ovo

Overview
Nameovo (AFP48372.1)
Smed IDSMED30018592
Uniprot Best hitTranscription factor Ovo-like 2 OS=Mus musculus GN=Ovol2 PE=2 SV=2 (E=7.29055e-34)
Length (bp)1211
Expression

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 129.413 bits (324), Expect = 3.41542e-34
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C++C K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 56 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 177
BLAST of ovo vs. Ensembl Human
Match: OVOL2 (ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:15804])

HSP 1 Score: 128.642 bits (322), Expect = 2.79154e-33
Identity = 59/131 (45.04%), Postives = 81/131 (61.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
+ C +C K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC C + F+QRCSLESH KIHGV Y YK+RR+KLY CE C Y+ + H+ HP S + K+ + K
Sbjct: 119 HSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249
BLAST of ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 127.872 bits (320), Expect = 5.21392e-33
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C++C K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 118 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239
BLAST of ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 119.398 bits (298), Expect = 8.53264e-31
Identity = 50/112 (44.64%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
C +C K FP ++ + RH++ H LC+ C K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H K+HG +Y Y+ERR KL+ CE C +++S T+ H
Sbjct: 72 CPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH 183
BLAST of ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 119.783 bits (299), Expect = 1.02498e-30
Identity = 50/112 (44.64%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
C +C K FP ++ + RH++ H LC+ C K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H K+HG +Y Y+ERR KL+ CE C +++S T+ H
Sbjct: 96 CPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH 207
BLAST of ovo vs. Ensembl Celegans
Match: lin-48 (Putative zinc finger transcription factor; Uncharacterized protein [Source:UniProtKB/TrEMBL;Acc:G5EDU6])

HSP 1 Score: 135.576 bits (340), Expect = 4.119e-36
Identity = 72/173 (41.62%), Postives = 96/173 (55.49%), Query Frame = 1
Query:  658 DPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCI-----------EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+PA + NGG G+ NP S+ + E + C IC K F ++ + RHI+ H +LC +C K F D++DLKRHTR HTGV+PYKC+ C + F+QRCSLESH K+HGV Y YKERR+K++ CE C Y+ +LSHI HP S
Sbjct: 83 NPA-VEFVNGGYGVKNPLAPLISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQRLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLESHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFS 254
BLAST of ovo vs. Ensembl Celegans
Match: Y55F3AM.14 (pep:known chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931 transcript:Y55F3AM.14 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 67.781 bits (164), Expect = 5.02073e-12
Identity = 30/74 (40.54%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQ 1005
C CNK F +Q H+R+H ++CK+C K F +L+ H R HTG +PY CQ C R F Q+ L +H+
Sbjct: 248 CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHE 321

HSP 2 Score: 55.8398 bits (133), Expect = 2.75642e-08
Identity = 38/134 (28.36%), Postives = 58/134 (43.28%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNY--------------LYKERR---NKLYPCEICSYSTSCKATWLSHIIQEH 1134
C +C K F ++ H RSH + C +C K F L+ H R HTG +PYKC+ C + F+Q + H+ H NY LY ++ +K + C+ C + + K H+ Q H
Sbjct: 106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH 239

HSP 3 Score: 52.7582 bits (125), Expect = 3.24704e-07
Identity = 39/141 (27.66%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRS-HGVN-FDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS----TSCKATWLSHIIQEH---PNSLYAKEEALKG 1173
++C C K F K +++ H++ H N +C YC K F + L+ H R HTG +PY C+ C + F+ + +L+SH+ G + Y C+ C + + A +H+ Q+H P+S A + G
Sbjct: 216 FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTG-----------ERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAG 345
BLAST of ovo vs. Ensembl Celegans
Match: pag-3 (Uncharacterized protein; Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 65.855 bits (159), Expect = 1.04555e-11
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPN 1140
++CK C K F + H+ H + C+YC K F D+K+HT +HTG +P+KC C + FSQ +L +H K G K + C++C + K H HP
Sbjct: 154 FECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGF-----------KPFACDVCGRTFQRKVDRRRHRESHHPG 263

HSP 2 Score: 52.7582 bits (125), Expect = 1.83523e-07
Identity = 28/114 (24.56%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
+ C+ C K+F + +++H + H + + CK C K F S L H +H+ +PY C+ C ++F Q+ ++ H Y K + C +C + S + ++H
Sbjct: 126 FHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKH-----------TYIHTGEKPHKCTVCGKAFSQSSNLITH 228
BLAST of ovo vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 62.3882 bits (150), Expect = 4.67067e-11
Identity = 38/143 (26.57%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  589 DIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
D ++++ ++ + + S P F+ G K F + + + K + C +CN+ F + H R+H + C C K F DS L +H R HTG +PY C C KF+Q +L H +K H
Sbjct: 80 DPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCG--------KAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH-MKTH 213
BLAST of ovo vs. Ensembl Celegans
Match: K11D2.4 (pep:known chromosome:WBcel235:I:12526189:12527553:1 gene:WBGene00010770 transcript:K11D2.4d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K11D2.4)

HSP 1 Score: 62.3882 bits (150), Expect = 5.79211e-11
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQR 984
++C C K F ++ +Q+H+R H ++C +C K F L +H R+HTGV+P+ C C R F QR
Sbjct: 29 HECDRCGKRFKARGGLQQHMRIHNNEKAYVCTFCAKSFTQKSHLDQHERIHTGVKPFLCAFCGRSFRQR 97
BLAST of ovo vs. Ensembl Fly
Match: ovo (ovo [Source:FlyBase gene name;Acc:FBgn0003028])

HSP 1 Score: 130.568 bits (327), Expect = 6.01385e-32
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
N+ + C++C K F ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+H V Y YKERR K+Y CE C ++T H+ HP S
Sbjct: 1065 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1189
BLAST of ovo vs. Ensembl Fly
Match: ovo (ovo [Source:FlyBase gene name;Acc:FBgn0003028])

HSP 1 Score: 125.946 bits (315), Expect = 1.35545e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
N+ + C++C K F ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+H V Y YKERR K+Y CE C ++T H+ HP
Sbjct: 871 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 993
BLAST of ovo vs. Ensembl Fly
Match: ovo (ovo [Source:FlyBase gene name;Acc:FBgn0003028])

HSP 1 Score: 125.946 bits (315), Expect = 1.42715e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
N+ + C++C K F ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+H V Y YKERR K+Y CE C ++T H+ HP
Sbjct: 818 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 940
BLAST of ovo vs. Ensembl Fly
Match: ovo (ovo [Source:FlyBase gene name;Acc:FBgn0003028])

HSP 1 Score: 125.176 bits (313), Expect = 3.29577e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
N+ + C++C K F ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+H V Y YKERR K+Y CE C ++T H+ HP
Sbjct: 1194 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 1316
BLAST of ovo vs. Ensembl Fly
Match: ovo (ovo [Source:FlyBase gene name;Acc:FBgn0003028])

HSP 1 Score: 125.176 bits (313), Expect = 3.29577e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
N+ + C++C K F ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+H V Y YKERR K+Y CE C ++T H+ HP
Sbjct: 1194 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 1316
BLAST of ovo vs. Ensembl Zebrafish
Match: ovol1 (ovo-like zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 144.436 bits (363), Expect = 9.71561e-39
Identity = 64/131 (48.85%), Postives = 87/131 (66.41%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
Y C++C KVF ++ + RH++ H LC +C K F D++DLKRH R HTGV+PYKC+ C + F+QRCSLESH KIHGV Y YKERR+KLY CE C ++ S + L H+ EHPNS + + + +
Sbjct: 159 YVCQVCQKVFQFQRMLNRHLKCHSEQKRHLCDFCGKGFNDTFDLKRHVRTHTGVRPYKCELCDKAFTQRCSLESHMKKIHGVTQQYAYKERRSKLYVCEECGHTASTQDALLRHLHTEHPNSAFLRAKGAR 289
BLAST of ovo vs. Ensembl Zebrafish
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 127.872 bits (320), Expect = 4.60625e-33
Identity = 54/127 (42.52%), Postives = 81/127 (63.78%), Query Frame = 1
Query:  766 VNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSL 1146
+ C++C K F + + ++RH++ H + C++C K F D++DLKRH R HTGV+PYKC C + F+QRCSLE+H KIH V Y +KERR+KLY CE C + + + +H+ +HP+ L
Sbjct: 133 ADSGLSCQVCQKTFTTARMLKRHLKCHSETKKYSCEHCGKGFNDTFDLKRHVRTHTGVRPYKCTMCAKAFTQRCSLEAHLKKIHAVTQQYAFKERRDKLYVCEECGLTAQTRESLQNHLQAQHPHRL 259
BLAST of ovo vs. Ensembl Zebrafish
Match: ENSDART00000169455.1 (pep:novel chromosome:GRCz10:10:347797:348108:1 gene:ENSDARG00000100197.1 transcript:ENSDART00000169455.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 5.93691e-18
Identity = 36/85 (42.35%), Postives = 55/85 (64.71%), Query Frame = 1
Query:  931 TGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS----LYAKEEALKG 1173
G++PY+C C + F+QRCSLESH KIHGV Y Y++RR+K++ CE C +++S + H+ Q+HP S Y ++ L+G
Sbjct: 1 AGIRPYRCDLCEKAFTQRCSLESHLRKIHGVQQQYAYRQRRSKIFVCEDCGFTSSRPDQYFLHVRQQHPGSPALRRYYRKHMLEG 85
BLAST of ovo vs. Ensembl Zebrafish
Match: zbtb16a (zinc finger and BTB domain containing 16a [Source:ZFIN;Acc:ZDB-GENE-030131-1989])

HSP 1 Score: 77.411 bits (189), Expect = 7.05254e-15
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
+Y C CN+ FPS ++RH+RSH + + C++C F D LK H R+HTG +PY+C C +KFS + LE+H
Sbjct: 514 SYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETH 589

HSP 2 Score: 56.225 bits (134), Expect = 3.53099e-08
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
C +C K F ++ +Q+H+ H ++C C + F LKRH R HTG P++C+ C F +L+ H+ +IH
Sbjct: 489 CLLCGKRFQTQTALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHK-RIH 565
BLAST of ovo vs. Ensembl Zebrafish
Match: zgc:174315 (zgc:174315 [Source:ZFIN;Acc:ZDB-GENE-080219-29])

HSP 1 Score: 74.3294 bits (181), Expect = 8.74964e-15
Identity = 43/132 (32.58%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHG----------------VALNY-LYKERRNKLYPCEICSYSTSCKATWLSHI 1122
+ CK C K + K + H+R H + C+ C K F ++ +L H R+HTG +PY C C R F+Q +LE H G ALNY + R K +PC+ C S CKA+ ++H+
Sbjct: 110 FTCKECGKSYSQKSNFNVHMRVHTGERPYSCQQCGKSFYNTGNLAVHMRIHTGEKPYSCHQCGRSFNQNGTLEIHMRTHTGEKPFICTECGEGFICQSALNYHMISHSREKPFPCDQCGKSFICKASLMNHM 241
BLAST of ovo vs. Ensembl Xenopus
Match: ovol2 (ovo-like zinc finger 2 [Source:Xenbase;Acc:XB-GENE-854193])

HSP 1 Score: 133.265 bits (334), Expect = 2.64848e-35
Identity = 60/131 (45.80%), Postives = 82/131 (62.60%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
Y C+IC K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH KIHGV Y YK+RR+KL+ CE C Y+ + H+ HP S + K+ K
Sbjct: 131 YSCEICAKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKKTTKK 261
BLAST of ovo vs. Ensembl Xenopus
Match: ovol1 (ovo-like zinc finger 1 [Source:Xenbase;Acc:XB-GENE-5964939])

HSP 1 Score: 129.798 bits (325), Expect = 3.03554e-34
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C +C K F ++ + RH++ H C++C K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV NY YKERR KLY CE C ++ + + L H+ +HP S
Sbjct: 116 FHCALCEKSFSFQRMLNRHMKCHSEVKRHRCEHCGKGFNDTFDLKRHVRTHTGVRPYKCHLCEKAFTQRCSLESHLKKIHGVQQNYAYKERRTKLYVCEDCGFTADSQESQLHHLQDQHPTS 237
BLAST of ovo vs. Ensembl Xenopus
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 126.331 bits (316), Expect = 5.80514e-33
Identity = 54/121 (44.63%), Postives = 79/121 (65.29%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPN 1140
+ C+ C K FP ++ + RH + H + C C K F D++DLKRH R HTG++PYKC C + F+QRCSLESH KIHG+ NY Y++RR+K+Y CE C +++ + H+++ HPN
Sbjct: 119 FSCRACRKCFPLQRMLTRHQKCHSIQKRHHCPCCSKGFNDTFDLKRHMRTHTGIRPYKCPVCDKSFTQRCSLESHLRKIHGILQNYAYRQRRSKIYVCEECGFTSPNADNYTLHVVEVHPN 239
BLAST of ovo vs. Ensembl Xenopus
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 124.02 bits (310), Expect = 3.33113e-32
Identity = 54/121 (44.63%), Postives = 79/121 (65.29%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPN 1140
+ C+ C K FP ++ + RH + H + C C K F D++DLKRH R HTG++PYKC C + F+QRCSLESH KIHG+ NY Y++RR+K+Y CE C +++ + H+++ HPN
Sbjct: 110 FSCRACRKCFPLQRMLTRHQKCHSIQKRHHCPCCSKGFNDTFDLKRHMRTHTGIRPYKCPVCDKSFTQRCSLESHLRKIHGILQNYAYRQRRSKIYVCEECGFTSPNADNYTLHVVEVHPN 230
BLAST of ovo vs. Ensembl Xenopus
Match: ZBTB16 (zinc finger and BTB domain containing 16 [Source:HGNC Symbol;Acc:HGNC:12930])

HSP 1 Score: 77.7962 bits (190), Expect = 2.77177e-15
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
+Y C CN+ FPS ++RH+RSH + + C++C F D LK H R+HTG +PY+C C +KFS + LE+H
Sbjct: 505 SYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETH 580

HSP 2 Score: 58.151 bits (139), Expect = 5.03205e-09
Identity = 27/78 (34.62%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
C +C K F ++ +Q+H+ H ++C C + F LKRH R HTG PY+C+ C F +L+ H+ +IH
Sbjct: 480 CLLCGKRFQTQTALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKGHK-RIH 556

HSP 3 Score: 47.7506 bits (112), Expect = 9.16189e-06
Identity = 22/81 (27.16%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHT--GVQPYKCQSCTRKFSQRCSLESHQ 1005
N + +C +C P ++ H + H + C+ C K F+DS L+ H H+ G + + C+ C +FS+ + E+H+
Sbjct: 388 NLSERCSVCGANLPDNDSVEHHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAAGAKAFVCEQCGAQFSKEDAYEAHR 468
BLAST of ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 132.494 bits (332), Expect = 4.00455e-35
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
G DG + ++ + K C V HN C +C K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH KIHGV Y YK+RR+KLY CE C Y+ + H+ +HP S + K+ + K
Sbjct: 53 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 215
BLAST of ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 132.494 bits (332), Expect = 9.36061e-35
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
G DG + ++ + K C V HN C +C K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH KIHGV Y YK+RR+KLY CE C Y+ + H+ +HP S + K+ + K
Sbjct: 86 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248
BLAST of ovo vs. Ensembl Mouse
Match: Ovol1 (ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:1330290])

HSP 1 Score: 127.102 bits (318), Expect = 6.91779e-33
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C IC K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 118 FTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDS 239
BLAST of ovo vs. Ensembl Mouse
Match: Ovol3 (ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:2388075])

HSP 1 Score: 119.398 bits (298), Expect = 6.4929e-31
Identity = 49/112 (43.75%), Postives = 74/112 (66.07%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
C +C K FP ++ + RH++ H +C YC K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H K+HG +Y Y+ERR KL+ CE C +++S + H
Sbjct: 71 CPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMRTHTGIRPFRCGACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDAYAQH 182
BLAST of ovo vs. Ensembl Mouse
Match: Mynn (myoneurin [Source:MGI Symbol;Acc:MGI:1931415])

HSP 1 Score: 78.9518 bits (193), Expect = 2.03802e-15
Identity = 61/218 (27.98%), Postives = 90/218 (41.28%), Query Frame = 1
Query:  493 ETVSENLWLEKVKVEKYFHLIENLSQSQENIE--------------DIVKTIKVKRRN--------FAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEIC 1080
E+ S L+LE K+ ++E + Q ++ E DIV+T+ VKR+ E+ S + ++L N G+ + F K K M C C KVF ++RH+R H ++C C K F LK H R HTG +PYKC+ C + F+Q+C L H HG K Y C++C
Sbjct: 205 ESASVELFLETSKLSSP--VVEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQSHCALKEHSMSNIASVKSPYELENAGEELDARFSKA------KPM------------CNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHG----------EEKPYKCDVC 392

HSP 2 Score: 60.077 bits (144), Expect = 2.35591e-09
Identity = 31/104 (29.81%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS 1089
Y+C +CN F + +++ H R H ++C C + F + L H R HTG +PY C +C + F+ SL +H K G + + CE+C S
Sbjct: 387 YKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTG-----------ERPFICELCGNS 479

HSP 3 Score: 58.5362 bits (140), Expect = 6.41313e-09
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIR-SHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
Y+C++C+K F K + H R HG + C C F S +LK H R H+G +PY C C ++F+Q +L H + G K Y C+ C + + ++ ++H
Sbjct: 358 YKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTG-----------EKPYVCDTCGKAFAVSSSLITH 461

HSP 4 Score: 54.299 bits (129), Expect = 1.3952e-07
Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
Y C C + F + H+R H ++C C K F S L H+R HTG +P+ C+ C ++ +L+ H+ K+H
Sbjct: 415 YVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGERPFICELCGNSYTDIKNLKKHKTKVH 494
BLAST of ovo vs. UniProt
Match: sp|Q8CIV7|OVOL2_MOUSE (Transcription factor Ovo-like 2 OS=Mus musculus GN=Ovol2 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 7.29055e-34
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
G DG + ++ + K C V HN C +C K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH KIHGV Y YK+RR+KLY CE C Y+ + H+ +HP S + K+ + K
Sbjct: 86 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248
BLAST of ovo vs. UniProt
Match: sp|Q9BRP0|OVOL2_HUMAN (Transcription factor Ovo-like 2 OS=Homo sapiens GN=OVOL2 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.43434e-32
Identity = 59/131 (45.04%), Postives = 81/131 (61.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
+ C +C K F ++ + RH++ H LC +C K F D++DLKRH R HTG++PYKC C + F+QRCSLESH KIHGV Y YK+RR+KLY CE C Y+ + H+ HP S + K+ + K
Sbjct: 119 HSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249
BLAST of ovo vs. UniProt
Match: sp|O14753|OVOL1_HUMAN (Putative transcription factor Ovo-like 1 OS=Homo sapiens GN=OVOL1 PE=2 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 2.67901e-32
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C++C K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 118 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239
BLAST of ovo vs. UniProt
Match: sp|A2VDT4|OVOL1_BOVIN (Putative transcription factor Ovo-like 1 OS=Bos taurus GN=OVOL1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.70758e-32
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C IC K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 118 FTCHICQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239
BLAST of ovo vs. UniProt
Match: sp|Q9WTJ2|OVOL1_MOUSE (Putative transcription factor Ovo-like 1 OS=Mus musculus GN=Ovol1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.38795e-32
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
+ C IC K F ++ + RH++ H LC YC K F D++DLKRH R HTGV+PYKC C + F+QRCSLESH KIHGV Y YKERR KLY CE C ++ + + H+ + HP+S
Sbjct: 118 FTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDS 239
BLAST of ovo vs. TrEMBL
Match: tr|J7FM12|J7FM12_SCHMD (Ovo OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 749.584 bits (1934), Expect = 0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 1
Query:  100 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 1182
MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN
Sbjct: 1 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 361
BLAST of ovo vs. TrEMBL
Match: tr|T1KIW9|T1KIW9_TETUR (Uncharacterized protein OS=Tetranychus urticae PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.02075e-39
Identity = 77/218 (35.32%), Postives = 121/218 (55.50%), Query Frame = 1
Query:  496 TVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRK--QFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
T++ ++ + ++ + + E + NIE + + +K+ R F+ K NGG GI NP + K S+D +C +C + FP + ++RH+++H ++LC +C K F D++DLK+HTR HTGV+PYKC C + F+QRCSLESH +KIHG++ +Y Y+ERR KLY CE C +T+ T H+ HP+S
Sbjct: 136 TITAEMYAQAIESARNYRYSEGRASFAPNIESLAEKLKIPLRMFSS------------IKFVNGGHGIKNPILSYGKLKPAIQPSLDD-------PLKCPVCAQRFPKPRCLKRHLKNHSDVKEYLCTFCGKGFNDTFDLKKHTRTHTGVRPYKCDHCEKSFAQRCSLESHTLKIHGISHSYAYRERRTKLYVCEACGNTTNKPETHYLHLKNNHPDS 334
BLAST of ovo vs. TrEMBL
Match: tr|R7U4Z5|R7U4Z5_CAPTE (Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_147941 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 4.10384e-39
Identity = 71/161 (44.10%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  664 AKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHN-YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
K ++ NGG G+ NP + R+ CI+ N N +QC++C+KVFP ++ + RH++ H +LC +C K F D++DLKRHTR HTGV+PYKC+ C + F+QRCSLESH K+H +++ YKERR KLY CE C ++T H+ HP+S
Sbjct: 123 PKIEVVNGGYGVKNPLLGNREFPREAPSTDLCIQTNDNKFQCRVCSKVFPLQRLLNRHVKCHSDIKRYLCSFCGKGFNDTFDLKRHTRTHTGVRPYKCEMCEKAFTQRCSLESHCRKVHNYQISFAYKERRAKLYVCEECGHTTEDPEKHYLHLKDTHPHS 283
BLAST of ovo vs. TrEMBL
Match: tr|A0A1I8IAF1|A0A1I8IAF1_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 5.69464e-39
Identity = 77/170 (45.29%), Postives = 102/170 (60.00%), Query Frame = 1
Query:  682 NGGDGIVNPF-----RKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQ----EHPNSLYAKEEA 1164
N G+G+ NP R+ +R + N Y+C+IC K F ++ + RH++ H +LC YC K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+HG AL + +KERR KL+ CE+C +ST+C LSH Q E P S A EEA
Sbjct: 142 NNGNGVKNPLAEAECRRASGAQRGGLGAQL---PNGQYECRICQKRFSLQRLLNRHLKCHSTLKRFLCSYCGKGFNDTFDLKRHTRTHTGVRPYKCTECGKAFTQRCSLESHARKLHGRALGFGHKERREKLHVCELCGHSTACARQHLSHAKQHQQAERPASSAATEEA 308
BLAST of ovo vs. TrEMBL
Match: tr|A0A1I8IWG8|A0A1I8IWG8_9PLAT (Uncharacterized protein OS=Macrostomum lignano PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.55291e-39
Identity = 77/170 (45.29%), Postives = 102/170 (60.00%), Query Frame = 1
Query:  682 NGGDGIVNPF-----RKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQ----EHPNSLYAKEEA 1164
N G+G+ NP R+ +R + N Y+C+IC K F ++ + RH++ H +LC YC K F D++DLKRHTR HTGV+PYKC C + F+QRCSLESH K+HG AL + +KERR KL+ CE+C +ST+C LSH Q E P S A EEA
Sbjct: 142 NNGNGVKNPLAEAECRRASGAQRGGLGAQL---PNGQYECRICQKRFSLQRLLNRHLKCHSTLKRFLCSYCGKGFNDTFDLKRHTRTHTGVRPYKCTECGKAFTQRCSLESHARKLHGRALGFGHKERREKLHVCELCGHSTACARQHLSHAKQHQQAERPASSAATEEA 308
The following BLAST results are available for this feature:
BLAST of ovo vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
OVOL13.415420e-3448.36ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL22.791540e-3345.04ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL15.213920e-3348.36ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL38.532640e-3144.64ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL31.024980e-3044.64ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of ovo vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
lin-484.119000e-3641.62Putative zinc finger transcription factor; Unchara... [more]
Y55F3AM.145.020730e-1240.54pep:known chromosome:WBcel235:IV:1058845:1063187:-... [more]
pag-31.045550e-1130.58Uncharacterized protein; Zinc finger protein PAG-3... [more]
che-14.670670e-1126.57Transcription factor che-1 [Source:UniProtKB/Swis... [more]
K11D2.45.792110e-1137.68pep:known chromosome:WBcel235:I:12526189:12527553:... [more]
back to top
BLAST of ovo vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
ovo6.013850e-3246.40ovo [Source:FlyBase gene name;Acc:FBgn0003028][more]
ovo1.355450e-3046.34ovo [Source:FlyBase gene name;Acc:FBgn0003028][more]
ovo1.427150e-3046.34ovo [Source:FlyBase gene name;Acc:FBgn0003028][more]
ovo3.295770e-3046.34ovo [Source:FlyBase gene name;Acc:FBgn0003028][more]
ovo3.295770e-3046.34ovo [Source:FlyBase gene name;Acc:FBgn0003028][more]
back to top
BLAST of ovo vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
ovol19.715610e-3948.85ovo-like zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
OVOL14.606250e-3342.52ovo like transcriptional repressor 1 [Source:HGNC ... [more]
ENSDART00000169455.15.936910e-1842.35pep:novel chromosome:GRCz10:10:347797:348108:1 gen... [more]
zbtb16a7.052540e-1543.42zinc finger and BTB domain containing 16a [Source:... [more]
zgc:1743158.749640e-1532.58zgc:174315 [Source:ZFIN;Acc:ZDB-GENE-080219-29][more]
back to top
BLAST of ovo vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
ovol22.648480e-3545.80ovo-like zinc finger 2 [Source:Xenbase;Acc:XB-GENE... [more]
ovol13.035540e-3448.36ovo-like zinc finger 1 [Source:Xenbase;Acc:XB-GENE... [more]
OVOL35.805140e-3344.63ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL33.331130e-3244.63ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
ZBTB162.771770e-1543.42zinc finger and BTB domain containing 16 [Source:H... [more]
back to top
BLAST of ovo vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Ovol24.004550e-3540.61ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol29.360610e-3540.61ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol16.917790e-3349.18ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol36.492900e-3143.75ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:... [more]
Mynn2.038020e-1527.98myoneurin [Source:MGI Symbol;Acc:MGI:1931415][more]
back to top
BLAST of ovo vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CIV7|OVOL2_MOUSE7.290550e-3440.61Transcription factor Ovo-like 2 OS=Mus musculus GN... [more]
sp|Q9BRP0|OVOL2_HUMAN1.434340e-3245.04Transcription factor Ovo-like 2 OS=Homo sapiens GN... [more]
sp|O14753|OVOL1_HUMAN2.679010e-3248.36Putative transcription factor Ovo-like 1 OS=Homo s... [more]
sp|A2VDT4|OVOL1_BOVIN3.707580e-3249.18Putative transcription factor Ovo-like 1 OS=Bos ta... [more]
sp|Q9WTJ2|OVOL1_MOUSE5.387950e-3249.18Putative transcription factor Ovo-like 1 OS=Mus mu... [more]
back to top
BLAST of ovo vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|J7FM12|J7FM12_SCHMD0.000000e+0100.00Ovo OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|T1KIW9|T1KIW9_TETUR3.020750e-3935.32Uncharacterized protein OS=Tetranychus urticae PE=... [more]
tr|R7U4Z5|R7U4Z5_CAPTE4.103840e-3944.10Uncharacterized protein OS=Capitella teleta GN=CAP... [more]
tr|A0A1I8IAF1|A0A1I8IAF1_9PLAT5.694640e-3945.29Uncharacterized protein OS=Macrostomum lignano PE=... [more]
tr|A0A1I8IWG8|A0A1I8IWG8_9PLAT8.552910e-3945.29Uncharacterized protein OS=Macrostomum lignano PE=... [more]
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000031pigment cup cell
PLANA:0000095trail cell
PLANA:0000036eye
PLANA:0000124visual system
PLANA:0000075optic cup
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2/integrase_DNA-bd
IPR007087Znf_C2H2
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018592 ID=SMED30018592|Name=ovo|organism=Schmidtea mediterranea sexual|type=transcript|length=1211bp
GTCATATTGAACACTGAGACTAGCTATCAATAGCTGACAATTAGACGTAT
AAAATGTTAGGGTACGCCTTTTTGGCCATTATTTCACACCAAAATTTCCA
TGAGTATTTTTCTAATAAGCACTCTACTCGCAAACGATGACGAAATGCCC
ACAGATTTGTCATCGAAAACTGAAAAGATTGAAAACCATGAAAAATCTGA
AAGGAATCTCTGCAAGTATTCCAGTCAGTTTCTTTCCTGTTTTTATTCAC
AGGAAATGTTGACACTACTTATGAGAAAAAATTTCATCAATCAATATTCA
TTTTATTTAAAGATTTTCTCGGGGTTTCCACAATTCGTCGATAACTTCAA
CTTAGTAAATCCAACAGATTTCACCGTCAATTCAAATTCAACAACAATTT
TGCCCTCATTCAACTTCCATAAAACGTCATTGAATATCGAAATGAACACC
TCACTGGCCAATTCTTCAAGCACTGGTAGGTCGTCTCCAACTGAAACTGT
GTCTGAAAATCTTTGGTTAGAAAAAGTAAAGGTGGAAAAATATTTCCATT
TAATTGAAAATCTATCACAATCCCAAGAGAACATTGAAGACATTGTCAAA
ACGATCAAAGTCAAACGAAGAAATTTTGCTGAATATATTAAGAAACTTTA
CCTAAGTGATCCAGCCAAATTTAAGTTGACAAATGGTGGAGATGGAATAG
TAAATCCATTTAGAAAACAATTCAAAGAAGAACGAGATAAATCTATGGAC
AAATTTTGCATCGAAGTTAATCACAATTATCAATGTAAGATATGTAACAA
GGTGTTTCCTTCCAAAAAGCACATGCAACGTCATATACGTTCACACGGTG
TAAATTTTGATTGGTTGTGTAAATATTGTTTTAAACCGTTTATTGATTCC
TACGATTTAAAACGACATACGAGAGTCCATACAGGAGTTCAACCATACAA
ATGTCAAAGTTGCACAAGAAAATTCAGTCAACGATGCTCATTGGAAAGTC
ATCAGGTGAAAATCCATGGAGTAGCACTGAATTATCTATACAAAGAAAGA
AGGAACAAGTTGTATCCGTGTGAAATCTGCAGTTATAGTACGTCTTGTAA
AGCAACTTGGTTGAGTCACATCATTCAGGAGCACCCGAATTCACTTTATG
CAAAAGAAGAAGCACTCAAAGGAAAATACAACTGACTTTGAAAAATATTG
ATTTTTCAAGC
back to top

protein sequence of SMED30018592-orf-1

>SMED30018592-orf-1 ID=SMED30018592-orf-1|Name=SMED30018592-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYS
QEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTI
LPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFH
LIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGI
VNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHG
VNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLES
HQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLY
AKEEALKGKYN*
back to top
Aliases
The feature 'ovo' has the following synonyms
Synonym
ovo
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018592
GenBankAFP48372.1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.681
NoneNo IPR availableSUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 268..316
NoneNo IPR availableSUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 239..277
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.604
IPR015880Zinc finger, C2H2-likeSMARTSM00355c2h2final6coord: 335..358
e-value: 0.73
score: 18.9
coord: 296..319
e-value: 0.18
score: 20.9
coord: 268..290
e-value: 0.5
score: 19.4
coord: 240..262
e-value: 8.6E-6
score: 35.2
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3DG3DSA:3.30.160.60coord: 297..319
e-value: 6.0E-5
score: 22.3
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3DG3DSA:3.30.160.60coord: 270..296
e-value: 1.5E-9
score: 37.3
IPR013087Zinc finger C2H2-type/integrase DNA-binding domainGENE3DG3DSA:3.30.160.60coord: 239..262
e-value: 1.8E-4
score: 20.6
IPR007087Zinc finger, C2H2PFAMPF00096zf-C2H2coord: 240..262
e-value: 4.6E-6
score: 26.7
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 242..262
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 298..319
IPR007087Zinc finger, C2H2PROSITEPS00028ZINC_FINGER_C2H2_1coord: 270..290
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 268..295
score: 12.882
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 240..262
score: 11.344
IPR007087Zinc finger, C2H2PROSITEPS50157ZINC_FINGER_C2H2_2coord: 296..319
score: 10.949