ovo

Overview
Nameovo (AFP48372.1)
Smed IDSMED30018592
Uniprot Best hitTranscription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=2 SV=2 (E=1.4669e-34)
Length (bp)1211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ovo (SMED30018592) t-SNE clustered cells

Violin plots show distribution of expression levels for ovo (SMED30018592) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30018592

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018592SMESG000081129.1 SmedASXL_001747SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018592SMESG000081129.1 dd_Smed_v6_76069_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018592SMESG000081129.1 dd_Smed_v6_48430_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
eyeSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 SMED30018592smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:22884275
Lapan et al., 2012
whole organism juvenile fluorescence in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 JX091074smed_ncbi_20200123PMID:22884275
Lapan et al., 2012
whole organism juvenile fluorescence in situ hybridization evidence
photoreceptor neuronSMED30018592SMESG000081129.1 Smed-ovosmed_ncbi_20200123PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30018592SMESG000081129.1 Smed-ovosmed_ncbi_20200123PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
trail cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
eye cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
eye cellSMED30018592SMESG000081129.1 ovosmed_ncbi_20200123PMID:29357350
de Sousa et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 129.413 bits (324), Expect = 6.749e-35
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C++C K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:   56 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 177          
BLAST of ovo vs. Ensembl Human
Match: OVOL2 (ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:15804])

HSP 1 Score: 128.642 bits (322), Expect = 6.898e-34
Identity = 59/131 (45.04%), Postives = 81/131 (61.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            + C +C K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC  C + F+QRCSLESH  KIHGV   Y YK+RR+KLY CE C Y+   +     H+   HP S + K+ + K
Sbjct:  119 HSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249          
BLAST of ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 127.872 bits (320), Expect = 1.304e-33
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C++C K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:  118 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239          
BLAST of ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 119.398 bits (298), Expect = 2.405e-31
Identity = 50/112 (44.64%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            C +C K FP ++ + RH++ H      LC+ C K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H  K+HG   +Y Y+ERR KL+ CE C +++S   T+  H
Sbjct:   72 CPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH 183          
BLAST of ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 119.783 bits (299), Expect = 3.035e-31
Identity = 50/112 (44.64%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            C +C K FP ++ + RH++ H      LC+ C K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H  K+HG   +Y Y+ERR KL+ CE C +++S   T+  H
Sbjct:   96 CPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH 207          
BLAST of ovo vs. Ensembl Celegans
Match: lin-48 (Putative zinc finger transcription factor [Source:UniProtKB/TrEMBL;Acc:G5EDU6])

HSP 1 Score: 135.576 bits (340), Expect = 8.096e-37
Identity = 72/173 (41.62%), Postives = 96/173 (55.49%), Query Frame = 1
Query:  658 DPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCI-----------EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            +PA  +  NGG G+ NP           S+    +           E   +  C IC K F  ++ + RHI+ H     +LC +C K F D++DLKRHTR HTGV+PYKC+ C + F+QRCSLESH  K+HGV   Y YKERR+K++ CE C Y+      +LSHI   HP S
Sbjct:   83 NPA-VEFVNGGYGVKNPLAPLISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQRLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLESHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFS 254          
BLAST of ovo vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 67.781 bits (164), Expect = 5.244e-12
Identity = 30/74 (40.54%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQ 1005
            C  CNK F     +Q H+R+H     ++CK+C K F    +L+ H R HTG +PY CQ C R F Q+  L +H+
Sbjct:  248 CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHE 321          

HSP 2 Score: 55.8398 bits (133), Expect = 3.003e-8
Identity = 38/134 (28.36%), Postives = 58/134 (43.28%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNY--------------LYKERR---NKLYPCEICSYSTSCKATWLSHIIQEH 1134
            C +C K F     ++ H RSH     + C +C K F     L+ H R HTG +PYKC+ C + F+Q  +   H+   H    NY              LY  ++   +K + C+ C  + + K     H+ Q H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 3 Score: 52.7582 bits (125), Expect = 3.550e-7
Identity = 39/141 (27.66%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRS-HGVN-FDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS----TSCKATWLSHIIQEH---PNSLYAKEEALKG 1173
            ++C  C K F  K +++ H++  H  N    +C YC K F  +  L+ H R HTG +PY C+ C + F+ + +L+SH+    G            + Y C+ C  +    +   A   +H+ Q+H   P+S  A    + G
Sbjct:  216 FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTG-----------ERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAG 345          
BLAST of ovo vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 67.781 bits (164), Expect = 5.244e-12
Identity = 30/74 (40.54%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQ 1005
            C  CNK F     +Q H+R+H     ++CK+C K F    +L+ H R HTG +PY CQ C R F Q+  L +H+
Sbjct:  248 CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHE 321          

HSP 2 Score: 55.8398 bits (133), Expect = 3.003e-8
Identity = 38/134 (28.36%), Postives = 58/134 (43.28%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNY--------------LYKERR---NKLYPCEICSYSTSCKATWLSHIIQEH 1134
            C +C K F     ++ H RSH     + C +C K F     L+ H R HTG +PYKC+ C + F+Q  +   H+   H    NY              LY  ++   +K + C+ C  + + K     H+ Q H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH 239          

HSP 3 Score: 52.7582 bits (125), Expect = 3.550e-7
Identity = 39/141 (27.66%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRS-HGVN-FDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS----TSCKATWLSHIIQEH---PNSLYAKEEALKG 1173
            ++C  C K F  K +++ H++  H  N    +C YC K F  +  L+ H R HTG +PY C+ C + F+ + +L+SH+    G            + Y C+ C  +    +   A   +H+ Q+H   P+S  A    + G
Sbjct:  216 FRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTG-----------ERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAG 345          
BLAST of ovo vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 65.855 bits (159), Expect = 1.017e-11
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPN 1140
            ++CK C K F     +  H+  H     + C+YC K F    D+K+HT +HTG +P+KC  C + FSQ  +L +H  K  G            K + C++C  +   K     H    HP 
Sbjct:  154 FECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGF-----------KPFACDVCGRTFQRKVDRRRHRESHHPG 263          

HSP 2 Score: 52.7582 bits (125), Expect = 1.955e-7
Identity = 28/114 (24.56%), Postives = 53/114 (46.49%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            + C+ C K+F +   +++H + H  +  + CK C K F  S  L  H  +H+  +PY C+ C ++F Q+  ++ H            Y     K + C +C  + S  +  ++H
Sbjct:  126 FHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKH-----------TYIHTGEKPHKCTVCGKAFSQSSNLITH 228          
BLAST of ovo vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 62.3882 bits (150), Expect = 4.900e-11
Identity = 38/143 (26.57%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  589 DIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            D   ++++ ++      + +  S P  F+    G        K F +  + +  K        + C +CN+ F     +  H R+H     + C  C K F DS  L +H R HTG +PY C  C  KF+Q  +L  H +K H
Sbjct:   80 DPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCG--------KAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH-MKTH 213          
BLAST of ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070739)

HSP 1 Score: 130.568 bits (327), Expect = 2.012e-32
Identity = 58/125 (46.40%), Postives = 79/125 (63.20%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            N+ + C++C K F  ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+H V   Y YKERR K+Y CE C ++T        H+   HP S
Sbjct: 1065 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1189          
BLAST of ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0100408)

HSP 1 Score: 125.946 bits (315), Expect = 5.744e-31
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            N+ + C++C K F  ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+H V   Y YKERR K+Y CE C ++T        H+   HP
Sbjct:  871 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 993          
BLAST of ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070740)

HSP 1 Score: 125.946 bits (315), Expect = 6.332e-31
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            N+ + C++C K F  ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+H V   Y YKERR K+Y CE C ++T        H+   HP
Sbjct:  818 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 940          
BLAST of ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070738)

HSP 1 Score: 125.176 bits (313), Expect = 1.240e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            N+ + C++C K F  ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+H V   Y YKERR K+Y CE C ++T        H+   HP
Sbjct: 1194 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 1316          
BLAST of ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0301914)

HSP 1 Score: 125.176 bits (313), Expect = 1.240e-30
Identity = 57/123 (46.34%), Postives = 78/123 (63.41%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            N+ + C++C K F  ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+H V   Y YKERR K+Y CE C ++T        H+   HP
Sbjct: 1194 NNKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHP 1316          
BLAST of ovo vs. Ensembl Zebrafish
Match: ovol1a (ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 144.436 bits (363), Expect = 1.777e-39
Identity = 64/131 (48.85%), Postives = 87/131 (66.41%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            Y C++C KVF  ++ + RH++ H      LC +C K F D++DLKRH R HTGV+PYKC+ C + F+QRCSLESH  KIHGV   Y YKERR+KLY CE C ++ S +   L H+  EHPNS + + +  +
Sbjct:  159 YVCQVCQKVFQFQRMLNRHLKCHSEQKRHLCDFCGKGFNDTFDLKRHVRTHTGVRPYKCELCDKAFTQRCSLESHMKKIHGVTQQYAYKERRSKLYVCEECGHTASTQDALLRHLHTEHPNSAFLRAKGAR 289          
BLAST of ovo vs. Ensembl Zebrafish
Match: ovol1b (ovo-like zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-091204-357])

HSP 1 Score: 127.872 bits (320), Expect = 1.329e-33
Identity = 54/127 (42.52%), Postives = 81/127 (63.78%), Query Frame = 1
Query:  766 VNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSL 1146
             +    C++C K F + + ++RH++ H     + C++C K F D++DLKRH R HTGV+PYKC  C + F+QRCSLE+H  KIH V   Y +KERR+KLY CE C  +   + +  +H+  +HP+ L
Sbjct:  133 ADSGLSCQVCQKTFTTARMLKRHLKCHSETKKYSCEHCGKGFNDTFDLKRHVRTHTGVRPYKCTMCAKAFTQRCSLEAHLKKIHAVTQQYAFKERRDKLYVCEECGLTAQTRESLQNHLQAQHPHRL 259          
BLAST of ovo vs. Ensembl Zebrafish
Match: zgc:171929 (zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19])

HSP 1 Score: 85.8853 bits (211), Expect = 3.916e-20
Identity = 39/90 (43.33%), Postives = 58/90 (64.44%), Query Frame = 1
Query:  916 HTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS----LYAKEEALKG 1173
            HT  HT ++PY+C  C + F+QRCSLESH  KIHGV   Y Y++RR+K++ CE C +++S    +  H+ Q+HP S     Y ++  L+G
Sbjct:    1 HTHTHTSIRPYRCDLCEKAFTQRCSLESHLRKIHGVQQQYAYRQRRSKIFVCEDCGFTSSRPDQYFLHVRQQHPGSPALRRYYRKHMLEG 90          
BLAST of ovo vs. Ensembl Zebrafish
Match: zbtb16a (zinc finger and BTB domain containing 16a [Source:NCBI gene;Acc:323269])

HSP 1 Score: 77.411 bits (189), Expect = 7.742e-15
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            +Y C  CN+ FPS   ++RH+RSH  +  + C++C   F D   LK H R+HTG +PY+C  C +KFS +  LE+H
Sbjct:  514 SYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETH 589          

HSP 2 Score: 56.225 bits (134), Expect = 4.158e-8
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            C +C K F ++  +Q+H+  H     ++C  C + F     LKRH R HTG  P++C+ C   F    +L+ H+ +IH
Sbjct:  489 CLLCGKRFQTQTALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHK-RIH 565          
BLAST of ovo vs. Ensembl Zebrafish
Match: zgc:174315 (zgc:174315 [Source:ZFIN;Acc:ZDB-GENE-080219-29])

HSP 1 Score: 74.3294 bits (181), Expect = 9.481e-15
Identity = 43/132 (32.58%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHG----------------VALNY-LYKERRNKLYPCEICSYSTSCKATWLSHI 1122
            + CK C K +  K +   H+R H     + C+ C K F ++ +L  H R+HTG +PY C  C R F+Q  +LE H     G                 ALNY +    R K +PC+ C  S  CKA+ ++H+
Sbjct:  110 FTCKECGKSYSQKSNFNVHMRVHTGERPYSCQQCGKSFYNTGNLAVHMRIHTGEKPYSCHQCGRSFNQNGTLEIHMRTHTGEKPFICTECGEGFICQSALNYHMISHSREKPFPCDQCGKSFICKASLMNHM 241          
BLAST of ovo vs. Ensembl Xenopus
Match: ovol2 (ovo like zinc finger 2 [Source:NCBI gene;Acc:448478])

HSP 1 Score: 134.42 bits (337), Expect = 4.536e-36
Identity = 60/131 (45.80%), Postives = 82/131 (62.60%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            Y C+IC K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KL+ CE C Y+   +     H+   HP S + K+   K
Sbjct:  114 YSCEICAKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKKTTKK 244          
BLAST of ovo vs. Ensembl Xenopus
Match: ovol2 (ovo like zinc finger 2 [Source:NCBI gene;Acc:448478])

HSP 1 Score: 133.265 bits (334), Expect = 1.646e-35
Identity = 60/131 (45.80%), Postives = 82/131 (62.60%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            Y C+IC K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KL+ CE C Y+   +     H+   HP S + K+   K
Sbjct:  131 YSCEICAKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKKTTKK 261          
BLAST of ovo vs. Ensembl Xenopus
Match: csf3r (colony stimulating factor 3 receptor [Source:Xenbase;Acc:XB-GENE-482176])

HSP 1 Score: 131.339 bits (329), Expect = 4.052e-35
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C +C K F  ++ + RH++ H       C++C K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV  NY YKERR KLY CE C ++   + + L H+  +HP S
Sbjct:   98 FHCALCEKSFSFQRMLNRHMKCHSEVKRHRCEHCGKGFNDTFDLKRHVRTHTGVRPYKCHLCEKAFTQRCSLESHLKKIHGVQQNYAYKERRTKLYVCEDCGFTADSQESQLHHLQDQHPTS 219          
BLAST of ovo vs. Ensembl Xenopus
Match: ENSXETT00000009201.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460547.1:151386:173197:1 gene:ENSXETG00000001160.1 transcript:ENSXETT00000009201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.727e-19
Identity = 43/101 (42.57%), Postives = 60/101 (59.41%), Query Frame = 1
Query:  862 WLCKYCFKPFIDSYDLKRH--TRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKE 1158
            + C+ C K F   + +KRH  T    G+ PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KL+ CE C Y+   +     H+   HP + + K+
Sbjct:   54 YSCEICAKGF---HQVKRHLCTFCGKGIHPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGNAFLKK 151          
BLAST of ovo vs. Ensembl Xenopus
Match: ENSXETT00000009194.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460547.1:151249:173197:1 gene:ENSXETG00000001160.1 transcript:ENSXETT00000009194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 2.805e-18
Identity = 43/101 (42.57%), Postives = 60/101 (59.41%), Query Frame = 1
Query:  862 WLCKYCFKPFIDSYDLKRH--TRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKE 1158
            + C+ C K F   + +KRH  T    G+ PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KL+ CE C Y+   +     H+   HP + + K+
Sbjct:   70 YSCEICAKGF---HQVKRHLCTFCGKGIHPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGNAFLKK 167          
BLAST of ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 132.494 bits (332), Expect = 8.124e-36
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
              G DG +   ++     + K     C   V HN  C +C K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KLY CE C Y+   +     H+  +HP S + K+ + K
Sbjct:   53 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 215          
BLAST of ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 132.494 bits (332), Expect = 2.097e-35
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
              G DG +   ++     + K     C   V HN  C +C K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KLY CE C Y+   +     H+  +HP S + K+ + K
Sbjct:   86 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248          
BLAST of ovo vs. Ensembl Mouse
Match: Ovol1 (ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:1330290])

HSP 1 Score: 127.102 bits (318), Expect = 1.864e-33
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C IC K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:  118 FTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDS 239          
BLAST of ovo vs. Ensembl Mouse
Match: Ovol3 (ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:2388075])

HSP 1 Score: 119.398 bits (298), Expect = 1.917e-31
Identity = 49/112 (43.75%), Postives = 74/112 (66.07%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            C +C K FP ++ + RH++ H      +C YC K F D++DLKRH R HTG++P++C +C + F+QRCSLE+H  K+HG   +Y Y+ERR KL+ CE C +++S    +  H
Sbjct:   71 CPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMRTHTGIRPFRCGACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDAYAQH 182          
BLAST of ovo vs. Ensembl Mouse
Match: Mynn (myoneurin [Source:MGI Symbol;Acc:MGI:1931415])

HSP 1 Score: 78.9518 bits (193), Expect = 2.145e-15
Identity = 61/218 (27.98%), Postives = 90/218 (41.28%), Query Frame = 1
Query:  493 ETVSENLWLEKVKVEKYFHLIENLSQSQENIE--------------DIVKTIKVKRRN--------FAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEIC 1080
            E+ S  L+LE  K+     ++E + Q  ++ E              DIV+T+ VKR+           E+      S  + ++L N G+ +   F K       K M            C  C KVF     ++RH+R H     ++C  C K F     LK H R HTG +PYKC+ C + F+Q+C L  H    HG            K Y C++C
Sbjct:  205 ESASVELFLETSKLSSP--VVEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQSHCALKEHSMSNIASVKSPYELENAGEELDARFSKA------KPM------------CNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHG----------EEKPYKCDVC 392          

HSP 2 Score: 60.077 bits (144), Expect = 2.642e-9
Identity = 31/104 (29.81%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS 1089
            Y+C +CN  F +  +++ H R H     ++C  C + F  +  L  H R HTG +PY C +C + F+   SL +H  K  G            + + CE+C  S
Sbjct:  387 YKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTG-----------ERPFICELCGNS 479          

HSP 3 Score: 58.5362 bits (140), Expect = 7.219e-9
Identity = 34/115 (29.57%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIR-SHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            Y+C++C+K F  K  +  H R  HG    + C  C   F  S +LK H R H+G +PY C  C ++F+Q  +L  H  +  G            K Y C+ C  + +  ++ ++H
Sbjct:  358 YKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTG-----------EKPYVCDTCGKAFAVSSSLITH 461          

HSP 4 Score: 54.299 bits (129), Expect = 1.582e-7
Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            Y C  C + F     +  H+R H     ++C  C K F  S  L  H+R HTG +P+ C+ C   ++   +L+ H+ K+H
Sbjct:  415 YVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGERPFICELCGNSYTDIKNLKKHKTKVH 494          
BLAST of ovo vs. UniProt
Match: sp|Q8CIV7|OVOL2_MOUSE (Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.467e-34
Identity = 67/165 (40.61%), Postives = 94/165 (56.97%), Query Frame = 1
Query:  679 TNGGDGIVNPFRKQFKEERDKSMDKFCI-EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
              G DG +   ++     + K     C   V HN  C +C K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC+ C + F+QRCSLESH  KIHGV   Y YK+RR+KLY CE C Y+   +     H+  +HP S + K+ + K
Sbjct:   86 AQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHN--CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248          
BLAST of ovo vs. UniProt
Match: sp|Q9BRP0|OVOL2_HUMAN (Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.312e-33
Identity = 59/131 (45.04%), Postives = 81/131 (61.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            + C +C K F  ++ + RH++ H      LC +C K F D++DLKRH R HTG++PYKC  C + F+QRCSLESH  KIHGV   Y YK+RR+KLY CE C Y+   +     H+   HP S + K+ + K
Sbjct:  119 HSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249          
BLAST of ovo vs. UniProt
Match: sp|O14753|OVOL1_HUMAN (Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 6.262e-33
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C++C K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:  118 FTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239          
BLAST of ovo vs. UniProt
Match: sp|A2VDT4|OVOL1_BOVIN (Putative transcription factor Ovo-like 1 OS=Bos taurus OX=9913 GN=OVOL1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 8.806e-33
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C IC K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:  118 FTCHICQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDS 239          
BLAST of ovo vs. UniProt
Match: sp|Q9WTJ2|OVOL1_MOUSE (Putative transcription factor Ovo-like 1 OS=Mus musculus OX=10090 GN=Ovol1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.304e-32
Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            + C IC K F  ++ + RH++ H      LC YC K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C  ++  +   + H+ + HP+S
Sbjct:  118 FTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDS 239          
BLAST of ovo vs. TrEMBL
Match: gnl|BL_ORD_ID|20348543 (tr|J7FM12|J7FM12_SCHMD Ovo OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 1
Query:  100 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 1182
            MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN
Sbjct:    1 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 361          
BLAST of ovo vs. TrEMBL
Match: gnl|BL_ORD_ID|24309936 (tr|T1KIW9|T1KIW9_TETUR Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107364344 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 9.632e-40
Identity = 77/218 (35.32%), Postives = 121/218 (55.50%), Query Frame = 1
Query:  496 TVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRK--QFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            T++  ++ + ++  + +   E  +    NIE + + +K+  R F+              K  NGG GI NP     + K     S+D          +C +C + FP  + ++RH+++H    ++LC +C K F D++DLK+HTR HTGV+PYKC  C + F+QRCSLESH +KIHG++ +Y Y+ERR KLY CE C  +T+   T   H+   HP+S
Sbjct:  136 TITAEMYAQAIESARNYRYSEGRASFAPNIESLAEKLKIPLRMFSS------------IKFVNGGHGIKNPILSYGKLKPAIQPSLDD-------PLKCPVCAQRFPKPRCLKRHLKNHSDVKEYLCTFCGKGFNDTFDLKKHTRTHTGVRPYKCDHCEKSFAQRCSLESHTLKIHGISHSYAYRERRTKLYVCEACGNTTNKPETHYLHLKNNHPDS 334          
BLAST of ovo vs. TrEMBL
Match: gnl|BL_ORD_ID|15743349 (tr|R7U4Z5|R7U4Z5_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_147941 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.199e-39
Identity = 71/161 (44.10%), Postives = 102/161 (63.35%), Query Frame = 1
Query:  664 AKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHN-YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
             K ++ NGG G+ NP     +  R+      CI+ N N +QC++C+KVFP ++ + RH++ H     +LC +C K F D++DLKRHTR HTGV+PYKC+ C + F+QRCSLESH  K+H   +++ YKERR KLY CE C ++T        H+   HP+S
Sbjct:  123 PKIEVVNGGYGVKNPLLGNREFPREAPSTDLCIQTNDNKFQCRVCSKVFPLQRLLNRHVKCHSDIKRYLCSFCGKGFNDTFDLKRHTRTHTGVRPYKCEMCEKAFTQRCSLESHCRKVHNYQISFAYKERRAKLYVCEECGHTTEDPEKHYLHLKDTHPHS 283          
BLAST of ovo vs. TrEMBL
Match: gnl|BL_ORD_ID|18232822 (tr|A0A267G266|A0A267G266_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007012g1 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.538e-39
Identity = 77/170 (45.29%), Postives = 102/170 (60.00%), Query Frame = 1
Query:  682 NGGDGIVNPF-----RKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQ----EHPNSLYAKEEA 1164
            N G+G+ NP      R+    +R     +     N  Y+C+IC K F  ++ + RH++ H     +LC YC K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+HG AL + +KERR KL+ CE+C +ST+C    LSH  Q    E P S  A EEA
Sbjct:  142 NNGNGVKNPLAEAECRRASGAQRGGLGAQL---PNGQYECRICQKRFSLQRLLNRHLKCHSTLKRFLCSYCGKGFNDTFDLKRHTRTHTGVRPYKCTECGKAFTQRCSLESHARKLHGRALGFGHKERREKLHVCELCGHSTACARQHLSHAKQHQQAERPASSAATEEA 308          
BLAST of ovo vs. TrEMBL
Match: gnl|BL_ORD_ID|18259233 (tr|A0A1I8IAF1|A0A1I8IAF1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.700e-39
Identity = 77/170 (45.29%), Postives = 102/170 (60.00%), Query Frame = 1
Query:  682 NGGDGIVNPF-----RKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQ----EHPNSLYAKEEA 1164
            N G+G+ NP      R+    +R     +     N  Y+C+IC K F  ++ + RH++ H     +LC YC K F D++DLKRHTR HTGV+PYKC  C + F+QRCSLESH  K+HG AL + +KERR KL+ CE+C +ST+C    LSH  Q    E P S  A EEA
Sbjct:  142 NNGNGVKNPLAEAECRRASGAQRGGLGAQL---PNGQYECRICQKRFSLQRLLNRHLKCHSTLKRFLCSYCGKGFNDTFDLKRHTRTHTGVRPYKCTECGKAFTQRCSLESHARKLHGRALGFGHKERREKLHVCELCGHSTACARQHLSHAKQHQQAERPASSAATEEA 308          
BLAST of ovo vs. Ensembl Cavefish
Match: ovol1a (ovo like transcriptional repressor 1 [Source:NCBI gene;Acc:103038355])

HSP 1 Score: 137.117 bits (344), Expect = 7.793e-37
Identity = 61/124 (49.19%), Postives = 82/124 (66.13%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLY 1149
            + C++C KVF  ++ + RH++ H      LC +C K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV   Y YKERR KLY CE C ++   + + L H+  +HPNS +
Sbjct:  162 FVCQVCQKVFQFQRMLNRHLKCHSEQKRHLCTFCGKGFNDTFDLKRHVRTHTGVRPYKCNLCEKAFTQRCSLESHMKKIHGVTQQYAYKERRTKLYVCEECGHTAPTQDSLLRHLHTQHPNSAF 285          
BLAST of ovo vs. Ensembl Cavefish
Match: ovol1b (putative transcription factor Ovo-like 1 [Source:NCBI gene;Acc:103034073])

HSP 1 Score: 133.265 bits (334), Expect = 9.150e-36
Identity = 59/124 (47.58%), Postives = 87/124 (70.16%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAK 1155
            C +C+K + + + ++RH+RSH  +  + C++C K F DS+DLKRH R HTGV+P+KC +C + F+QRCSLE+H  KIHGV+  Y +KERR+KLY CE C  +   +   L+H+  +HP+S  AK
Sbjct:  130 CPVCHKTYSNTRLVKRHLRSHNDSKRYSCEHCGKGFNDSFDLKRHVRTHTGVRPFKCSACDKAFTQRCSLETHLKKIHGVSQQYAFKERRDKLYVCEECGLTAPTQERLLNHLQAKHPSSGTAK 253          
BLAST of ovo vs. Ensembl Cavefish
Match: zgc:171929 (putative transcription factor ovo-like protein 3 [Source:NCBI gene;Acc:103025094])

HSP 1 Score: 129.798 bits (325), Expect = 1.796e-34
Identity = 57/126 (45.24%), Postives = 88/126 (69.84%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKAT-WLSHIIQEHPNS 1143
            ++++ C +C+K+FP ++ + RH++ H +     C+YC K F D++DLKRH R HTG++PY+C  C + F+QRCSLESH  KIHGV   Y Y++RR+K++ CE C + TSC+   +  H+ Q HP+S
Sbjct:  120 SNDFLCPVCHKIFPLQRMLTRHLKCHSLIKRHPCRYCGKGFNDTFDLKRHMRTHTGIRPYRCDLCEKAFTQRCSLESHLRKIHGVRQQYAYRQRRSKIFVCEDCGF-TSCRPDEYFLHVRQRHPDS 244          
BLAST of ovo vs. Ensembl Cavefish
Match: zbtb16a (zinc finger and BTB domain containing 16a [Source:NCBI gene;Acc:323269])

HSP 1 Score: 77.0258 bits (188), Expect = 7.538e-15
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            +Y C  CN+ FPS   ++RH+RSH  +  + C++C   F D   LK H R+HTG +PY+C  C +KFS +  LE+H
Sbjct:  509 SYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETH 584          

HSP 2 Score: 56.225 bits (134), Expect = 4.041e-8
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            C +C K F ++  +Q+H+  H     ++C  C + F     LKRH R HTG  P++C+ C   F    +L+ H+ +IH
Sbjct:  484 CLLCGKRFQTQTALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKGHK-RIH 560          
BLAST of ovo vs. Ensembl Cavefish
Match: zbtb16b (zinc finger and BTB domain-containing protein 16-A-like [Source:NCBI gene;Acc:103032372])

HSP 1 Score: 75.8702 bits (185), Expect = 1.970e-14
Identity = 32/76 (42.11%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            +Y C  C++ FPS   ++RH+RSH  +  + C++C   F D   LK H R+HTG +PY+C  C +KFS +  LE+H
Sbjct:  502 SYICSECDRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETH 577          

HSP 2 Score: 59.6918 bits (143), Expect = 3.147e-9
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            C +C K F ++K +Q+H+  H     ++C  C + F     LKRH R HTG  PY+C+ C   F    +L+ H+ +IH
Sbjct:  477 CLLCGKRFQTQKALQQHMEVHAGVRSYICSECDRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKGHK-RIH 553          

HSP 3 Score: 50.0618 bits (118), Expect = 3.253e-6
Identity = 26/89 (29.21%), Postives = 45/89 (50.56%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNY 1035
            +H Y+C+ C   F  +  ++ H R H     + C  C K F   + L+ H RVHTG +P++C+ C ++     ++  H ++ H  A  Y
Sbjct:  528 DHPYECEFCGSCFRDESTLKGHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKH-LRTHNGASPY 615          
BLAST of ovo vs. Ensembl Sea Lamprey
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 131.724 bits (330), Expect = 1.428e-37
Identity = 58/120 (48.33%), Postives = 82/120 (68.33%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            C +C K F   + + RH++ H      +C +C K F D++DLKRH R HTGV+PYKC++C++ F+QRCSLESH  KIHGV+  Y YKERR KLY CE C ++ S +  ++ H+ + HP+S
Sbjct:    9 CHLCGKAFHLVRMLNRHMKCHSDIKKHVCNFCGKGFNDTFDLKRHVRTHTGVRPYKCEACSKAFTQRCSLESHLKKIHGVSQRYAYKERRTKLYVCEECGFTASSQEAFVVHLRESHPDS 128          
BLAST of ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003016.1 (pep scaffold:Pmarinus_7.0:GL477497:34499:46557:1 gene:ENSPMAG00000002746.1 transcript:ENSPMAT00000003016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 6.407e-14
Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVA 1026
            +QC+ C + F  ++++Q H R+H  +  + C  C K F+ S DL RHTR HTG +PY CQ C R F  +  L  H ++ H  A
Sbjct:    4 FQCQSCGQTFTQRRYLQIHGRTHTGDRPYACATCGKRFLQSSDLVRHTRTHTGERPYACQHCGRGFRLKHHLRDH-LRTHAGA 85          
BLAST of ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.782e-13
Identity = 43/170 (25.29%), Postives = 74/170 (43.53%), Query Frame = 1
Query:  703 NPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSH-----------------GVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEE 1161
            + F  Q + ER   M +  +     + C+IC++ F     ++ H+RSH                    F   C++C K F     L RH R+HTG +P+ C+ C R F+Q+ +L+ H+ K  G            + Y C  C ++ S +    +HI + H ++    E+
Sbjct:   93 DEFTLQSQLERHMDMHRQELSGARTFTCRICHQEFQRVSTLREHMRSHYKIRASLSTRSYKRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTG-----------ERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQ 251          

HSP 2 Score: 68.1662 bits (165), Expect = 1.517e-12
Identity = 38/127 (29.92%), Postives = 58/127 (45.67%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFD--------WLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEH 1134
            + C +C+K F    H++ H+++H             + C +C K F     L+RH R+HTG +PY CQ C + F+Q  +L+ H  K  G            K Y C+ C  + S K     HI + H
Sbjct: 1655 HTCPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTG-----------EKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 3 Score: 67.3958 bits (163), Expect = 3.072e-12
Identity = 30/75 (40.00%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            Y+C  CNK F    H+++HIRSH     + C  C + F+ S  LK H R H G++ YKC  C   F+   SL+ H
Sbjct:  635 YRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRH 709          

HSP 4 Score: 66.6254 bits (161), Expect = 4.900e-12
Identity = 31/78 (39.74%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQV 1008
            +Y+C  CNK F    H+++H+RSH     + C  C + F+ S  LK H R HTG + YKC  C   F+   SL  H V
Sbjct:  954 SYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMV 1031          

HSP 5 Score: 64.3142 bits (155), Expect = 2.946e-11
Identity = 37/128 (28.91%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKE 1158
            +++C+ C K F     + RHIR H     + C+ C + F     L+ H   HTG +PY+C  C   FSQR +L +H  ++H  A           ++ CE CS       +  +HI + H +  Y  +
Sbjct:  162 SHRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDA----KPGGEQPVFQCEDCSCVFKKLGSLNAHISRMHADESYTSQ 285          

HSP 6 Score: 56.225 bits (134), Expect = 8.433e-9
Identity = 27/80 (33.75%), Postives = 41/80 (51.25%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            + C  CNK F     + RHIR H     + C  CF+ F     L  H + HTG++ + C  C + FS + SL+ H +++H
Sbjct:  456 HMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVH-IRLH 534          

HSP 7 Score: 52.373 bits (124), Expect = 1.692e-7
Identity = 31/104 (29.81%), Postives = 45/104 (43.27%), Query Frame = 1
Query:  868 CKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQE---HPNSLYAKEEALK 1170
            C YC K F  S  LK+H R HTG +P+KC  C R F     L++H     G            K Y C++C  + +   +   H++     HP      EE+ +
Sbjct:  957 CGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTG-----------EKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFR 1049          

HSP 8 Score: 51.6026 bits (122), Expect = 2.521e-7
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  847 GVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHI 1122
            G++  + C YC K F  S  LK+H R HTG +PY+C  C+R F     L++H ++ H V L         K Y C +C  + +   +   H+
Sbjct:  630 GLDRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAH-IRTH-VGL---------KAYKCVMCDGTFTTNGSLKRHM 710          

HSP 9 Score: 48.9062 bits (115), Expect = 1.786e-6
Identity = 27/76 (35.53%), Postives = 38/76 (50.00%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFD-WLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            +QC ICN++F     +Q+H+R H  N     C  C   F   Y+L  H   H+ V    C  C R FS+  SL++H
Sbjct:    2 HQCDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRATHS-VDQTACPDCGRTFSRIASLKAH 76          

HSP 10 Score: 48.1358 bits (113), Expect = 3.631e-6
Identity = 21/63 (33.33%), Postives = 32/63 (50.79%), Query Frame = 1
Query:  814 KKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            K  +  H+++H     + C  C  PF     LK H R+HTG +P+KC  C ++F      +SH
Sbjct: 1186 KSTLDCHVKTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSH 1248          
BLAST of ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 9.317e-13
Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQ 1005
            ++C +C K F    ++  H+R+H   F   C  C K F  S DL+ H R HTG +P+KC  C + FSQ  +L+ HQ
Sbjct:    6 FKCTVCEKAFAQSSYLTIHLRTHTKPFR--CPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQ 79          

HSP 2 Score: 62.3882 bits (150), Expect = 1.533e-12
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQ 1005
            ++C +C K F     +Q H R+H     + C  C K F  S +LK+H R HTG +P+KC  C + F++   L  HQ
Sbjct:   32 FRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKHQ 107          
BLAST of ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008351.1 (pep scaffold:Pmarinus_7.0:GL476515:232573:234573:1 gene:ENSPMAG00000007556.1 transcript:ENSPMAT00000008351.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.256e-12
Identity = 41/122 (33.61%), Postives = 56/122 (45.90%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNY------------------LYKERRNKLYPCEICSYSTS 1095
            C+ C   F  K ++  H R H       C++C K F+ S+DL RH R HTG +P+ CQ C ++FS+   L  H +K HG+   +                  L K    KLY CE C  S S
Sbjct:   12 CQECGTCFKRKWYLVAHERKHSGVRPHACEHCGKRFLASHDLVRHRRTHTGEKPFACQLCGKRFSRSYGLSCH-MKTHGLPKEFQCEQCEESFPHLHMMRVHLRKHTGEKLYTCEYCGISYS 132          
BLAST of ovo vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 71.633 bits (174), Expect = 6.212e-14
Identity = 29/77 (37.66%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQV 1008
            ++C  C+++F    H++ H+RSH     ++C YC K F    +L+ H R+HTG +PY C  C +KFS++ +L +H V
Sbjct:  593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLV 669          
BLAST of ovo vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 60.077 bits (144), Expect = 3.355e-10
Identity = 35/104 (33.65%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS 1089
            Y+CK C + F S++ + +H R+H     + C  C K F  S  LK H R HTG +P +C+ C ++F++  +L  H +K H             K Y C  CS S
Sbjct:  768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKH-IKTH------------QKKYKCSDCSKS 858          

HSP 2 Score: 52.7582 bits (125), Expect = 6.833e-8
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVK 1011
            Y+C ICNK F     ++ HIR+H       CK C K F +S +L +H + H   + YKC  C++ F     L S +VK
Sbjct:  796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ--KKYKCSDCSKSFDDLGKLNSQKVK 871          
BLAST of ovo vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 55.8398 bits (133), Expect = 5.607e-9
Identity = 30/103 (29.13%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQ---------SCTRKFSQRCSLESH-QVKIHGVALNYLYKERR 1053
            N+ C +C K F    +++ H+R+H     ++C  C K F   +D KRH  +HTG + Y C           C +KF++  +L  H + +     +  LY+E R
Sbjct:  568 NFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITPLYEEAR 670          
BLAST of ovo vs. Ensembl Yeast
Match: YGR067C_mRNA (Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p [Source:SGD;Acc:S000003299])

HSP 1 Score: 51.6026 bits (122), Expect = 1.460e-7
Identity = 21/52 (40.38%), Postives = 30/52 (57.69%), Query Frame = 1
Query:  862 WLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIH 1017
            ++C +C KPF  S    RH R H GV+P++CQ C   F +R  L+ H   +H
Sbjct:    8 YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59          
BLAST of ovo vs. Ensembl Yeast
Match: ADR1 (Carbon source-responsive zinc-finger transcription factor; required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization [Source:SGD;Acc:S000002624])

HSP 1 Score: 50.0618 bits (118), Expect = 4.534e-7
Identity = 31/98 (31.63%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  739 KSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRS-HGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVAL 1029
            ++ D   I  N+N   KI  ++    ++++ + R+  G    ++C+ C + F     LKRH R HT  +PY C  C R F++R  L  H  KIH   L
Sbjct:   62 RTPDGKIITTNNNMNSKINKQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159          
BLAST of ovo vs. Ensembl Nematostella
Match: EDO45255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE8])

HSP 1 Score: 115.161 bits (287), Expect = 3.153e-31
Identity = 47/122 (38.52%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            Y+C+IC   F  ++ + RH+++H     + C++C K F D++DLKRH R HTG++P+KC  C + F+QRCSLE+H  ++H V   Y ++ERR+K++ CE C  +      ++ H+ + HP +
Sbjct:    8 YKCEICQSSFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKDSPEFMKHVHELHPET 129          
BLAST of ovo vs. Ensembl Nematostella
Match: EDO45199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE9])

HSP 1 Score: 113.235 bits (282), Expect = 1.299e-30
Identity = 48/121 (39.67%), Postives = 78/121 (64.46%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYS-TSCKATWLSHIIQEHP 1137
            Y+C +CN  F  ++ + RH+++H     + C++C K F D++DLKRH R HTG++P+KC  C + F+QRCSLE+H  ++H V   Y ++ERR+K++ CE C  +    +A +  H+   HP
Sbjct:    1 YKCGLCNASFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKENQAEYRQHVASHHP 121          
BLAST of ovo vs. Ensembl Nematostella
Match: EDO39560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S0])

HSP 1 Score: 79.7221 bits (195), Expect = 4.552e-18
Identity = 47/131 (35.88%), Postives = 70/131 (53.44%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            +QC  C+K F    H++ HIR+H  +  + C+YC K F    +L+ HTR+HTG +P+KCQ C++ F+Q  +L SH  + H  A          K Y C+ CS S SC +    H      N ++A  E+ K
Sbjct:   21 FQCVHCDKSFGKSSHLRDHIRTHTGDRPFRCQYCNKAFTQYSNLRTHTRIHTGEKPFKCQHCSKSFTQAVTLRSH-TRTHTGA----------KPYNCKRCSKSFSCFSGLRGH------NRIHADVESSK 134          
BLAST of ovo vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 75.0998 bits (183), Expect = 3.831e-16
Identity = 39/103 (37.86%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSY 1086
            Y C IC++ F    ++QRHI +H       C YC K F+ S DL+RH R+HTG +PYKC+ C++ F+   +L+SH +   G            K Y C IC++
Sbjct:   60 YTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTG-----------EKPYKCSICNW 151          

HSP 2 Score: 59.3066 bits (142), Expect = 1.051e-10
Identity = 30/75 (40.00%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            Y C+ C+KVF    + QRH+  H     + C+ C K F  +  LK H R+HTG +PY C  C+R F+Q  +L+ H
Sbjct:    4 YTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRH 78          
BLAST of ovo vs. Ensembl Nematostella
Match: EDO45259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG0])

HSP 1 Score: 72.4034 bits (176), Expect = 2.058e-15
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            Y+C  C++ F     +QRH+R+H     + CK C + F  S DLKRH R HTG +PYKC  C++ FSQ  SL++H
Sbjct:   63 YKCTQCSRAFVRSTDLQRHLRNHTGEKPYKCKECSRAFARSTDLKRHMRTHTGEKPYKCWQCSKAFSQSGSLQTH 137          

HSP 2 Score: 67.3958 bits (163), Expect = 1.230e-13
Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  763 EVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            +    ++C  C+K F    +++RH+RSH     + C  C + F+ S DL+RH R HTG +PYKC+ C+R F++   L+ H
Sbjct:   30 KTGRTWKCSFCSKAFQYPCYLRRHMRSHTGESPYKCTQCSRAFVRSTDLQRHLRNHTGEKPYKCKECSRAFARSTDLKRH 109          

HSP 3 Score: 53.9138 bits (128), Expect = 5.028e-9
Identity = 27/81 (33.33%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  769 NHNYQCKICNKVFPSKKHMQRHIR---SHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESH 1002
            + ++ C  C K+F  + ++ RH++          W C +C K F     L+RH R HTG  PYKC  C+R F +   L+ H
Sbjct:    1 DESFTCYKCGKIFAYQSYLDRHVKYVCPDKTGRTWKCSFCSKAFQYPCYLRRHMRSHTGESPYKCTQCSRAFVRSTDLQRH 81          
BLAST of ovo vs. Ensembl Medaka
Match: ovol1a (ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 138.272 bits (347), Expect = 1.757e-38
Identity = 67/139 (48.20%), Postives = 85/139 (61.15%), Query Frame = 1
Query:  754 FCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALK 1170
            FC    H YQ  +C K F  ++ + RHI+ H      LC +C K F D++DLKRH R HTGV+PYKC  C + F+QRCSLESH  KIHGV L Y YKERRNKLY CE C ++   +     H+   HP+S   K +A +
Sbjct:   36 FC---KHTYQHIVCQKTFHYQRMLNRHIKCHNETKRHLCSFCGKGFNDTFDLKRHVRTHTGVRPYKCGLCDKAFTQRCSLESHMKKIHGVTLKYAYKERRNKLYVCEECGHTAGTQDDLALHLHTLHPDSPLLKGKAAR 171          
BLAST of ovo vs. Ensembl Medaka
Match: zgc:171929 (zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19])

HSP 1 Score: 80.1073 bits (196), Expect = 2.393e-18
Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 1
Query:  937 VQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            ++PYKC+ C + F+QRCSLESH  KIHGV   Y Y++RR+K++ CE C Y++S    +  H+ Q HP S
Sbjct:    1 IRPYKCELCEKAFTQRCSLESHMRKIHGVHQQYAYRQRRSKIFVCEDCGYTSSRPDEYFLHVRQRHPGS 69          
BLAST of ovo vs. Ensembl Medaka
Match: ENSORLT00000000229.2 (pep primary_assembly:ASM223467v1:2:4555726:4563366:1 gene:ENSORLG00000000191.2 transcript:ENSORLT00000000229.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 6.404e-15
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHII 1125
            + CK C+K F  K H++RH+RSH     + C+ C K F +  DLKRH R HTG + + C+ C + F +  SL+ H     G            K YPC+ C+ S S K+   +H+ 
Sbjct:   31 FSCKECDKSFSRKSHLKRHMRSHTGEKSFACEECDKSFSEISDLKRHMRTHTGEKSFVCEECGKSFGEIASLKKHMRTHTG-----------EKPYPCKECNTSFSRKSHLKTHMT 135          

HSP 2 Score: 64.3142 bits (155), Expect = 1.230e-11
Identity = 31/84 (36.90%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVAL 1029
            Y CK CN  F  K H++ H+ +H     + CK C   F  +  LK H R HTG +P+ C+ C ++FSQ  +L+ H +  H V++
Sbjct:  115 YPCKECNTSFSRKSHLKTHMTTHTGEKPFTCKECDTSFSQTSSLKTHMRTHTGEKPFSCKECDKRFSQSYNLKKHMI-THKVSI 197          

HSP 3 Score: 63.1586 bits (152), Expect = 3.014e-11
Identity = 34/116 (29.31%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  775 NYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHI 1122
            ++ C+ C+K F     ++RH+R+H     ++C+ C K F +   LK+H R HTG +PY C+ C   FS++  L++H     G            K + C+ C  S S  ++  +H+
Sbjct:   58 SFACEECDKSFSEISDLKRHMRTHTGEKSFVCEECGKSFGEIASLKKHMRTHTGEKPYPCKECNTSFSRKSHLKTHMTTHTG-----------EKPFTCKECDTSFSQTSSLKTHM 162          
BLAST of ovo vs. Ensembl Medaka
Match: ENSORLT00000033746.1 (PR domain zinc finger protein 1 [Source:NCBI gene;Acc:101163928])

HSP 1 Score: 73.9442 bits (180), Expect = 2.530e-14
Identity = 38/95 (40.00%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVK---IHGVALNYLYKERRNK 1059
            C+ C K F    H+QRH   H    +++C  C K F ++ +L+RH RVHTG +PY+CQ C  +F++R +L  H  +    H VAL  L K R++K
Sbjct:  165 CQQCGKAFKRSSHLQRHKHIHTGQRNFVCSICTKRFREAGELQRHQRVHTGEKPYQCQLCHTRFAERNTLRRHTKRKHPYHQVALEMLNK-RKDK 258          

HSP 2 Score: 58.5362 bits (140), Expect = 2.924e-9
Identity = 33/118 (27.97%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            C++C ++F     ++RH  +H      +C+ C K F  S  L+RH  +HTG + + C  CT++F +   L+ HQ ++H             K Y C++C    + + T   H  ++HP
Sbjct:  137 CQLCPRIFFYLSDLERHAITHSQKKPHVCQQCGKAFKRSSHLQRHKHIHTGQRNFVCSICTKRFREAGELQRHQ-RVH----------TGEKPYQCQLCHTRFAERNTLRRHTKRKHP 243          
BLAST of ovo vs. Ensembl Medaka
Match: ENSORLT00000028931.1 (PR domain zinc finger protein 1 [Source:NCBI gene;Acc:101163928])

HSP 1 Score: 73.9442 bits (180), Expect = 3.112e-14
Identity = 38/95 (40.00%), Postives = 56/95 (58.95%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVK---IHGVALNYLYKERRNK 1059
            C+ C K F    H+QRH   H    +++C  C K F ++ +L+RH RVHTG +PY+CQ C  +F++R +L  H  +    H VAL  L K R++K
Sbjct:  187 CQQCGKAFKRSSHLQRHKHIHTGQRNFVCSICTKRFREAGELQRHQRVHTGEKPYQCQLCHTRFAERNTLRRHTKRKHPYHQVALEMLNK-RKDK 280          

HSP 2 Score: 58.5362 bits (140), Expect = 3.027e-9
Identity = 33/118 (27.97%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  784 CKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            C++C ++F     ++RH  +H      +C+ C K F  S  L+RH  +HTG + + C  CT++F +   L+ HQ ++H             K Y C++C    + + T   H  ++HP
Sbjct:  159 CQLCPRIFFYLSDLERHAITHSQKKPHVCQQCGKAFKRSSHLQRHKHIHTGQRNFVCSICTKRFREAGELQRHQ-RVH----------TGEKPYQCQLCHTRFAERNTLRRHTKRKHP 265          
BLAST of ovo vs. Planmine SMEST
Match: SMESG000081129.1 (SMESG000081129.1)

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 1
Query:  100 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 1182
            MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN
Sbjct:    1 MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 361          
BLAST of ovo vs. Planmine SMEST
Match: SMESG000081129.1 (SMESG000081129.1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 346/346 (100.00%), Postives = 346/346 (100.00%), Query Frame = 1
Query:  145 MPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 1182
            MPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN
Sbjct:    1 MPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYSQEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTILPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFHLIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLYAKEEALKGKYN 346          
BLAST of ovo vs. Planmine SMEST
Match: SMESG000006550.1 (SMESG000006550.1)

HSP 1 Score: 149.828 bits (377), Expect = 1.741e-42
Identity = 72/160 (45.00%), Postives = 101/160 (63.12%), Query Frame = 1
Query:  676 LTNGGDGIVNPFRKQFKEERDKSMDKFCIEVNHN----YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNS 1143
            L N G GI+NP       +         +E+++N    ++CKIC+K F   + + RH++SH     +LC YCFK F D++DLKRHTR HTG++PYKC+ C + F+QRCSLESH  K+H + L Y +KERR KLY CE+C ++T       SH+  +HPNS
Sbjct:   78 LINNGTGIINPLL-LLNPKYSNGKYNTSLELSNNNIKEFRCKICDKTFFGARLLNRHLKSHSSLRRYLCNYCFKGFNDTFDLKRHTRTHTGIRPYKCKQCPKAFTQRCSLESHLKKVHNITLPYGFKERREKLYICELCGFNTPNIDACCSHMKDQHPNS 236          
BLAST of ovo vs. Planmine SMEST
Match: SMESG000016051.1 (SMESG000016051.1)

HSP 1 Score: 132.109 bits (331), Expect = 6.743e-36
Identity = 71/172 (41.28%), Postives = 96/172 (55.81%), Query Frame = 1
Query:  649 YLSDPAKFKLTNGGDGIVNPFRKQ---------FKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 1137
            ++S P+  +  N G GI NP   +          K + D+  D          QC  C K F + +   RHI+SH     +LCKYC K F D++DLKRHTR HTGV+PY CQ C + F+QRCSLESH  K+H + L Y YKERR K++ CE C +S++    +  H+   HP
Sbjct:   67 WISKPS-IEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVL--------QCSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 229          
BLAST of ovo vs. Planmine SMEST
Match: SMESG000000679.1 (SMESG000000679.1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.475e-13
Identity = 33/85 (38.82%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  778 YQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALN 1032
            + C IC + F     +  H+R+H     + C +C K F DS  L +HTRVH+G +PYKC+ C  KFSQ  +L  H +++H  ++N
Sbjct:  373 FSCHICCRTFSQSSSVTTHMRTHSGERPYRCHHCSKAFSDSSTLTKHTRVHSGEKPYKCRICLLKFSQSGNLNRH-MRVHLNSIN 456          

HSP 2 Score: 58.5362 bits (140), Expect = 4.158e-9
Identity = 32/113 (28.32%), Postives = 50/113 (44.25%), Query Frame = 1
Query:  781 QCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSH 1119
            QC +C + +     ++ H+R+H     + C  C K F    +L  H R+H+G +P+ C  C R FSQ  S+ +H     G            + Y C  CS + S  +T   H
Sbjct:  318 QCHLCGRSYARPSTLKIHMRTHSGERPFKCNVCSKTFSQVANLTAHKRIHSGEKPFSCHICCRTFSQSSSVTTHMRTHSG-----------ERPYRCHHCSKAFSDSSTLTKH 419          
The following BLAST results are available for this feature:
BLAST of ovo vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OVOL16.749e-3548.36ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL26.898e-3445.04ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL11.304e-3348.36ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL32.405e-3144.64ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL33.035e-3144.64ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of ovo vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-488.096e-3741.62Putative zinc finger transcription factor [Source... [more]
Y55F3AM.145.244e-1240.54pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.145.244e-1240.54pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
pag-31.017e-1130.58Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
che-14.900e-1126.57Transcription factor che-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of ovo vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovo2.012e-3246.40gene:FBgn0003028 transcript:FBtr0070739[more]
ovo5.744e-3146.34gene:FBgn0003028 transcript:FBtr0100408[more]
ovo6.332e-3146.34gene:FBgn0003028 transcript:FBtr0070740[more]
ovo1.240e-3046.34gene:FBgn0003028 transcript:FBtr0070738[more]
ovo1.240e-3046.34gene:FBgn0003028 transcript:FBtr0301914[more]
back to top
BLAST of ovo vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol1a1.777e-3948.85ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ovol1b1.329e-3342.52ovo-like zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1719293.916e-2043.33zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19][more]
zbtb16a7.742e-1543.42zinc finger and BTB domain containing 16a [Source:... [more]
zgc:1743159.481e-1532.58zgc:174315 [Source:ZFIN;Acc:ZDB-GENE-080219-29][more]
back to top
BLAST of ovo vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol24.536e-3645.80ovo like zinc finger 2 [Source:NCBI gene;Acc:44847... [more]
ovol21.646e-3545.80ovo like zinc finger 2 [Source:NCBI gene;Acc:44847... [more]
csf3r4.052e-3548.36colony stimulating factor 3 receptor [Source:Xenba... [more]
ENSXETT00000009201.13.727e-1942.57pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ENSXETT00000009194.12.805e-1842.57pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of ovo vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ovol28.124e-3640.61ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol22.097e-3540.61ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol11.864e-3349.18ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol31.917e-3143.75ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:... [more]
Mynn2.145e-1527.98myoneurin [Source:MGI Symbol;Acc:MGI:1931415][more]
back to top
BLAST of ovo vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CIV7|OVOL2_MOUSE1.467e-3440.61Transcription factor Ovo-like 2 OS=Mus musculus OX... [more]
sp|Q9BRP0|OVOL2_HUMAN3.312e-3345.04Transcription factor Ovo-like 2 OS=Homo sapiens OX... [more]
sp|O14753|OVOL1_HUMAN6.262e-3348.36Putative transcription factor Ovo-like 1 OS=Homo s... [more]
sp|A2VDT4|OVOL1_BOVIN8.806e-3349.18Putative transcription factor Ovo-like 1 OS=Bos ta... [more]
sp|Q9WTJ2|OVOL1_MOUSE1.304e-3249.18Putative transcription factor Ovo-like 1 OS=Mus mu... [more]
back to top
BLAST of ovo vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203485430.000e+0100.00tr|J7FM12|J7FM12_SCHMD Ovo OS=Schmidtea mediterran... [more]
gnl|BL_ORD_ID|243099369.632e-4035.32tr|T1KIW9|T1KIW9_TETUR Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|157433491.199e-3944.10tr|R7U4Z5|R7U4Z5_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|182328221.538e-3945.29tr|A0A267G266|A0A267G266_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182592331.700e-3945.29tr|A0A1I8IAF1|A0A1I8IAF1_9PLAT Uncharacterized pro... [more]
back to top
BLAST of ovo vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol1a7.793e-3749.19ovo like transcriptional repressor 1 [Source:NCBI ... [more]
ovol1b9.150e-3647.58putative transcription factor Ovo-like 1 [Source:N... [more]
zgc:1719291.796e-3445.24putative transcription factor ovo-like protein 3 [... [more]
zbtb16a7.538e-1543.42zinc finger and BTB domain containing 16a [Source:... [more]
zbtb16b1.970e-1442.11zinc finger and BTB domain-containing protein 16-A... [more]
back to top
BLAST of ovo vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OVOL11.428e-3748.33ovo like transcriptional repressor 1 [Source:HGNC ... [more]
ENSPMAT00000003016.16.407e-1439.76pep scaffold:Pmarinus_7.0:GL477497:34499:46557:1 g... [more]
ENSPMAT00000005225.12.782e-1325.29pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
ENSPMAT00000007831.19.317e-1339.47pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000008351.11.256e-1233.61pep scaffold:Pmarinus_7.0:GL476515:232573:234573:1... [more]
back to top
BLAST of ovo vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF16.212e-1437.66Zinc-finger transcription factor; involved in diau... [more]
ZAP13.355e-1033.65Zinc-regulated transcription factor; binds to zinc... [more]
CRZ15.607e-929.13Transcription factor, activates transcription of s... [more]
YGR067C_mRNA1.460e-740.38Putative protein of unknown function; contains a z... [more]
ADR14.534e-731.63Carbon source-responsive zinc-finger transcription... [more]
back to top
BLAST of ovo vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452553.153e-3138.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451991.299e-3039.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395604.552e-1835.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491163.831e-1637.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452592.058e-1545.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ovo vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol1a1.757e-3848.20ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1719292.393e-1849.28zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19][more]
ENSORLT00000000229.26.404e-1535.34pep primary_assembly:ASM223467v1:2:4555726:4563366... [more]
ENSORLT00000033746.12.530e-1440.00PR domain zinc finger protein 1 [Source:NCBI gene;... [more]
ENSORLT00000028931.13.112e-1440.00PR domain zinc finger protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of ovo vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081129.10.000e+0100.00SMESG000081129.1[more]
SMESG000081129.10.000e+0100.00SMESG000081129.1[more]
SMESG000006550.11.741e-4245.00SMESG000006550.1[more]
SMESG000016051.16.743e-3641.28SMESG000016051.1[more]
SMESG000000679.15.475e-1338.82SMESG000000679.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018592
GenBankAFP48372.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018592 ID=SMED30018592|Name=ovo|organism=Schmidtea mediterranea sexual|type=transcript|length=1211bp
GTCATATTGAACACTGAGACTAGCTATCAATAGCTGACAATTAGACGTAT
AAAATGTTAGGGTACGCCTTTTTGGCCATTATTTCACACCAAAATTTCCA
TGAGTATTTTTCTAATAAGCACTCTACTCGCAAACGATGACGAAATGCCC
ACAGATTTGTCATCGAAAACTGAAAAGATTGAAAACCATGAAAAATCTGA
AAGGAATCTCTGCAAGTATTCCAGTCAGTTTCTTTCCTGTTTTTATTCAC
AGGAAATGTTGACACTACTTATGAGAAAAAATTTCATCAATCAATATTCA
TTTTATTTAAAGATTTTCTCGGGGTTTCCACAATTCGTCGATAACTTCAA
CTTAGTAAATCCAACAGATTTCACCGTCAATTCAAATTCAACAACAATTT
TGCCCTCATTCAACTTCCATAAAACGTCATTGAATATCGAAATGAACACC
TCACTGGCCAATTCTTCAAGCACTGGTAGGTCGTCTCCAACTGAAACTGT
GTCTGAAAATCTTTGGTTAGAAAAAGTAAAGGTGGAAAAATATTTCCATT
TAATTGAAAATCTATCACAATCCCAAGAGAACATTGAAGACATTGTCAAA
ACGATCAAAGTCAAACGAAGAAATTTTGCTGAATATATTAAGAAACTTTA
CCTAAGTGATCCAGCCAAATTTAAGTTGACAAATGGTGGAGATGGAATAG
TAAATCCATTTAGAAAACAATTCAAAGAAGAACGAGATAAATCTATGGAC
AAATTTTGCATCGAAGTTAATCACAATTATCAATGTAAGATATGTAACAA
GGTGTTTCCTTCCAAAAAGCACATGCAACGTCATATACGTTCACACGGTG
TAAATTTTGATTGGTTGTGTAAATATTGTTTTAAACCGTTTATTGATTCC
TACGATTTAAAACGACATACGAGAGTCCATACAGGAGTTCAACCATACAA
ATGTCAAAGTTGCACAAGAAAATTCAGTCAACGATGCTCATTGGAAAGTC
ATCAGGTGAAAATCCATGGAGTAGCACTGAATTATCTATACAAAGAAAGA
AGGAACAAGTTGTATCCGTGTGAAATCTGCAGTTATAGTACGTCTTGTAA
AGCAACTTGGTTGAGTCACATCATTCAGGAGCACCCGAATTCACTTTATG
CAAAAGAAGAAGCACTCAAAGGAAAATACAACTGACTTTGAAAAATATTG
ATTTTTCAAGC
back to top

protein sequence of SMED30018592-orf-1

>SMED30018592-orf-1 ID=SMED30018592-orf-1|Name=SMED30018592-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MSIFLISTLLANDDEMPTDLSSKTEKIENHEKSERNLCKYSSQFLSCFYS
QEMLTLLMRKNFINQYSFYLKIFSGFPQFVDNFNLVNPTDFTVNSNSTTI
LPSFNFHKTSLNIEMNTSLANSSSTGRSSPTETVSENLWLEKVKVEKYFH
LIENLSQSQENIEDIVKTIKVKRRNFAEYIKKLYLSDPAKFKLTNGGDGI
VNPFRKQFKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHG
VNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLES
HQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHPNSLY
AKEEALKGKYN*
back to top
Aliases
The feature 'ovo' has the following synonyms
Synonym
ovo
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003103eye cell
PLANA:0000075optic cup
PLANA:0000017photoreceptor neuron
PLANA:0000036eye
PLANA:0000031pigment cup cell
PLANA:0000124visual system
PLANA:0000095trail cell
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000008Stage 8
PLANA:0000006Stage 6
Vocabulary: INTERPRO
TermDefinition
IPR027756Ovo-like
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 255..277
e-value: 0.5
score: 19.4
coord: 283..306
e-value: 0.18
score: 20.9
coord: 322..345
e-value: 0.73
score: 18.9
coord: 227..249
e-value: 8.6E-6
score: 35.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 257..277
e-value: 1.6E-4
score: 21.9
coord: 227..249
e-value: 4.9E-6
score: 26.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 257..277
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 285..306
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 229..249
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 255..282
score: 12.882
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 283..306
score: 10.949
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 227..249
score: 11.344
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 255..277
e-value: 1.5E-6
score: 29.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 278..356
e-value: 1.3E-13
score: 52.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 226..252
e-value: 8.7E-7
score: 30.6
IPR027756Ovo-likePANTHERPTHR10032ZINC FINGER PROTEIN WITH KRAB AND SCAN DOMAINScoord: 112..351
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 226..264
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 255..303