Synaptotagmin 1

Overview
NameSynaptotagmin 1
Smed IDSMED30018598
Length (bp)1426
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018598

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30018598h1SMcG0001693 SmedASXL_010374SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30018598h1SMcG0001693 dd_Smed_v4_13680_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin 1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 195.282 bits (495), Expect = 1.013e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 408          

HSP 2 Score: 63.1586 bits (152), Expect = 4.513e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  263 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 375          
BLAST of Synaptotagmin 1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 195.282 bits (495), Expect = 1.013e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 408          

HSP 2 Score: 63.1586 bits (152), Expect = 4.513e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  263 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 375          
BLAST of Synaptotagmin 1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 195.282 bits (495), Expect = 1.013e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 408          

HSP 2 Score: 63.1586 bits (152), Expect = 4.513e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  263 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 375          
BLAST of Synaptotagmin 1 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 194.897 bits (494), Expect = 1.404e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 405          

HSP 2 Score: 62.7734 bits (151), Expect = 5.063e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  260 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 372          
BLAST of Synaptotagmin 1 vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 193.741 bits (491), Expect = 4.445e-56
Identity = 115/272 (42.28%), Postives = 166/272 (61.03%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +LGKL +++ Y  ++  L V V    +L  L+ GGTSDPYVKV+L    K K+ETK+ R+T NP FNE FTF V  +EL  +TL+   YDFDRFSKH+ IG + + +  +DL + IE+W +L     +   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  KK   NPY+NE F F++  E   KVQ+VVT  +   + +  +  IG I +G   TG+  +HW ++++N +R I +WH L
Sbjct:  139 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEK--LGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTL-NPYFNESFSFEIPFEQIQKVQVVVTVLDY--DKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 405          
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 193.741 bits (491), Expect = 2.665e-56
Identity = 115/271 (42.44%), Postives = 167/271 (61.62%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LG++ Y + Y  +   L VTV    DL  ++  GTSDPYVK++L  + K K ETK+ R+T NPVFNE F F V+  E+  +TL+F  YDFDRFSKH+QIG +++ LG +DL  +IE+W ++  P  D   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L +GG  + KKK +  K    NPYYNE F F++  E   KV L++T  +   + +  +  IG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKVSLMITVMD--YDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTL 427          
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 187.963 bits (476), Expect = 3.313e-54
Identity = 115/272 (42.28%), Postives = 166/272 (61.03%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEF-QLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LG++ Y + Y  +   L VTV    DL  ++  GTSDPYVK++L  + K K ETK+ R+T NPVFNE F F V+  E+  +TL+F  YDFDRFSKH+QIG +++ LG +DL  +IE+W ++  P  D   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP+++L +       +KKK T IK+ T NPY+NE F F +L      KV L++T  +   + +  +  IG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDY--DKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTL 429          
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 183.341 bits (464), Expect = 4.355e-54
Identity = 104/277 (37.55%), Postives = 163/277 (58.84%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDN 1119
            LG+L Y + Y  +  SL V +    +L  ++ GGTSDPYVK++L    K K +TK++R++ NPVFNE FTF +   E+  QTL+   +DFDRF KH+QIG + + LG +DL+  +E    ++ P      E  LGE+C++L+  P++ KL V ++E K L+K D   L DP++++ L  G   + KKK T   K   NPYYNE F F +++E   +V L VT      + +  +  IG +++G   TG   K W ++++  +R++ +WH LV   D+
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESPP-----ENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTL-NPYYNESFSFDVTSEKMQRVHLHVTV--SDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTLVPFNDD 284          
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 183.341 bits (464), Expect = 4.355e-54
Identity = 104/277 (37.55%), Postives = 163/277 (58.84%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDN 1119
            LG+L Y + Y  +  SL V +    +L  ++ GGTSDPYVK++L    K K +TK++R++ NPVFNE FTF +   E+  QTL+   +DFDRF KH+QIG + + LG +DL+  +E    ++ P      E  LGE+C++L+  P++ KL V ++E K L+K D   L DP++++ L  G   + KKK T   K   NPYYNE F F +++E   +V L VT      + +  +  IG +++G   TG   K W ++++  +R++ +WH LV   D+
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESPP-----ENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTL-NPYYNESFSFDVTSEKMQRVHLHVTV--SDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTLVPFNDD 284          
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 161.384 bits (407), Expect = 6.181e-45
Identity = 101/287 (35.19%), Postives = 162/287 (56.45%), Query Frame = 1
Query:  292 GKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFN---CSNNNIKHSMPIGNIVLG------PTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDNKK 1125
            G + + ++Y  E   L VT+ S  DL  ++  G SDPYVKV++  + K KFET+I R T NP +NE F F++   EL ++TL+   YD+DR SK +++G L + L ++D     +    L +P  D   E  LG+IC S +  P    + +TI+EA+ L+K D     DP++++ L  G  ++ KKK +   K   NPYYNE F+F++   +  KV L+V+ ++    S N+      IG + LG      P IT +  + W E+++ S+R +V+WH L E ++ +K
Sbjct:   85 GNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTL-NPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDF-----IGEVTLGSKHLNLPQITHACSEQWAEMMT-SRRPVVQWHTLQERMEKEK 364          

HSP 2 Score: 83.1889 bits (204), Expect = 3.694e-17
Identity = 47/142 (33.10%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  262 KALEKPKES------LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKL--KFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLI----EDWAEL 651
            + L+KP++       LG + ++ +Y P + ++ +T+    +L K++ GG+SDPYVK++L    KL  K +T  K +T NP +NE F F + P  +    LI   +D+D+ SK++ IG + L    L+L ++     E WAE+
Sbjct:  202 RPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEM 343          
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 198.749 bits (504), Expect = 8.580e-58
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  188 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 460          
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 198.364 bits (503), Expect = 1.088e-57
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  186 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 458          
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 198.364 bits (503), Expect = 1.088e-57
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  186 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 458          
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077727)

HSP 1 Score: 198.364 bits (503), Expect = 1.088e-57
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  186 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 458          
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 197.208 bits (500), Expect = 3.029e-57
Identity = 117/277 (42.24%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  188 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQK--LGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 459          
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 194.512 bits (493), Expect = 1.372e-56
Identity = 114/271 (42.07%), Postives = 164/271 (60.52%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVITVLDY--DKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVL 404          

HSP 2 Score: 64.6994 bits (156), Expect = 8.209e-11
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            L++ EK  +E LG + ++++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG + + L +
Sbjct:  259 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS 379          
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 194.512 bits (493), Expect = 1.372e-56
Identity = 114/271 (42.07%), Postives = 164/271 (60.52%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVITVLDY--DKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVL 404          

HSP 2 Score: 64.6994 bits (156), Expect = 8.209e-11
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            L++ EK  +E LG + ++++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG + + L +
Sbjct:  259 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS 379          
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 189.119 bits (479), Expect = 1.645e-54
Identity = 108/271 (39.85%), Postives = 165/271 (60.89%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL +++ Y   +  L V +    DL+ +++GGTSDPYVKV++    K K++TK+ ++T NPVFNE F F +   E+  +TL+   YDFDRFSKH+ IG + + +  LDL++ IE W +LD  S++      LG+IC+SL+  P   KL + ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  +   K+Q V+T  +   + I  +  IG I +G    G+  +HW ++++N +R I +WH L
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLD--SAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTL-NPYYNESFSFEIPQDQMQKIQAVITVLD--YDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPL 413          

HSP 2 Score: 58.151 bits (139), Expect = 9.728e-9
Identity = 30/104 (28.85%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            E LG +  +++Y P +  L + +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F +  +++     +    D+D+  K++ IG
Sbjct:  277 EKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIG 380          
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 189.119 bits (479), Expect = 1.645e-54
Identity = 108/271 (39.85%), Postives = 165/271 (60.89%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL +++ Y   +  L V +    DL+ +++GGTSDPYVKV++    K K++TK+ ++T NPVFNE F F +   E+  +TL+   YDFDRFSKH+ IG + + +  LDL++ IE W +LD  S++      LG+IC+SL+  P   KL + ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  +   K+Q V+T  +   + I  +  IG I +G    G+  +HW ++++N +R I +WH L
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDLD--SAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTL-NPYYNESFSFEIPQDQMQKIQAVITVLD--YDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPL 413          

HSP 2 Score: 58.151 bits (139), Expect = 9.728e-9
Identity = 30/104 (28.85%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            E LG +  +++Y P +  L + +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F +  +++     +    D+D+  K++ IG
Sbjct:  277 EKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIG 380          
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 179.104 bits (453), Expect = 5.966e-51
Identity = 104/272 (38.24%), Postives = 161/272 (59.19%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +LGKL +++ Y      L V +    DL  ++ GGTSDPYVKV+L    K KFETK++R+   PVFNE F F +   EL  +TL+   +DFDRF KH+ IG + + +  +DL++ + +W EL+    +       G++C+SL+  P   KL V I+EAK L+K D   L DP++++ L+  G  + KKK T  K    NPY+NE F F++  E   KVQL++T ++   + +  + PIG   +G   TG G +HW ++++N +R + +WH L
Sbjct:  133 NLGKLEFSLDYNFTDAQLIVGILQAQDLAAMDIGGTSDPYVKVYLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCVDLAQPLHEWRELENGEKEEEKL---GDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTL-NPYFNESFSFEVPFEQIQKVQLLITVYD--YDKLGSNDPIGKTFIGYGATGVGLRHWSDMLANPRRPVAQWHTL 398          

HSP 2 Score: 65.0846 bits (157), Expect = 7.298e-11
Identity = 42/147 (28.57%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  292 GKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL----DQPSSDVNTEIPLGEICMSLK 714
            G +  +++Y P +  L V +    +L K++ GG SDPYVK+ L+   K   + K   +    NP FNE F+F V  E++    L+   YD+D+   ++ IG   +  GA  +   +  W+++     +P +  +T  P  E+  +LK
Sbjct:  265 GDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDPIGKTFIGYGATGVG--LRHWSDMLANPRRPVAQWHTLQPEEEVEAALK 409          
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 206.838 bits (525), Expect = 3.390e-61
Identity = 119/277 (42.96%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  271 EKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            EKP+E LGKL Y++ Y  ++  L V +    DL  L+ GGTSDPYVKV+L    K K+ETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +DL+ +IE+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + +  +  IG I +G   TG+  +HW ++++N +R I +WH L
Sbjct:  130 EKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVLTVLDY--DKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTL 401          

HSP 2 Score: 65.855 bits (159), Expect = 5.202e-11
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            L++ EK  +E LG + ++++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K+E IG + +   A
Sbjct:  256 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNA 376          
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 206.838 bits (525), Expect = 4.645e-61
Identity = 119/277 (42.96%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  271 EKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            EKP+E LGKL Y++ Y  ++  L V +    DL  L+ GGTSDPYVKV+L    K K+ETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +DL+ +IE+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + +  +  IG I +G   TG+  +HW ++++N +R I +WH L
Sbjct:  135 EKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVLTVLDY--DKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTL 406          

HSP 2 Score: 65.855 bits (159), Expect = 5.531e-11
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            L++ EK  +E LG + ++++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K+E IG + +   A
Sbjct:  261 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNA 381          
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 197.593 bits (501), Expect = 1.559e-57
Identity = 119/279 (42.65%), Postives = 169/279 (60.57%), Query Frame = 1
Query:  271 EKPKE--SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            E+PKE   LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVK++L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  138 EQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDL--VSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 411          

HSP 2 Score: 63.1586 bits (152), Expect = 4.127e-10
Identity = 34/112 (30.36%), Postives = 62/112 (55.36%), Query Frame = 1
Query:  259 LKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            + A ++ +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  267 VSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 378          
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 184.882 bits (468), Expect = 4.041e-53
Identity = 100/276 (36.23%), Postives = 162/276 (58.70%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            E  G++ Y+++Y  ++E L V VK    L  ++ GGTSDPY  V++    + KFETK+ R+T NPVFNE F F V+ EE+P  T +   +DF+RF KH+ IG +++ LG ++L  +IEDW +L  P+     E  LG+IC SL+  P   KL + ILEAK L++ D +   DP++++ L        +KK    K     PY+NE F F +S E    + L+++ ++  ++ +  +  IG + LG   +G+  +HW +++++ +R I +WH L E 
Sbjct:  104 EYRGRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDLG-PAGKTEHE-HLGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTL-KPYFNESFTFDVSLEQMKNLDLIISVWD--HDKVGKNEQIGKLFLGCRASGNALRHWSDMLAHPRRPIAQWHKLQEA 374          
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 180.644 bits (457), Expect = 3.232e-51
Identity = 106/266 (39.85%), Postives = 162/266 (60.90%), Query Frame = 1
Query:  304 YAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +++ Y  ++  ++V +    +L  L+ GGTSDPYVKV+     K K ETK+ R+T NP+FNE FTF +  +EL  +TL    YDFDRFSKH+ IG + + +  +DL + IE+W +L   S++      LG+IC+SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  KK   NPY+NE F F++  E   KVQ+V+T  +   + +  +  IG I +G   +G+  +HW ++++N +R I +WH L
Sbjct:  151 FSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ--SAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTL-NPYFNESFSFEIPFEQIQKVQVVITVLDY--DKLGKNEAIGKIFVGCNASGTELRHWSDMLANPRRPIAQWHPL 411          

HSP 2 Score: 65.0846 bits (157), Expect = 8.894e-11
Identity = 41/121 (33.88%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  259 LKALEKPK-ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPK--LKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            L++ EK + E LG +  +++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   K +T +K++T NP FNE F+F +  E++    ++    D+D+  K+E IG + +   A
Sbjct:  266 LQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNA 386          
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 195.282 bits (495), Expect = 6.511e-57
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 407          

HSP 2 Score: 63.1586 bits (152), Expect = 3.035e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  262 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 374          
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 195.282 bits (495), Expect = 6.511e-57
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 407          

HSP 2 Score: 63.1586 bits (152), Expect = 3.035e-10
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  262 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 374          
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 193.356 bits (490), Expect = 3.418e-56
Identity = 115/272 (42.28%), Postives = 166/272 (61.03%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +LGKL +++ Y  ++  L V V    +L  L+ GGTSDPYVKV+L    K K+ETK+ R+T NP FNE FTF V  +EL  +TL+   YDFDRFSKH+ IG + + +  +DL + IE+W +L     +   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  KK   NPY+NE F F++  E   KVQ+VVT  +   + +  +  IG I +G   TG+  +HW ++++N +R I +WH L
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEK--LGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTL-NPYFNESFSFEIPFEQIQKVQVVVTVLDY--DKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 408          
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 193.356 bits (490), Expect = 3.418e-56
Identity = 115/272 (42.28%), Postives = 166/272 (61.03%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +LGKL +++ Y  ++  L V V    +L  L+ GGTSDPYVKV+L    K K+ETK+ R+T NP FNE FTF V  +EL  +TL+   YDFDRFSKH+ IG + + +  +DL + IE+W +L     +   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  KK   NPY+NE F F++  E   KVQ+VVT  +   + +  +  IG I +G   TG+  +HW ++++N +R I +WH L
Sbjct:  142 NLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEK--LGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTL-NPYFNESFSFEIPFEQIQKVQVVVTVLDY--DKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 408          
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 159.844 bits (403), Expect = 7.157e-44
Identity = 101/274 (36.86%), Postives = 159/274 (58.03%), Query Frame = 1
Query:  280 KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            K  LG+L Y++ Y  ++  L V +     L  L+ GG+SDPYV V+L    + + ETK+ R+T NP F E F F V   EL  + L+   YDFDRFS+++ IG + + + +++L + ++ W EL     +   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L +GG  V KKK T  K    NPYYNE F F++  +   KVQ+ +T  +   + +  +  IG + +G  + G+G +HW ++++N +R I +WH L
Sbjct:  106 KHQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEK--LGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTL-NPYYNEAFSFEVPCDQVQKVQVELTVLD--YDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSL 374          
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 1.257e-62
Identity = 121/279 (43.37%), Postives = 172/279 (61.65%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            K +  LGKL +++ Y  +   L V V    DL  ++  GTSDPYVKV+L    K K+ETK+ R+T NPVFNE FTF V   E+ ++ L F  YDFDRFSKH+QIG + + L ++DL +++EDW +L  P ++   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP+++++L +G   + KKK T  K    NPY+NE F F++  E   KV L++T  +   + I  S PIG  VLG   +G+  +HW ++++N +R I +WH L EV
Sbjct:  149 KSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTL-NPYFNESFGFEVPFEQIQKVTLIITVVDY--DRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEV 424          
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Match: sp|P21521|SY65_DROME (Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 198.749 bits (504), Expect = 8.600e-57
Identity = 118/277 (42.60%), Postives = 171/277 (61.73%), Query Frame = 1
Query:  274 KPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            + ++ LG+L + ++Y   S SL VTV    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T +PVFNE FTF   P  +   +TL+F  +DFDRFSKH+QIG + + L  +DL++ IE+W +L     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++++ + G  + KKK +  K    NPYYNE F F++  E   K+ LVVT  +   + I  S PIG  +LG   TG+  +HW +++++ +R I +WH L
Sbjct:  188 QSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTL-NPYYNESFSFEVPFEQIQKICLVVTVVD--YDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 460          
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Match: sp|Q5R4J5|SYT1_PONAB (Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.413e-56
Identity = 115/271 (42.44%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KK+ T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 405          

HSP 2 Score: 77.0258 bits (188), Expect = 7.477e-14
Identity = 41/113 (36.28%), Postives = 67/113 (59.29%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKL--KFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   K ET IK+ T NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  260 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 372          
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Match: sp|P46096|SYT1_MOUSE (Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 4.554e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 407          

HSP 2 Score: 63.1586 bits (152), Expect = 2.123e-9
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  262 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 374          
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Match: sp|P21579|SYT1_HUMAN (Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 4.864e-56
Identity = 116/271 (42.80%), Postives = 163/271 (60.15%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y++ Y  ++  L V +    +L  L+ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG   + +  +D   + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+VVT  +   + I  +  IG + +G   TG+  +HW ++++N +R I +WH L
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQVVVTVLDY--DKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 408          

HSP 2 Score: 63.1586 bits (152), Expect = 2.167e-9
Identity = 36/113 (31.86%), Postives = 63/113 (55.75%), Query Frame = 1
Query:  259 LKALEKP-KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG 588
            L++ EK  +E LG + ++++Y P +  L V +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG
Sbjct:  263 LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIG 375          
BLAST of Synaptotagmin 1 vs. TrEMBL
Match: A0A267E333 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g3 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.529e-70
Identity = 135/282 (47.87%), Postives = 182/282 (64.54%), Query Frame = 1
Query:  265 ALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            A EK  E LGKL Y++ Y  +   L V V    DL  ++ GGTSDPYVKV++  + K KFETK+ R+T NPVFNE F F V   ++P++TL+F  YDFDRFSKH+QIG + L LGA+DL++LIE+W ++D P S+ +    LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL   G  + KKK T  K    NPYYNE F F++  E   KV L+VT  +   + I  S PIG IVLG T TG+  +HW ++++N +R I +WH L E+
Sbjct:  149 AQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTL-NPYYNESFSFEVPFEQIQKVSLIVTVVD--YDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEM 427          
BLAST of Synaptotagmin 1 vs. TrEMBL
Match: A0A267GS86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g1 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.737e-70
Identity = 135/282 (47.87%), Postives = 182/282 (64.54%), Query Frame = 1
Query:  265 ALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            A EK  E LGKL Y++ Y  +   L V V    DL  ++ GGTSDPYVKV++  + K KFETK+ R+T NPVFNE F F V   ++P++TL+F  YDFDRFSKH+QIG + L LGA+DL++LIE+W ++D P S+ +    LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL   G  + KKK T  K    NPYYNE F F++  E   KV L+VT  +   + I  S PIG IVLG T TG+  +HW ++++N +R I +WH L E+
Sbjct:  149 AQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTL-NPYYNESFSFEVPFEQIQKVSLIVTVVD--YDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEM 427          
BLAST of Synaptotagmin 1 vs. TrEMBL
Match: A0A267E6V1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g2 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 6.572e-70
Identity = 134/280 (47.86%), Postives = 181/280 (64.64%), Query Frame = 1
Query:  271 EKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            EK  E LGKL Y++ Y  +   L V V    DL  ++ GGTSDPYVKV++  + K KFETK+ R+T NPVFNE F F V   ++P++TL+F  YDFDRFSKH+QIG + L LGA+DL++LIE+W ++D P S+ +    LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL   G  + KKK T  K    NPYYNE F F++  E   KV L+VT  +   + I  S PIG IVLG T TG+  +HW ++++N +R I +WH L E+
Sbjct:  151 EKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYILPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTL-NPYYNESFSFEVPFEQIQKVSLIVTVVD--YDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEM 427          
BLAST of Synaptotagmin 1 vs. TrEMBL
Match: A0A1D2ML67 (Synaptotagmin 1 (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_12882 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.375e-65
Identity = 128/283 (45.23%), Postives = 176/283 (62.19%), Query Frame = 1
Query:  277 PKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDNKK 1125
            P + LGKL Y ++Y   + +L+VTV    DL  L+ GGTSDPYVKV+L    K KFETK+ R+T NP+FNE F F +   +L  +TL+F  +DFDRFSKH+QIG + + L  LDL++ IEDW EL     +   E  LG+IC SL+  P   KL V ILEAK L+K D   L DP+++++L + G  + KKK +  K    NPYYNE F F++  E   KV LV+T  +   + I  S PIG +VLG   TG+  +HW +++++ +R I +WH L E  D KK
Sbjct:   32 PVQKLGKLQYRLEYDFNANNLQVTVIQAEDLPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPIFNETFNFKLPYSDLMAKTLVFAIFDFDRFSKHDQIGEVKIPLCQLDLAQTIEDWKELQSVEGEGGQENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALMQNGKRLKKKKTSIKKCTL-NPYYNESFTFEVPFEQIQKVNLVITVVDY--DRIGTSEPIGKVVLGCNATGTELRHWSDMLASPRRPIAQWHTLKEPDDEKK 311          
BLAST of Synaptotagmin 1 vs. TrEMBL
Match: A0A267EMR3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002345g1 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.669e-65
Identity = 126/274 (45.99%), Postives = 174/274 (63.50%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            LGKL Y++ Y  +   L V V    DL  ++ GGTSDPYVK ++    K KFETK+ R+T NPVFNE F F V   ++P++TL+F  YDFDRFSKH+QIG + L LG +DL+++IE+W ++D P S+ +    LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL   G  + KKK T  K    NPYYNE F F++  E   KV L+VT  +   + I  S PIG +VLG T T +  +HW ++++N +R I +WH L E+
Sbjct:  142 LGKLQYSLDYDFQKGELSVGVIQAADLPAMDMGGTSDPYVKTYILPDKKKKFETKVHRKTLNPVFNETFVFKVPYADVPSKTLVFAIYDFDRFSKHDQIGLIKLPLGCMDLARVIEEWKDVDPPESEDDKSNKLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMMNGKRLKKKKTTIKKCTL-NPYYNESFTFEVPFEQIQKVTLIVTVVD--YDRIGTSEPIGRVVLGCTATQAELRHWSDMLANPRRPIAQWHTLQEM 412          
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Match: ENSAMXT00000017640.2 (synaptotagmin-1-like [Source:NCBI gene;Acc:103035847])

HSP 1 Score: 201.445 bits (511), Expect = 2.539e-59
Identity = 115/273 (42.12%), Postives = 171/273 (62.64%), Query Frame = 1
Query:  292 GKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
            GKL+Y+++Y      + V +K   +L+ ++ GGTSDPYVKV++       FETK+ R+T NPVFNE F + +S +EL   TL+   YDF+RFSKH+ IG L L+L A+D + +IE+W +L +PS   + +  LGEIC SL+  P   KL V ILEAK L+K D     DP++++ L        KKK T++KK T NPY+NE F F +S E   KVQLV++ ++  ++ +  +  IG I LG   TG+  +HW +++SN +R + +WH L+  
Sbjct:  137 GKLLYSLEYNAARSEMAVGIKEAAELMAMDHGGTSDPYVKVYVLPSKSKTFETKVFRKTLNPVFNESFKYQISQKELGESTLVIQVYDFNRFSKHDVIGELRLELSAVDWNHVIEEWRDLSKPSK--HEQEHLGEICFSLRYVPTASKLTVVILEAKNLKKMDHGGYSDPYVKVQL-ILDKRKWKKKKTSVKKQTLNPYFNESFTFDVSFEQIQKVQLVISVWD--HDKMSRNDAIGKIFLGCDATGNQLRHWADMLSNPRRPVAQWHTLLSA 404          

HSP 2 Score: 73.9442 bits (180), Expect = 7.415e-14
Identity = 47/136 (34.56%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  262 KALEKP----KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVW--LKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            + L KP    +E LG++ ++++Y P +  L V +    +L K++ GG SDPYVKV   L ++   K +T +K++T NP FNE FTF VS E++    L+   +D D+ S+++ IG + L   A      +  WA++
Sbjct:  254 RDLSKPSKHEQEHLGEICFSLRYVPTASKLTVVILEAKNLKKMDHGGYSDPYVKVQLILDKRKWKKKKTSVKKQTLNPYFNESFTFDVSFEQIQKVQLVISVWDHDKMSRNDAIGKIFLGCDA--TGNQLRHWADM 387          
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 195.667 bits (496), Expect = 4.481e-57
Identity = 115/279 (41.22%), Postives = 167/279 (59.86%), Query Frame = 1
Query:  271 EKPKES--LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            E PKE   LGKL +++ Y     SL V +    DL  ++  GTSDPYVK++L    K KFETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S++ E+W  L +   +   +  LG+IC+SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++ +E   KVQ+VVT  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  133 EGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQKAEKEEQEK--LGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTL-NPYYNESFSFEVPSEQIQKVQVVVTVLD--YDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL 406          

HSP 2 Score: 66.2402 bits (160), Expect = 2.640e-11
Identity = 44/155 (28.39%), Postives = 77/155 (49.68%), Query Frame = 1
Query:  262 KALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA------------LDLSKLIEDWAELDQPSSDVNTEI 684
            KA ++ +E LG +  +++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG + + L +             +  + I  W  L +P  DV+ E+
Sbjct:  263 KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL-KPEEDVDAEL 416          
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 195.282 bits (495), Expect = 4.778e-57
Identity = 115/279 (41.22%), Postives = 167/279 (59.86%), Query Frame = 1
Query:  271 EKPKES--LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            E PKE   LGKL +++ Y     SL V +    DL  ++  GTSDPYVK++L    K KFETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S++ E+W  L +   +   +  LG+IC+SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++ +E   KVQ+VVT  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  130 EGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQKAEKEEQEK--LGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTL-NPYYNESFSFEVPSEQIQKVQVVVTVLDY--DKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL 403          

HSP 2 Score: 66.2402 bits (160), Expect = 2.590e-11
Identity = 44/155 (28.39%), Postives = 77/155 (49.68%), Query Frame = 1
Query:  262 KALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA------------LDLSKLIEDWAELDQPSSDVNTEI 684
            KA ++ +E LG +  +++Y P +  L V V    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F V  E++    ++    D+D+  K++ IG + + L +             +  + I  W  L +P  DV+ E+
Sbjct:  260 KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL-KPEEDVDAEL 413          
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 194.512 bits (493), Expect = 1.090e-56
Identity = 116/280 (41.43%), Postives = 167/280 (59.64%), Query Frame = 1
Query:  262 KALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +A  K +E LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP+ ++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  127 EAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQIVITVLDY--DKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVL 401          
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 194.126 bits (492), Expect = 1.415e-56
Identity = 116/280 (41.43%), Postives = 167/280 (59.64%), Query Frame = 1
Query:  262 KALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +A  K +E LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NP FNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V ILEAK L+K D   L DP+ ++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  130 EAEPKEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQIVITVLDY--DKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVL 404          
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 114.39 bits (285), Expect = 8.604e-30
Identity = 58/121 (47.93%), Postives = 79/121 (65.29%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            LGKL ++I Y  ++  L V V    +L  L+ GGTSDPYVK++L    K K+ETK+ R+T NPVFNE F F V   EL  +TL+   YDFDRFSKH+ IG + + +  +DL  +IE+W +L
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDL 200          
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 114.39 bits (285), Expect = 8.966e-30
Identity = 55/128 (42.97%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSD 669
            +LG+L +++ Y  ++    V +    DL  ++ GG SDPYV+V+L    K KFET + R+T NP+F E FTFTV  EEL  + L+   YDFDRFS+H+ IG L + L ++DLS  +E+W +L +   D
Sbjct:   78 TLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDLQKTEKD 205          
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 114.775 bits (286), Expect = 1.192e-29
Identity = 58/121 (47.93%), Postives = 79/121 (65.29%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            LGKL ++I Y  ++  L V V    +L  L+ GGTSDPYVK++L    K K+ETK+ R+T NPVFNE F F V   EL  +TL+   YDFDRFSKH+ IG + + +  +DL  +IE+W +L
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDL 217          
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 95.9005 bits (237), Expect = 6.930e-23
Identity = 54/123 (43.90%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  292 GKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLD--LGALDLSKLIEDWAELD 654
            GKL +A+ Y  E E L V V    +L   +  GTSDPYVK++L    K K++TK+ R+T NPVF E F F V   ELP + L F  YDFDRFS+H+ IG +++D      DLS+    W +++
Sbjct:  114 GKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPDRKRKYQTKVHRKTLNPVFEETFQFFVPYAELPARRLHFSVYDFDRFSRHDTIGQVVVDNLFEESDLSRETSLWRDIE 236          
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 97.4413 bits (241), Expect = 7.505e-23
Identity = 51/123 (41.46%), Postives = 77/123 (62.60%), Query Frame = 1
Query:  292 GKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLD--LGALDLSKLIEDWAELD 654
            G++ + ++Y  E E L V +    DL   +  GTSDPYVK++L  + K K++TK+ R+T NPVF+E F F V   EL ++ L F  YDFDRFS+H+ IG +++D  L A D S+    W +++
Sbjct:  185 GRINFQVRYDYEGEQLVVKINKAVDLPAKDFSGTSDPYVKIYLLPERKRKYQTKVHRKTLNPVFDETFQFGVPYSELASRRLHFSVYDFDRFSRHDIIGTVLVDNLLEATDHSRETSIWRDIE 307          
BLAST of Synaptotagmin 1 vs. Ensembl Yeast
Match: TCB2 (ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; contains 3 calcium and lipid binding domains; mRNA is targeted to bud; TCB2 has a paralog, TCB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005031])

HSP 1 Score: 55.8398 bits (133), Expect = 9.213e-9
Identity = 43/147 (29.25%), Postives = 65/147 (44.22%), Query Frame = 1
Query:  292 GKLVYAIKYFP-------------ESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLK-FETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPL 690
             KL+  + +FP              S  L++T KS  +LI +N  G SDPYV+ +L EK     F+T ++++T NP +NE  T  VS        L     D++  + +  IG  ++ L  +D             P SD    IPL
Sbjct:  957 AKLLVQVSWFPVTATELPQSDLITNSGDLKITAKSAENLIGVNKNGYSDPYVEFFLNEKSTSPFFKTAVQKKTLNPTWNESKTIEVSNR--VNDYLTINVKDYESTNSNRSIGKAVVPLSTID-------------PESDTTFNIPL 1088          
BLAST of Synaptotagmin 1 vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 55.0694 bits (131), Expect = 1.739e-8
Identity = 34/109 (31.19%), Postives = 58/109 (53.21%), Query Frame = 1
Query:  319 FPESES------LRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSK 627
             P SES      L + + SGH L   +  G SDP+V +++ +K    F++ IK++T +PV+NED    +         +IF   D+DR   ++ +G   LD+ +L++ K
Sbjct: 1124 LPSSESVEDTGYLNIKLISGHGLKSADRNGYSDPFVHIFVNDKK--VFKSNIKKKTLDPVWNEDAKIPILSRS--KNQVIFNVLDWDRAGDNDDLGQASLDVSSLEVGK 1228          
BLAST of Synaptotagmin 1 vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 47.3654 bits (111), Expect = 3.974e-6
Identity = 36/139 (25.90%), Postives = 61/139 (43.88%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFP-------------ESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQP 660
            E   KL+  I +FP              S  L +  +S  +LI  +  G SDPY+K ++  +    ++TK+ ++T NP +N++ T  ++        L     D+D  S  + IG   + L  +     +E   ELD P
Sbjct:  963 EGSAKLMLQISWFPIDTKQLPANDLITNSGDLTIMSRSAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQINNR--LNDVLRIKVMDWDSTSADDTIGTAEIPLNKVK----VEGTTELDVP 1095          
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 159.458 bits (402), Expect = 1.266e-44
Identity = 96/275 (34.91%), Postives = 157/275 (57.09%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSP-EELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSD---VNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +G++ + + Y     +L V +    D+   +  G+SDPYVK+ L    K K+ETK+ R+T NPVFNE F F   P  E+  + L+   +DFDRFS+H+ IG   L L  +DL+  I +W  L  PS      +++  LG+IC SL+  P   KL +TI+EAK L+  D     DP+++++L + G  + KKK T  K+   NPYYNE F F ++ E   +  L+++  +   + +  S  IG  V+G   +G+  +HW +++++ +R++ +WH L
Sbjct:   84 IGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTL-NPYYNETFTFTVAFEKIEQTSLIISVLDY--DRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTL 355          

HSP 2 Score: 72.7886 bits (177), Expect = 4.963e-14
Identity = 43/127 (33.86%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  280 KESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIG-CLMLDLGALDLSKLIEDWAEL 651
            K  LG + ++++Y P S  L++T+     L  ++  G SDPYVK+ L ++ +   + K   + R  NP +NE FTFTV+ E++   +LI    D+DR  K E IG C+   +G L     +  WA++
Sbjct:  218 KSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCV---VGELSSGADLRHWADM 341          
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 130.954 bits (328), Expect = 5.816e-35
Identity = 84/279 (30.11%), Postives = 149/279 (53.41%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPE-ELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSN-NNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVV 1113
            E LGK+ +++ Y+     L + V     L   +  GTSDP+VK+ L    K K ET++KR+  NPV+NE FTF   P  +L  +TL     D+DRFS+++ IG + + L  +DL  +   + +   P       +PLG++ +SL   P   ++ V +++A  L+  D     DP++++ +      + KKK T  ++   +P +NE F F +  +   K++ +   FN  + + I  +  IG ++LG   TGS  +HW E+++N ++ + +WH L + +
Sbjct:    1 EQLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDLLPCK--KDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTR-DPVWNESFIFDVPLD---KIRDLTFVFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQWHRLQDAL 273          

HSP 2 Score: 77.411 bits (189), Expect = 5.469e-16
Identity = 44/129 (34.11%), Postives = 74/129 (57.36%), Query Frame = 1
Query:  271 EKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKL--KFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            +K +  LG L+ ++ Y P +  + V V   + L  ++  G+SDPYVK+++  K +   K +T IKRRTR+PV+NE F F V  +++   T +F   D+DR +++E IG ++  LG       +  W E+
Sbjct:  129 KKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVI--LGYRTTGSSLRHWTEM 255          
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Match: EDO47762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX9])

HSP 1 Score: 111.694 bits (278), Expect = 1.196e-27
Identity = 84/280 (30.00%), Postives = 150/280 (53.57%), Query Frame = 1
Query:  277 PKESLGKLVYAIKYFPESESLRVTVKSGHDL-IKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQP--SSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSG--YKHWKEIISNSKRTIVRWHGL 1101
            P+  +G+L + I+Y    ++L VT+    +L  +  T  T DP+VK+ L  K K   +++ KR+T+ P FNE F   ++ +EL + TL F  +D  R S+   IG  M  L  ++ + + E W +L++P   S    ++ LG+I +SL   P  ++L + IL A  LR    +   DPF++++    G  V+K K T + + T NP +N+ F + ++ +      L+V+ ++ S   ++    IG ++LG  +   G   +HW E+++N ++ I  WH L
Sbjct:   26 PESHIGRLWFNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVSQSRCKRKTKRPTFNETFYIPIAEDELDSSTLQFTVFDGYRMSQQAIIGEAMYPLIDMESTGIQELWRDLEKPIEVSQAKRKL-LGDIHISLSYYPTLDRLTIIILRAANLRTIGHKGT-DPFVKIAF-SIGNKVMKTKKTAVHQDTVNPMFNDAFNYTVTEDDLGTSSLLVSVWH-SGGGVREDKLIGRVLLGGMMYARGKECEHWTEMMTNPRKMIKYWHPL 301          
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 103.219 bits (256), Expect = 8.958e-25
Identity = 83/280 (29.64%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  286 SLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWL----KEKPKLKFETKIKRRTRNPVFNEDFTF-TVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEV 1110
             LG L + ++Y      L V +     L  ++ GGTSDPYVK+ L     +  KL+  TK K  T NPVFNE  T+  ++ EE+ ++TL    +D D   +++ IG   ++L  L+ S   + +     P +  +   PLG I ++LK +     LFVT++   GL   D     DP+++  L+       K++    KK   NP +NE+F + ++     K  L VT ++      K +  IG ++L     GS  KHW +++    +   +WH L  V
Sbjct:   18 GLGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYK--TLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLN-SNPTQTFKRSLIPKALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTL-NPEFNEEFVYDIAHHELAKKSLEVTVWDYDVG--KSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTLENV 291          

HSP 2 Score: 80.4925 bits (197), Expect = 8.146e-17
Identity = 44/119 (36.97%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  262 KALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKP--KLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGA 612
            KAL+ P   LG++  A+KY  +   L VTV     L  ++  G SDPYVK +LK  P  K K  T I+++T NP FNE+F + ++  EL  ++L    +D+D    ++ IG ++L++ A
Sbjct:  145 KALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINA 263          
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Match: EDO33081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST78])

HSP 1 Score: 101.679 bits (252), Expect = 1.515e-24
Identity = 78/273 (28.57%), Postives = 126/273 (46.15%), Query Frame = 1
Query:  295 KLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDL-YDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTI--TGSGYKHWKEIISNSKRTIVRWHGLV 1104
            +L +++ Y   +E L+V +     L        + PYVK+ L    K K ++  + R  NP FNEDF F+V  EEL  +TL F   DFDRFS+ + IG + L+ G                            ++  SL+  P   +L V IL+ K LR   EE    D ++++S+  GG  V K+K   +KK   NP +N+ F F +       V  V++          + + +G  V+GP +  T  G  HW +++ + +  + +WH L+
Sbjct:    5 RLCFSLNYSHYNEKLQVKLIRATRLTPKGNNVVATPYVKMCLLPDRKRKLQSTRRHRNSNPAFNEDFVFSVPAEELRMRTLKFTVCDFDRFSRQQVIGHVQLEKG----------------------------QLLFSLQYLPTACRLTVAILKGKDLRVEGEETTEIDTYVKVSMIMGGKAVKKRKTPVVKKTC-NPVFNQAFVFSMPPSYLENVSFVISVIATPKRG-GNKIHVGRAVVGPYMYSTSPGLSHWTDMLGSPRSAVAQWHSLI 247          
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 207.608 bits (527), Expect = 1.368e-61
Identity = 118/271 (43.54%), Postives = 171/271 (63.10%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y+I Y  +   L V +    DL+ +++GGTSDPYVKV++    K KF+TK+ ++T NPVFNE FTF +  +E+  +TL+   YDFDRFSKH+ IG + + +  LDL+K IE+W +LD  S+D      LG+IC+SL+  P   KL + ILEAK L+K D   L DP+++++L + G  + KKK T  K    NPYYNE F F++  E   K+Q V+T  +   + I  +  IG I +G   TG+G KHW ++++N +R I +WH L
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLD--SADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTL-NPYYNESFSFEIPLEQMQKIQAVITVLDY--DKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPL 415          

HSP 2 Score: 58.9214 bits (141), Expect = 4.806e-9
Identity = 33/125 (26.40%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            E LG +  +++Y P +  L + +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F +  E++     +    D+D+  K++ IG +   +G+      ++ W+++
Sbjct:  279 EKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIW--VGSKSTGAGLKHWSDM 401          
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 207.608 bits (527), Expect = 1.368e-61
Identity = 118/271 (43.54%), Postives = 171/271 (63.10%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y+I Y  +   L V +    DL+ +++GGTSDPYVKV++    K KF+TK+ ++T NPVFNE FTF +  +E+  +TL+   YDFDRFSKH+ IG + + +  LDL+K IE+W +LD  S+D      LG+IC+SL+  P   KL + ILEAK L+K D   L DP+++++L + G  + KKK T  K    NPYYNE F F++  E   K+Q V+T  +   + I  +  IG I +G   TG+G KHW ++++N +R I +WH L
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLD--SADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTL-NPYYNESFSFEIPLEQMQKIQAVITVLDY--DKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPL 415          

HSP 2 Score: 58.9214 bits (141), Expect = 4.806e-9
Identity = 33/125 (26.40%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  283 ESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTR--NPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAEL 651
            E LG +  +++Y P +  L + +    +L K++ GG SDPYVK+ L +  K   + K   +    NP +NE F+F +  E++     +    D+D+  K++ IG +   +G+      ++ W+++
Sbjct:  279 EKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIW--VGSKSTGAGLKHWSDM 401          
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Match: ENSORLT00000042397.1 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 202.601 bits (514), Expect = 1.127e-59
Identity = 120/271 (44.28%), Postives = 168/271 (61.99%), Query Frame = 1
Query:  289 LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            LGKL Y+I+Y  E+  L V +    DL+ +++GGTSDPYV+V L    K KF+TK+ ++T NPVFNE F F V  EEL  +TL    YD+DRFSKH+ IG + L +  +DL + IE+W +L+  S+D      LG+IC+SL+  P   KL V ILEAK L+K D   L DP++++ L +GG  + KKK T  K    NPYYNE F F++  E   K+ + VT F+   + I  +  IG I +G   TG G KHW ++++N +R I +WH L
Sbjct:  148 LGKLQYSIEYDFENTKLTVGILQAADLMSMDSGGTSDPYVRVLLLPDKKKKFDTKVHKKTLNPVFNETFVFKVPYEELGGKTLCLSVYDYDRFSKHDVIGEVKLAMNTIDLGRPIEEWRDLE--SADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDACGLSDPYVKIQLLQGGKRLKKKKTTVKKNTL-NPYYNESFSFEIPLEQMQKILVAVTVFDY--DKIGKNDAIGKIFVGSKATGLGLKHWSDMLANPRRPIAQWHVL 413          
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 196.823 bits (499), Expect = 1.677e-57
Identity = 117/278 (42.09%), Postives = 169/278 (60.79%), Query Frame = 1
Query:  274 KPKES--LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +PKES  LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  136 EPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQIVITVLDY--DKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVL 408          
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 196.823 bits (499), Expect = 1.677e-57
Identity = 117/278 (42.09%), Postives = 169/278 (60.79%), Query Frame = 1
Query:  274 KPKES--LGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            +PKES  LGKL Y++ Y     +L V +    +L  ++ GGTSDPYVKV+L    K KFETK+ R+T NPVFNE FTF V   EL  +TL+   YDFDRFSKH+ IG + + +  +D S + E+W +L   S++   +  LG+IC SL+  P   KL V +LEAK L+K D   L DP++++ L + G  + KKK T  K    NPYYNE F F++  E   KVQ+V+T  +   + I  +  IG + +G   +G+  +HW ++++N +R I +WH L
Sbjct:  136 EPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ--SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTL-NPYYNESFSFEVPFEQIQKVQIVITVLDY--DKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVL 408          
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Match: SMESG000059797.1 (SMESG000059797.1)

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 340/342 (99.42%), Postives = 341/342 (99.71%), Query Frame = 1
Query:  100 MNTMXXXXXXXXXXXXXXXCWIMYRHFYRKKNDKIVFDXXXXXXXXXXXXXVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDNKK 1125
            MNTMILIISSILAVSIAAICWIMYRHFYRKKNDKIVFDKLEKKAAELNLEEVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETK+KRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEGGGIVIKKKFTTIKKATPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISN KRTIVRWHGLVEVVDNKK
Sbjct:    1 MNTMILIISSILAVSIAAICWIMYRHFYRKKNDKIVFDKLEKKAAELNLEEVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKVKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEGGGIVIKKKFTTIKKATPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNPKRTIVRWHGLVEVVDNKK 342          
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Match: SMESG000059797.1 (SMESG000059797.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 321/323 (99.38%), Postives = 322/323 (99.69%), Query Frame = 1
Query:  157 CWIMYRHFYRKKNDKIVFDXXXXXXXXXXXXXVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDNKK 1125
            CWIMYRHFYRKKNDKIVFDKLEKKAAELNLEEVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETK+KRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEGGGIVIKKKFTTIKKATPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISN KRTIVRWHGLVEVVDNKK
Sbjct:   17 CWIMYRHFYRKKNDKIVFDKLEKKAAELNLEEVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKVKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEGGGIVIKKKFTTIKKATPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNPKRTIVRWHGLVEVVDNKK 339          
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 226.483 bits (576), Expect = 2.578e-69
Identity = 136/283 (48.06%), Postives = 180/283 (63.60%), Query Frame = 1
Query:  271 EKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDN 1119
            EK    LGKL Y++ Y  +   L V V    DL  ++  GTSDPYVK++L    K KFETK+ R+  NPVFNE F F V   E+ ++TLIF  YDFDRFSKH+QIG + + LGA+DL ++IE+W EL+ P +D   E  LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL    G  +KKK TTIKK T NPYYNE F F++  E   KV L+VT  +   + I  S PIG IVLG   TG+  +HW ++++N +R I +WH L E+ +N
Sbjct:  115 EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSL-MLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDY--DRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPEN 394          
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 220.705 bits (561), Expect = 6.512e-67
Identity = 132/279 (47.31%), Postives = 176/279 (63.08%), Query Frame = 1
Query:  265 ALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            A +K   +LGKL Y++ Y      L V V    DL  ++  GTSDPYVKV+L    K KFETK+ R+  NPVFNE F F +   E+ ++TL+F  +DFDRFSKH+QIG + + LG++DL K+IE+W EL  P SD   E  LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL    G  +KKK TTIKK T NPYYNE F F++  E   KV L+VT  +   + I  S PIG +VLG   TG+  +HW ++++N +R I +WH L
Sbjct:  126 AQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSL-MLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDY--DRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 401          
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 220.32 bits (560), Expect = 7.239e-67
Identity = 132/279 (47.31%), Postives = 176/279 (63.08%), Query Frame = 1
Query:  265 ALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSDPYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFFYDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEICMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEXXXXXXXXXXXXXXXXXPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPIGNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGL 1101
            A +K   +LGKL Y++ Y      L V V    DL  ++  GTSDPYVKV+L    K KFETK+ R+  NPVFNE F F +   E+ ++TL+F  +DFDRFSKH+QIG + + LG++DL K+IE+W EL  P SD   E  LG+IC SL+  P   KL + ILEAK L+K D   L DP+++LSL    G  +KKK TTIKK T NPYYNE F F++  E   KV L+VT  +   + I  S PIG +VLG   TG+  +HW ++++N +R I +WH L
Sbjct:  122 AQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSL-MLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDY--DRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTL 397          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT11.013e-5642.80synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.013e-5642.80synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.013e-5642.80synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT11.404e-5642.80synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT24.445e-5642.28synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-12.665e-5642.44Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-13.313e-5442.28Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-34.355e-5437.55SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-34.355e-5437.55SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-26.181e-4535.19Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt18.580e-5842.60gene:FBgn0004242 transcript:FBtr0077726[more]
Syt11.088e-5742.60gene:FBgn0004242 transcript:FBtr0077728[more]
Syt11.088e-5742.60gene:FBgn0004242 transcript:FBtr0345331[more]
Syt11.088e-5742.60gene:FBgn0004242 transcript:FBtr0077727[more]
Syt13.029e-5742.24gene:FBgn0004242 transcript:FBtr0343993[more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a1.372e-5642.07synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a1.372e-5642.07synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a1.645e-5439.85synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a1.645e-5439.85synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt5b5.966e-5138.24synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT53.390e-6142.96synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT54.645e-6142.96synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
e2f41.559e-5742.65E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
syt84.041e-5336.23synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
luzp23.232e-5139.85leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt16.511e-5742.80synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt16.511e-5742.80synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt23.418e-5642.28synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt23.418e-5642.28synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt57.157e-4436.86synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
back to top
BLAST of Synaptotagmin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41823|SY65_APLCA1.257e-6243.37Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=... [more]
sp|P21521|SY65_DROME8.600e-5742.60Synaptotagmin 1 OS=Drosophila melanogaster OX=7227... [more]
sp|Q5R4J5|SYT1_PONAB2.413e-5642.44Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE... [more]
sp|P46096|SYT1_MOUSE4.554e-5642.80Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 P... [more]
sp|P21579|SYT1_HUMAN4.864e-5642.80Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE... [more]
back to top
BLAST of Synaptotagmin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E3331.529e-7047.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS861.737e-7047.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6V16.572e-7047.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1D2ML671.375e-6545.23Synaptotagmin 1 (Fragment) OS=Orchesella cincta OX... [more]
A0A267EMR31.669e-6545.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000017640.22.539e-5942.12synaptotagmin-1-like [Source:NCBI gene;Acc:1030358... [more]
syt1b4.481e-5741.22synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b4.778e-5741.22synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1a1.090e-5641.43synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1a1.415e-5641.43synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt2a8.604e-3047.93synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
SYT58.966e-3042.97synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
syt2a1.192e-2947.93synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
SYT66.930e-2343.90synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
SYT67.505e-2341.46synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TCB29.213e-929.25ER protein involved in ER-plasma membrane tetherin... [more]
TCB31.739e-831.19Cortical ER protein involved in ER-plasma membrane... [more]
TCB13.974e-625.90Lipid-binding ER protein involved in ER-plasma mem... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317461.266e-4434.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437045.816e-3530.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477621.196e-2730.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419338.958e-2529.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330811.515e-2428.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt2a1.368e-6143.54synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt2a1.368e-6143.54synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
ENSORLT00000042397.11.127e-5944.28synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
syt1a1.677e-5742.09synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a1.677e-5742.09synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
back to top
BLAST of Synaptotagmin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059797.10.000e+099.42SMESG000059797.1[more]
SMESG000059797.10.000e+099.38SMESG000059797.1[more]
SMESG000025329.12.578e-6948.06SMESG000025329.1[more]
SMESG000055143.16.512e-6747.31SMESG000055143.1[more]
SMESG000055143.17.239e-6747.31SMESG000055143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018598 ID=SMED30018598|Name=Synaptotagmin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1426bp
GCCATATGCCACCTCCATGTTGCCCATAGCATAACAGTCATAATTTTTTT
TTCAAGTGTAAATCGATATATTTATAGAGGAGCACTGACACCATAAAAAA
TGAACACGATGATTCTTATTATTTCTAGTATTCTTGCTGTCAGCATTGCC
GCCATATGCTGGATCATGTACCGACACTTCTATAGAAAGAAAAACGACAA
AATAGTTTTCGATAAACTGGAGAAGAAAGCAGCAGAACTCAATTTAGAAG
AGGTCAGTTTGAAAGCGCTAGAAAAACCTAAAGAAAGTCTTGGGAAATTG
GTTTATGCAATAAAATACTTTCCTGAATCGGAATCTCTCCGAGTGACGGT
GAAATCAGGACACGATCTTATCAAGTTAAACACCGGTGGAACGTCAGATC
CATACGTGAAAGTCTGGCTTAAAGAGAAACCAAAATTAAAATTCGAAACC
AAAATCAAAAGACGGACGAGAAATCCAGTTTTCAATGAAGATTTTACATT
TACGGTATCACCCGAAGAACTTCCAACTCAAACTTTGATATTTTTTTTCT
ATGATTTTGACAGATTTTCCAAACACGAGCAAATCGGCTGTCTGATGCTA
GATTTGGGTGCATTAGATCTTAGCAAACTGATTGAAGATTGGGCTGAACT
CGATCAACCTAGCAGTGATGTCAACACGGAAATACCTTTAGGAGAAATTT
GTATGTCATTAAAACAGGATCCAGACGAAGAGAAATTATTTGTTACAATA
TTAGAAGCAAAAGGTTTAAGGAAACACGACGAAGAGGATTTATACGATCC
TTTTCTGCGTTTATCCTTAGAAGAAGGAGGAGGGATAGTCATCAAAAAGA
AGTTCACAACAATAAAAAAGGCAACTCCCAACCCATATTATAATGAGGAT
TTTGAGTTTCAACTATCCGCCGAGTTATCTACGAAAGTGCAATTGGTAGT
CACTGCATTCAATTGCAGCAATAACAACATCAAGCATAGCATGCCAATCG
GAAATATCGTTTTGGGCCCAACCATTACTGGATCTGGATATAAACATTGG
AAAGAAATTATCAGCAATTCCAAAAGAACAATTGTTCGTTGGCACGGATT
AGTCGAGGTGGTCGACAATAAAAAATGAATGATGTTATCAAAGACTGTAT
GAAACATTTATTTATCCTATGATACCTGTTTGCTGTTATTTATCAAAATA
ACCCAGTCTAGGGCCTATTAAATTATAATTTATTGACAAGTCAAATGGGG
CAGAAATTCCAACCTTTCTTTCGATTGTAGTAAGACGTTTTGAGATATGG
GATTAAAAAGGTGCTAGACCTCTTTGTGGATATCTTTGAAAAAGAACGTT
ATATCAACAGTAAGTCTTTACAGTTTTAGAAACTAAAAATTAAAAGCTTT
TAAGAGTTACTAAATGTTTCGTTCAT
back to top

protein sequence of SMED30018598-orf-1

>SMED30018598-orf-1 ID=SMED30018598-orf-1|Name=SMED30018598-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MNTMILIISSILAVSIAAICWIMYRHFYRKKNDKIVFDKLEKKAAELNLE
EVSLKALEKPKESLGKLVYAIKYFPESESLRVTVKSGHDLIKLNTGGTSD
PYVKVWLKEKPKLKFETKIKRRTRNPVFNEDFTFTVSPEELPTQTLIFFF
YDFDRFSKHEQIGCLMLDLGALDLSKLIEDWAELDQPSSDVNTEIPLGEI
CMSLKQDPDEEKLFVTILEAKGLRKHDEEDLYDPFLRLSLEEGGGIVIKK
KFTTIKKATPNPYYNEDFEFQLSAELSTKVQLVVTAFNCSNNNIKHSMPI
GNIVLGPTITGSGYKHWKEIISNSKRTIVRWHGLVEVVDNKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005544calcium-dependent phospholipid binding
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 30..57
NoneNo IPR availablePANTHERPTHR10024:SF227SYNAPTOTAGMIN 1coord: 5..336
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 5..336
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 197..334
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 59..189
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 95..107
score: 58.86
coord: 146..154
score: 40.05
coord: 122..135
score: 48.17
IPR000008C2 domainSMARTSM00239C2_3ccoord: 212..329
e-value: 2.1E-9
score: 47.3
coord: 79..181
e-value: 1.6E-18
score: 77.5
IPR000008C2 domainPFAMPF00168C2coord: 212..317
e-value: 2.7E-10
score: 40.5
coord: 79..184
e-value: 6.8E-22
score: 77.7
IPR000008C2 domainPROSITEPS50004C2coord: 212..304
score: 13.239
IPR000008C2 domainPROSITEPS50004C2coord: 79..166
score: 16.613
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 52..189
e-value: 5.3E-36
score: 125.6
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 190..336
e-value: 1.2E-29
score: 104.8