Postives = 115/164 (70.12%), Query Frame = 1
Query:    1 YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA--YIPRSERRQNFN 486
            Y K+ RL E++      + +VFAETK+K D +  FLR + FRV AMHGDK+Q +R+  L  FR   + +LVATDVASRGLD+DDI+ V+NYDFP Q EDYIHRIGRT R  K G ++TFF RKNSK A  LV+++EEANQ V+  L  +A  +   S+RR +++
Sbjct:  338 YDKENRLCELIQSFHGLRCLVFAETKKKTDQVAYFLRRRGFRVAAMHGDKAQRERDATLAAFRTAKITVLVATDVASRGLDIDDIEYVVNYDFPNQTEDYIHRIGRTARSNKKGTAFTFFTRKNSKQAADLVEILEEANQEVNPQLLRMAGGHSRFSKRRNDYS 501          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
DDX171.263e-4250.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX171.285e-4250.00DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX55.657e-4149.31DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX56.142e-4149.31DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX56.686e-4149.31DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-171.916e-4247.06DEAD boX helicase homolog [Source:RefSeq peptide;... [more]
ddx-171.916e-4247.06DEAD boX helicase homolog [Source:RefSeq peptide;... [more]
ddx-171.916e-4247.06DEAD boX helicase homolog [Source:RefSeq peptide;... [more]
ddx-171.916e-4247.06DEAD boX helicase homolog [Source:RefSeq peptide;... [more]
ddx-171.916e-4247.06DEAD boX helicase homolog [Source:RefSeq peptide;... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Rm628.432e-4651.92Rm62 [Source:FlyBase gene name;Acc:FBgn0003261][more]
Rm628.432e-4651.92Rm62 [Source:FlyBase gene name;Acc:FBgn0003261][more]
Rm629.217e-4651.92Rm62 [Source:FlyBase gene name;Acc:FBgn0003261][more]
Rm629.217e-4651.92Rm62 [Source:FlyBase gene name;Acc:FBgn0003261][more]
Rm629.217e-4651.92Rm62 [Source:FlyBase gene name;Acc:FBgn0003261][more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
ddx52.314e-4148.97DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx52.352e-4148.97DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx53.505e-4148.97DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
DDX176.552e-4047.22DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx3b4.355e-3646.36DEAD (Asp-Glu-Ala-Asp) box helicase 3b [Source:ZFI... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
ddx171.315e-4250.69DEAD (Asp-Glu-Ala-Asp) box helicase 17 [Source:Xen... [more]
ddx52.004e-4149.66DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:Xenb... [more]
ddx432.580e-3646.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
ddx3x2.059e-3545.70DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked [S... [more]
DDX45.451e-3438.82DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx175.099e-4350.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx54.475e-4149.31DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx437.413e-3645.99DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 [Source:... [more]
Ddx42.262e-3541.51DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx42.982e-3541.51DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46942|DB10_NICSY9.617e-4553.02ATP-dependent RNA helicase-like protein DB10 OS=Ni... [more]
sp|Q5VQL1|RH14_ORYSJ1.334e-4453.38DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sa... [more]
sp|P19109|DDX17_DROME1.778e-4451.92ATP-dependent RNA helicase p62 OS=Drosophila melan... [more]
sp|Q501J6|DDX17_MOUSE3.929e-4250.00Probable ATP-dependent RNA helicase DDX17 OS=Mus m... [more]
sp|Q9LYJ9|RH46_ARATH4.759e-4249.66DEAD-box ATP-dependent RNA helicase 46 OS=Arabidop... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A183A0V7|A0A183A0V7_9TREM1.327e-5154.04Uncharacterized protein OS=Echinostoma caproni PE=... [more]
tr|G7YD59|G7YD59_CLOSI5.104e-5052.15ATP-dependent RNA helicase DDX5/DBP2 OS=Clonorchis... [more]
tr|A0A075A5Y3|A0A075A5Y3_9TREM1.841e-4952.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
tr|A0A183TE80|A0A183TE80_SCHSO9.602e-4956.00Uncharacterized protein OS=Schistocephalus solidus... [more]
tr|A0A0X3NYM9|A0A0X3NYM9_SCHSO4.510e-4853.05Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 30..111
e-value: 6.7E-32
score: 122.0
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 3..111
e-value: 4.4E-29
score: 100.9
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 6..150
score: 22.883
IPR027417P-loop containing nucleoside triphosphate hydrolaseGENE3DG3DSA:3.40.50.300coord: 3..148
e-value: 1.8E-51
score: 173.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..143

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0006364rRNA processing
GO:0010501RNA secondary structure unwinding
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000211primitive ectoderm cell
PLANA:0000058embryonic digestive system
PLANA:0000212blastomere compartment
PLANA:0000029primitive ectoderm
PLANA:0004517blastomere
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000003Stage 3
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018602 ID=SMED30018602|Name=ATP-dependent RNA helicase dbp2|organism=Schmidtea mediterranea sexual|type=transcript|length=607bp
TATTCAAAAGATAAACGATTGTTAGAAGTTGTTAGCAAAACTCCACGGGA
CAAAATGATTGTGTTCGCAGAAACGAAAAGGAAAGCTGATATGATTTGTT
CTTTCCTACGTTCAAAACAATTCAGAGTTGGTGCAATGCATGGAGATAAG
TCACAGAGCGACAGAGAATATATTCTTAATGGGTTTCGAGGTGAAAATTT
AAATATTCTCGTGGCAACAGATGTAGCAAGCAGGGGTTTAGATGTTGATG
ATATTAAAGTTGTAATCAATTACGACTTCCCTATTCAATTTGAAGATTAC
ATTCATAGAATCGGTAGGACAGGCCGACGAGGAAAATCCGGTGTGTCTTA
TACATTTTTCAATAGAAAGAATTCGAAAAGTGCTCGTCAATTGGTGAAAG
TGATGGAAGAAGCTAATCAATCAGTTTCAGATAGTTTGTATGATCTTGCA
TATATACCAAGAAGTGAGCGTAGACAAAATTTCAATCGTCCGCCAATGCC
AGTGCCGCAAGTAAATAATTATCAAGTACCTCCGCCTCAATATAATGGTG
GAAATAACATGTATCCGCAACCAGATTTATATATGCAAAACGGAGCAGCA
CATCACA
back to top

protein sequence of SMED30018602-orf-1

>SMED30018602-orf-1 ID=SMED30018602-orf-1|Name=SMED30018602-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
YSKDKRLLEVVSKTPRDKMIVFAETKRKADMICSFLRSKQFRVGAMHGDK
SQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDY
IHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLA
YIPRSERRQNFNRPPMPVPQVNNYQVPPPQYNGGNNMYPQPDLYMQNGAA
HH
back to top
Aliases
The feature 'ATP-dependent RNA helicase dbp2' has the following synonyms
Synonym
DDX5-like