SMED30018579

Overview
NameSMED30018579
Smed IDSMED30018579
Length (bp)2562
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018579 (SMED30018579) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018579 (SMED30018579) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018579 (SMED30018579) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018579 (SMED30018579) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018579

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018579SMESG000017019.1 SmedASXL_013190SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018579SMESG000017019.1 SmedASXL_013190SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30018579SMESG000017019.1 SmedASXL_013192SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30018579SMESG000017019.1 SmedASXL_013189SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018579SMESG000017019.1 SmedASXL_013189SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30018579SMESG000017019.1 dd_Smed_v4_13580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018579SMESG000017019.1 dd_Smed_v4_13580_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018579SMESG000017019.1 dd_Smed_v6_13580_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30018579SMESG000017019.1 Contig27784newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30018579SMESG000017019.1 Contig27784uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30018579SMESG000017019.1 dd_Smed_v4_13580_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018579SMESG000017019.1 SMED_05272_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018579SMESG000017019.1 SMED_05272_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018579SMESG000017019.1 SMED_05273_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30018579SMESG000017019.1 SMED_05273_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018579 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000560:123450..126931 -12485
Homology
BLAST of SMED30018579 vs. Ensembl Human
Match: CDT1 (chromatin licensing and DNA replication factor 1 [Source:HGNC Symbol;Acc:HGNC:24576])

HSP 1 Score: 60.077 bits (144), Expect = 1.340e-8
Identity = 78/358 (21.79%), Postives = 152/358 (42.46%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQH-VPS-KNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKP------TEFDSSKVSPLKTGD-----------------NHRLGSLSQSLIDKVRMNKANRSV--ITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   +VL E F+ ++ ++    NR +  T   ++  V+ +   R+F EC +G+I  VYP +Y  R +  VP+ K+G R S  ++ I            P L +S  L        +R Q F +  V+ V   ++ F+ + S   V   ++  R   W+  FN++ +V  +EP  +PQ    ++L  A+   +  +    P      ++      +P   G                     L  +SQ L++++R  +A + +  +T  P   +R     +LPE+A ++ + F + + KP   +  + + C  +                +  C  +M  G   ++L +L +++P W+
Sbjct:  186 LPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMR-RRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLL--------QRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTR---WHPRFNVD-EVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVF-VSERKP---ALSMEVACARM----------------VGSCCTIMSPGEMEKHLLLLSELLPDWL 510          
BLAST of SMED30018579 vs. Ensembl Zebrafish
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:ZFIN;Acc:ZDB-GENE-070111-1])

HSP 1 Score: 81.6481 bits (200), Expect = 1.780e-15
Identity = 105/399 (26.32%), Postives = 180/399 (45.11%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYD--NRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQH--VPSKNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENAR--------LTFSVMKKN--------------NKPTEFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV------KDLNWAVPRLTIGTPDLSLDEVLLRLNANVAKQQ 2469
            LP   K+L E F+ LE ++    NR +  T T ++  V+ +   R F E  LG+I AVYP AY+ R +   +      + S+ ++ +          +RP L +S  L        +R   F +N V+IV   ++ F+  LN  I+  +      +   W+  F+++ +V  V+P  +PQ  Q ++L +A+        L    M+K                +P     S V+P +T     L  +SQSL++++R  +A +  +V+T  P    R  M S+LPE+A I+ N F + + KP   + ++ L C        NR+   I  Y   R     D     ++L +L ++ P W+      KDL   + + T    DLS+  VL +LN    +++
Sbjct:  321 LPYQYKLLAEMFRSLETIVAMLFNRSETVTFTKVKQGVQDMMRKR-FEESHLGQIKAVYPSAYTFRQEKNIISFSATAKRSSYQLTVEPVIDEEFKGVRPVLSASRLL--------ERRHIFHQNLVEIVKGHHKTFLASLNPPIVVPDE-----KLTRWHPRFSVD-EVPNVKPSDLPQPPQTEKLTSAQEVLDKARALMTPKMEKALANMALKTAEKACVKEPETTAKSAVTPTETPGA--LKGVSQSLLERIRAKEAQKLHAVMTRNPQQEERLLMMSRLPELARILRNVF-VAEKKP---ALIMELAC--------NRM---IASY---RSPLTSD--EMEKHLRLLAELTPAWLTIHPIRKDLYLKLNKTT----DLSI--VLDKLNQKTKEEE 676          
BLAST of SMED30018579 vs. Ensembl Zebrafish
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:ZFIN;Acc:ZDB-GENE-070111-1])

HSP 1 Score: 55.0694 bits (131), Expect = 2.554e-7
Identity = 52/191 (27.23%), Postives = 92/191 (48.17%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYD--NRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQH--VPSKNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENAR 1935
            LP   K+L E F+ LE ++    NR +  T T ++  V+ +   R F E  LG+I AVYP AY+ R +   +      + S+ ++ +          +RP L +S  L        +R   F +N V+IV   ++ F+  LN  I+  +      +   W+  F+++ +V  V+P  +PQ  Q ++L +A+
Sbjct:  271 LPYQYKLLAEMFRSLETIVAMLFNRSETVTFTKVKQGVQDMMRKR-FEESHLGQIKAVYPSAYTFRQEKNIISFSATAKRSSYQLTVEPVIDEEFKGVRPVLSASRLL--------ERRHIFHQNLVEIVKGHHKTFLASLNPPIVVPDE-----KLTRWHPRFSVD-EVPNVKPSDLPQPPQTEKLTSAQ 446          
BLAST of SMED30018579 vs. Ensembl Xenopus
Match: CDT1 (chromatin licensing and DNA replication factor 1 [Source:NCBI gene;Acc:100379812])

HSP 1 Score: 71.2478 bits (173), Expect = 4.426e-12
Identity = 85/359 (23.68%), Postives = 161/359 (44.85%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDIAI----------RPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDN---------------------HRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   KVL E F+ ++ ++    NR +  T + ++  V+ +   +QF +  +G+I  VYP AY  R + ++P+ K+G++ +  ++ I            RP+L +S+ L        +R Q F  +   IV   ++ F+  LN  ++  ++     +   W+  FN++ +V  V P  +P   Q ++L  A+   S  +    P    +     LKT +N                     + L  +SQSL++++R  +A +  +++T  P    R  M S+LPE+A I+ N F + + KP   +  + + C        NR        +I      M  G   ++L +L +++P W+
Sbjct:  258 LPYKYKVLAEMFRSMDTIVGMLFNRSETITFSKVKQGVQDMM-RKQFEQRNVGQIKTVYPTAYKYRQEKNIPTFKDGVKKTDYQLTIDPLIDEGDKLNGRPHLSASSLL--------QRRQLFHRSLTSIVKQHHKVFLASLNPPMVVPDD-----KLTRWHPRFNVD-EVPDVMPSELPLPPQVEKLTTAQEVLSKARGMITPKMEKALANLALKTAENAGEPKNVSSEETKSAATASTSNALKGVSQSLLERIRAKEAQKLQAMMTRRPQQEERLLMMSRLPELARILRNVF-VAEKKP---ALTLEVTC--------NR--------VISSYRSSMSPGEMEKHLALLSEILPDWL 581          
BLAST of SMED30018579 vs. Ensembl Xenopus
Match: CDT1 (chromatin licensing and DNA replication factor 1 [Source:NCBI gene;Acc:100379812])

HSP 1 Score: 71.2478 bits (173), Expect = 4.711e-12
Identity = 85/359 (23.68%), Postives = 161/359 (44.85%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDIAI----------RPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDN---------------------HRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   KVL E F+ ++ ++    NR +  T + ++  V+ +   +QF +  +G+I  VYP AY  R + ++P+ K+G++ +  ++ I            RP+L +S+ L        +R Q F  +   IV   ++ F+  LN  ++  ++     +   W+  FN++ +V  V P  +P   Q ++L  A+   S  +    P    +     LKT +N                     + L  +SQSL++++R  +A +  +++T  P    R  M S+LPE+A I+ N F + + KP   +  + + C        NR        +I      M  G   ++L +L +++P W+
Sbjct:  211 LPYKYKVLAEMFRSMDTIVGMLFNRSETITFSKVKQGVQDMM-RKQFEQRNVGQIKTVYPTAYKYRQEKNIPTFKDGVKKTDYQLTIDPLIDEGDKLNGRPHLSASSLL--------QRRQLFHRSLTSIVKQHHKVFLASLNPPMVVPDD-----KLTRWHPRFNVD-EVPDVMPSELPLPPQVEKLTTAQEVLSKARGMITPKMEKALANLALKTAENAGEPKNVSSEETKSAATASTSNALKGVSQSLLERIRAKEAQKLQAMMTRRPQQEERLLMMSRLPELARILRNVF-VAEKKP---ALTLEVTC--------NR--------VISSYRSSMSPGEMEKHLALLSEILPDWL 534          
BLAST of SMED30018579 vs. UniProt/SwissProt
Match: sp|Q9I9A7|CDT1_XENLA (DNA replication factor Cdt1 OS=Xenopus laevis OX=8355 GN=cdt1 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.867e-13
Identity = 85/359 (23.68%), Postives = 158/359 (44.01%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDI----------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDN---------------------HRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   KVL E F+ ++ ++    NR +  T + ++  V+ +   +QF +  +G+I  VYP AY  R + ++P+ K+G++ +  ++ I          + RP+L +S  L        +R Q F  +   IV   +R F+  LN  ++  ++     +   W+  FN++ +V  V P  +P   Q + L  A+   S  +    P    +     LKT +N                       L  +SQSL++++R  +A +  +++T  P    R  M S+LPE+A I+ N F + + KP   +  + + C                  +I  C   M  G   ++L +L +++P W+
Sbjct:  258 LPYKYKVLAEMFRSMDTIVGMLFNRSETITFSKVKQGVQDMM-RKQFEQRNVGQIKTVYPNAYKYRQEKNIPTFKDGVKKTDYQLTIEPLVAEGDMLSGRPHLSASRLL--------ERKQLFHRSLTSIVKQHHRVFLTSLNPPMLVPDD-----KLTRWHPRFNVD-EVLDVTPAELPLPPQVERLTTAQEVLSKARGLITPKMEKALANLALKTAENAGETKNVSTEETKSTATTSTSTALKGVSQSLLERIRAKEAQKLQAIMTRRPQQEERLLMMSRLPELARILRNVF-VAEKKP---ALTLEVTCSR----------------VIASCRSSMSPGEMEKHLALLSEILPDWL 581          
BLAST of SMED30018579 vs. UniProt/SwissProt
Match: sp|Q9H211|CDT1_HUMAN (DNA replication factor Cdt1 OS=Homo sapiens OX=9606 GN=CDT1 PE=1 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 6.437e-8
Identity = 78/358 (21.79%), Postives = 152/358 (42.46%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQH-VPS-KNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKP------TEFDSSKVSPLKTGD-----------------NHRLGSLSQSLIDKVRMNKANRSV--ITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   +VL E F+ ++ ++    NR +  T   ++  V+ +   R+F EC +G+I  VYP +Y  R +  VP+ K+G R S  ++ I            P L +S  L        +R Q F +  V+ V   ++ F+ + S   V   ++  R   W+  FN++ +V  +EP  +PQ    ++L  A+   +  +    P      ++      +P   G                     L  +SQ L++++R  +A + +  +T  P   +R     +LPE+A ++ + F + + KP   +  + + C  +                +  C  +M  G   ++L +L +++P W+
Sbjct:  186 LPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMR-RRFEECNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLL--------QRRQIFSQKLVEHVKEHHKAFLASLSPAMVVPEDQLTR---WHPRFNVD-EVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVF-VSERKP---ALSMEVACARM----------------VGSCCTIMSPGEMEKHLLLLSELLPDWL 510          
BLAST of SMED30018579 vs. TrEMBL
Match: A0A0X3PKA8 (DNA replication factor Cdt1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=CDT1 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.513e-12
Identity = 49/173 (28.32%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  181 NTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEK--MKIIPNF--NFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLETSVQPI 687
            +T+ +P H   +L+ F + D+VV+ L  +      DKV   ++E+  ++F   I  Q   ++P+SYS+ +D    KVT+       + +IPN   +    +   P K   VF  ++L+ R  H  + L+ +V+  H EFL+   ++S+ ++   +  K+WH  F L+T+V  I
Sbjct:  149 STLPLPSHMHTLLEFFRACDLVVSVLHNRSEVCSFDKVKLAVQELVRSDFTEAIVSQFATVYPDSYSFRYDKQLDKVTKLPTSSYVLILIPNLRSDGTQMARDSPSKGHLVFTGNRLIQRRHHFQKSLIARVRRAHREFLVNKLSISESDLPPDSPIKRWHPAFPLDTAVPTI 321          

HSP 2 Score: 70.4774 bits (171), Expect = 9.653e-9
Identity = 86/384 (22.40%), Postives = 157/384 (40.89%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELE---KLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSN-----------FLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKE------------------LENARLT--FSVMKKNNKPTEFDSSKVSP------LKTGDNHRLGSLSQSLIDKVR-MNKANR-SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVL 2436
            LP+H+  L E F+  +    ++++    C+   ++ AV+ L     FTE  + +   VYP++YS R      K     +++ + I I PNL S              L F    + +R   F ++ +  V  ++REF++NK  I   ++      + W+  F ++  V T+   P+P K    E                     A +   FS   ++ K T + S   SP      L   +   L  +S+SL+ +VR   KA + S++T +P + ++    S LP   T +  E +    KP+  + +   + +S +   S    L+                     +D L  ++P W++ + WA P L +   D  L +V+
Sbjct:  153 LPSHMHTLLEFFRACDLVVSVLHNRSEVCSFDKVKLAVQELVRS-DFTEAIVSQFATVYPDSYSFRYDKQLDKVTKLPTSSYVLILI-PNLRSDGTQMARDSPSKGHLVFTGNRLIQRRHHFQKSLIARVRRAHREFLVNKLSISESDLPPDSPIKRWHPAFPLDTAVPTIPSTPLPPKPDANESKITSASEAVAAFRSRALFREAEICERFSPHPQDAKKT-YKSVVPSPSQASGSLTKSNAVALKGISESLLARVREREKAMQFSLLTRSPISEKQRLALSCLPTTITQVWRELRALSGKPVPLATVATRLAQSSETGLSQEAALY--------------------RIDELISLMPDWLEKVAWAKPHLRLKDMDRPLKDVI 513          
BLAST of SMED30018579 vs. TrEMBL
Match: A0A183TKL1 (DNA replication factor Cdt1 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS17009 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.742e-12
Identity = 49/173 (28.32%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  181 NTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEK--MKIIPNF--NFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLETSVQPI 687
            +T+ +P H   +L+ F + D+VV+ L  +      DKV   ++E+  ++F   I  Q   ++P+SYS+ +D    KVT+       + +IPN   +    +   P K   VF  ++L+ R  H  + L+ +V+  H EFL+   ++S+ ++   +  K+WH  F L+T+V  I
Sbjct:  171 STLPLPSHMHTLLEFFRACDLVVSVLHNRSEVCSFDKVKLAVQELVRSDFTEAIVSQFATVYPDSYSFRYDKQLDKVTKLPTSSYVLILIPNLRSDGTQMARDSPSKGHLVFTGNRLIQRRHHFQKSLIARVRRAHREFLVNKLSISESDLPPDSPIKRWHPAFPLDTAVPTI 343          

HSP 2 Score: 70.4774 bits (171), Expect = 1.021e-8
Identity = 86/384 (22.40%), Postives = 157/384 (40.89%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELE---KLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSN-----------FLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKE------------------LENARLT--FSVMKKNNKPTEFDSSKVSP------LKTGDNHRLGSLSQSLIDKVR-MNKANR-SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVL 2436
            LP+H+  L E F+  +    ++++    C+   ++ AV+ L     FTE  + +   VYP++YS R      K     +++ + I I PNL S              L F    + +R   F ++ +  V  ++REF++NK  I   ++      + W+  F ++  V T+   P+P K    E                     A +   FS   ++ K T + S   SP      L   +   L  +S+SL+ +VR   KA + S++T +P + ++    S LP   T +  E +    KP+  + +   + +S +   S    L+                     +D L  ++P W++ + WA P L +   D  L +V+
Sbjct:  175 LPSHMHTLLEFFRACDLVVSVLHNRSEVCSFDKVKLAVQELVRS-DFTEAIVSQFATVYPDSYSFRYDKQLDKVTKLPTSSYVLILI-PNLRSDGTQMARDSPSKGHLVFTGNRLIQRRHHFQKSLIARVRRAHREFLVNKLSISESDLPPDSPIKRWHPAFPLDTAVPTIPSTPLPPKPDANESKITSASEAVAAFRSRALFREAEICERFSPHPQDAKKT-YKSVVPSPSQASGSLTKSNAVALKGISESLLARVREREKAMQFSLLTRSPISEKQRLALSCLPTTITQVWRELRALSGKPVPLATVATRLAQSSETGLSQEAALY--------------------RIDELISLMPDWLEKVAWAKPHLRLKDMDRPLKDVI 535          
BLAST of SMED30018579 vs. TrEMBL
Match: A0A4Z2D6X1 (DNA replication factor Cdt1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004002 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.249e-12
Identity = 95/420 (22.62%), Postives = 172/420 (40.95%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELE---KLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLE-----------SSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELE-----------NARLTF---------SVMKKNNKPTEF-DSSKVSPLKT---------GDN---------------------HRLGSLSQSLIDKVRMNKANRSVIT----GAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVLLRLNANVAK 2463
            LP +L+VL E F+  +    ++++ +  C+   L+ AV+ +   R F E  +G+ L +YP  Y +R +    K   RS+ N + + + PNL            S  FL F    + +R  +F    + +V+ S+REF++++  I    + E      W+  F +E  V ++ P P+P +  + E +            AR  F         S+ K+   P         SPLK           DN                     + L  +S +L++KVR  +  R ++T    G  +  RR     +LP I T + +  +  + +P+  S +   V  +                        +   + SE+LD+L ++ P W++ LNW+   L +  P+ S+ +V+  +   VAK
Sbjct:  177 LPHNLRVLLELFRSCDTVVSMLHNRKELCSFDKLQPAVQEIV-RRNFEETHVGQFLTIYPMVYFLRYEKQLDKFTHRSNGNYV-LVLSPNLRTDGTQIGHDSPSKGFLPFTGTRLIQRRNRFHSLLLNLVLKSHREFLISELGIDPSKLPEDSSLRRWHPKFPLESAVTSILPSPLPVRPSEFEQKITSAKDAVKAFQARALFREAETCHQISLSKQQLSPIPSPKKPAASPLKASNIIGSTVCADNVMGMQTNSEESTSKRIITSTPNTLKGVSLALLNKVRARENERRLLTELTYGKVSETRRAIYC-RLPLIVTQVWSILRSSNARPVPLSTVAVRVADAHPSG--------------------ISADAISEHLDVLVELAPCWIEKLNWSTVHLRLKDPERSVKDVIDLVKMKVAK 573          
BLAST of SMED30018579 vs. TrEMBL
Match: E7F2R5 (Chromatin licensing and DNA replication factor 1 OS=Danio rerio OX=7955 GN=cdt1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.983e-12
Identity = 105/399 (26.32%), Postives = 180/399 (45.11%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYD--NRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQH--VPSKNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFI--LNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENAR--------LTFSVMKKN--------------NKPTEFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV------KDLNWAVPRLTIGTPDLSLDEVLLRLNANVAKQQ 2469
            LP   K+L E F+ LE ++    NR +  T T ++  V+ +   R F E  LG+I AVYP AY+ R +   +      + S+ ++ +          +RP L +S  L        +R   F +N V+IV   ++ F+  LN  I+  +      +   W+  F+++ +V  V+P  +PQ  Q ++L +A+        L    M+K                +P     S V+P +T     L  +SQSL++++R  +A +  +V+T  P    R  M S+LPE+A I+ N F + + KP   + ++ L C        NR+   I  Y   R     D     ++L +L ++ P W+      KDL   + + T    DLS+  VL +LN    +++
Sbjct:  321 LPYQYKLLAEMFRSLETIVAMLFNRSETVTFTKVKQGVQDMMRKR-FEESHLGQIKAVYPSAYTFRQEKNIISFSATAKRSSYQLTVEPVIDEEFKGVRPVLSASRLL--------ERRHIFHQNLVEIVKGHHKTFLASLNPPIVVPDE-----KLTRWHPRFSVD-EVPNVKPSDLPQPPQTEKLTSAQEVLDKARALMTPKMEKALANMALKTAEKACVKEPETTAKSAVTPTETPGA--LKGVSQSLLERIRAKEAQKLHAVMTRNPQQEERLLMMSRLPELARILRNVF-VAEKKP---ALIMELAC--------NRM---IASY---RSPLTSD--EMEKHLRLLAELTPAWLTIHPIRKDLYLKLNKTT----DLSI--VLDKLNQKTKEEE 676          
BLAST of SMED30018579 vs. TrEMBL
Match: C1L4L6 (DNA replication factor Cdt1 (Double parked homolog) OS=Schistosoma japonicum OX=6182 GN=DUP PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.960e-12
Identity = 95/420 (22.62%), Postives = 171/420 (40.71%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELE---KLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLE-----------SSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELE-----------NARLTF---------SVMKKNNKPTEF-DSSKVSPLKT---------GDN---------------------HRLGSLSQSLIDKVRMNKANRSVIT----GAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVLLRLNANVAK 2463
            LP +L+VL E F+  +    ++++    C+   L+ AV+ +   R F E  +G+ L +YP  Y +R +    K   RS+ N + + + PNL            S  FL F    + +R  +F    + +V+ S+REF++++  I    + E      W+  F +E  V ++ P P+P +  + E +            AR  F         S+ K+   P         SPLK           DN                     + L  +S +L++KVR  +  R ++T    G  +  RR     +LP I T + +  +  + +P+  S +   V  +                        +   + SE+LD+L ++ P W++ LNW+   L +  P+ S+ +V+  +   VAK
Sbjct:  177 LPHNLRVLLELFRSCDTVVSMLHNREELCSFDKLQPAVQEIV-RRNFEETHVGQFLTIYPMVYFLRYEKQLDKFTHRSNGNYV-LVLSPNLRTDGTQIGHDSPSKGFLPFTGTRLIQRRNRFHSLLLNLVLKSHREFLISELGIDPSKLPEDSSLRRWHPKFPLESAVTSILPSPLPVRPSEFEQKITSAKDAVKAFQARALFREAETCHQISLSKQQLSPIPSPKKPAASPLKASNIIGSTVCADNVMGTQTNSEESTSKRIITSTPNTLKGVSLALLNKVRARENERRLLTELTYGKVSETRRAIYC-RLPLIVTQVWSILRSSNARPVPLSTVAVRVADAHPSG--------------------ISADAISEHLDVLVELAPCWIEKLNWSTVHLRLKDPERSVKDVIDLVKMKVAK 573          
BLAST of SMED30018579 vs. Ensembl Cavefish
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:ZFIN;Acc:ZDB-GENE-070111-1])

HSP 1 Score: 67.0106 bits (162), Expect = 6.193e-11
Identity = 79/355 (22.25%), Postives = 156/355 (43.94%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLI--YDNRRKCAT-TYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDN--------------------HRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWV 2367
            LP   K+L E F+ ++ ++    NR +  T   ++  V+ +  H++F E  +G+I  VYP AY+ R + ++P+     + S  ++ +          +RP L ++  L         R + F +N V+IV   ++ F+   + + VE  ++ I    W+  F+++ +V  ++P  +PQ  Q ++L  A+      +    P    +     LKT +                       L  +SQSL++++R  +A +    +T  P    R  M S+LPE+A I+ N F + + KP   + ++ + C        NR        ++      +  G   ++L +L ++ P W+
Sbjct:  310 LPYKYKLLAEMFRSMDTIVGMLFNRSETVTFAKVKQGVQDMM-HKRFEEAHIGQIKTVYPSAYTFRQEKNIPNFSTTAKKSAYQLTVEPVIEEETNGVRPVLSATRLL--------DRRRMFHQNLVEIVKGHHKVFLAGLNPL-VEVPDDKI--TRWHPRFSVD-EVPNIQPGDLPQPPQTEKLTTAQEVLDRARALMTPKMEKALANMALKTAEASCAKEPEPPAKPVETPAQTPSALKGVSQSLLERIRAKEAQKLQVAMTRNPEQEERLGMMSRLPELARILRNVF-VAEKKP---ALIMEIAC--------NR--------VVASYRSSLSSGEMEKHLRLLAELAPEWL 631          
BLAST of SMED30018579 vs. Ensembl Medaka
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:NCBI gene;Acc:101175588])

HSP 1 Score: 67.781 bits (164), Expect = 2.958e-11
Identity = 69/291 (23.71%), Postives = 136/291 (46.74%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSN--HRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIEL-DVKTVEPVPMPQ-----KSQQKELENARLTF----------SVMKKNNKPTEFD------SSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEF 2172
            LP H ++L E F+ ++ ++     +C T       + + +  HR+F +  + +I  V+PEAY+++ + ++P+  +G++    ++ +           RP L +S  L        +R + F +N + +V   ++EF+   S++   +V E  R   W+  FN++L     V P+P P       + Q+ L+ ARL            +  +   +P +        +  V+P+       L  +SQSL+D++R  +A +  +V+T  PA   R  M S+L ++A I+   F
Sbjct:  173 LPLHFRLLAEMFRSMDTVVAMLYNRCETATFAKVQQGVQDMTHRRFEQNHVAQIRTVFPEAYALKQEKNIPTFSSGIKKGEYQLTVEPIIVSDHSQARPVLSASLLL--------ERRRVFHQNLISLVKQHHQEFL--SSLVPPVSVPED-RLTRWHPRFNVDLVPAVPVSPLPEPPHRETLSTAQEVLDRARLLINPKMEKALISAAQQVQPRPAQGSVCAQKAAEPVAPVPGS----LKGVSQSLLDRIRAKEAQKLQAVMTRDPAHEERLLMMSRLVDLARILRGIF 448          

HSP 2 Score: 53.5286 bits (127), Expect = 7.124e-7
Identity = 47/199 (23.62%), Postives = 86/199 (43.22%), Query Frame = 1
Query:  166 SYQSLNTI--------LIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNK-------------SDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLE-TSVQPIEPI 696
            +YQ  +T+        ++P+HF+ + ++F S+D VV  L  +  +    KV + +++M    F+     QI  +FPE+Y+ + +              K IP F+ G K             SD    +++ V     L+ R    ++ L+  V++ H EFL        V  +  T   +WH  FN++     P+ P+
Sbjct:  156 AYQRYHTLAQDIPPGLVLPLHFRLLAEMFRSMDTVVAMLYNRCETATFAKVQQGVQDMTHRRFEQNHVAQIRTVFPEAYALKQE--------------KNIPTFSSGIKKGEYQLTVEPIIVSDH--SQARPVLSASLLLERRRVFHQNLISLVKQHHQEFLSSLVPPVSVPEDRLT---RWHPRFNVDLVPAVPVSPL 335          
BLAST of SMED30018579 vs. Ensembl Medaka
Match: cdt1 (chromatin licensing and DNA replication factor 1 [Source:NCBI gene;Acc:101175588])

HSP 1 Score: 67.0106 bits (162), Expect = 6.098e-11
Identity = 69/291 (23.71%), Postives = 136/291 (46.74%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSN--HRQFTECQLGKILAVYPEAYSVRLQ-HVPS-KNGLRSSTNKIDI---------AIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIEL-DVKTVEPVPMPQ-----KSQQKELENARLTF----------SVMKKNNKPTEFD------SSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANR--SVITGAPATIRRNFMASKLPEIATIIANEF 2172
            LP H ++L E F+ ++ ++     +C T       + + +  HR+F +  + +I  V+PEAY+++ + ++P+  +G++    ++ +           RP L +S  L        +R + F +N + +V   ++EF+   S++   +V E  R   W+  FN++L     V P+P P       + Q+ L+ ARL            +  +   +P +        +  V+P+       L  +SQSL+D++R  +A +  +V+T  PA   R  M S+L ++A I+   F
Sbjct:  223 LPLHFRLLAEMFRSMDTVVAMLYNRCETATFAKVQQGVQDMTHRRFEQNHVAQIRTVFPEAYALKQEKNIPTFSSGIKKGEYQLTVEPIIVSDHSQARPVLSASLLL--------ERRRVFHQNLISLVKQHHQEFL--SSLVPPVSVPED-RLTRWHPRFNVDLVPAVPVSPLPEPPHRETLSTAQEVLDRARLLINPKMEKALISAAQQVQPRPAQGSVCAQKAAEPVAPVPGS----LKGVSQSLLDRIRAKEAQKLQAVMTRDPAHEERLLMMSRLVDLARILRGIF 498          

HSP 2 Score: 54.299 bits (129), Expect = 5.068e-7
Identity = 47/199 (23.62%), Postives = 86/199 (43.22%), Query Frame = 1
Query:  166 SYQSLNTI--------LIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNK-------------SDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLE-TSVQPIEPI 696
            +YQ  +T+        ++P+HF+ + ++F S+D VV  L  +  +    KV + +++M    F+     QI  +FPE+Y+ + +              K IP F+ G K             SD    +++ V     L+ R    ++ L+  V++ H EFL        V  +  T   +WH  FN++     P+ P+
Sbjct:  206 AYQRYHTLAQDIPPGLVLPLHFRLLAEMFRSMDTVVAMLYNRCETATFAKVQQGVQDMTHRRFEQNHVAQIRTVFPEAYALKQE--------------KNIPTFSSGIKKGEYQLTVEPIIVSDH--SQARPVLSASLLLERRRVFHQNLISLVKQHHQEFLSSLVPPVSVPEDRLT---RWHPRFNVDLVPAVPVSPL 385          
BLAST of SMED30018579 vs. Planmine SMEST
Match: SMESG000017019.1 (SMESG000017019.1)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 517/542 (95.39%), Postives = 519/542 (95.76%), Query Frame = 1
Query:  853 GIINKGKMSMTNLSSTNGKENKNQIKWSNNEQISPTXXXXXXXXXXXXXXXXXXXXXXPSNQNAANEXXXXXXXXXXXXXQRKSSKLTVRFSTEDARQSNSDRKAFQSINRIPLRKSAITPSKTTPKRSENPPSVPNSGSKPTRSQPRLSFISNSNGGTPNGKNFLASVAMPNSPMLKTEFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANRSVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVLLRLNANVAKQQPLK 2478
            GIINKGKMSMTNLSSTNGKENKNQIKWSNNEQISPTILKEKLIKKSSLSNENNSNDLKPSNQNAANESSKSK+SPIDKSIQRKSSKLTVRFSTEDARQSNSDRKAFQSINRIPLRKSAITPSKTTPKRSENPPSVPNSGSKPTRSQPRLSFISNSNGGTPNGKNFLASVAMPNSPMLKTEFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKN KPTEFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANRSVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNES                      SFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPD+SLDEVLLRLNANVAKQQPLK
Sbjct:  394 GIINKGKMSMTNLSSTNGKENKNQIKWSNNEQISPTILKEKLIKKSSLSNENNSNDLKPSNQNAANESSKSKESPIDKSIQRKSSKLTVRFSTEDARQSNSDRKAFQSINRIPLRKSAITPSKTTPKRSENPPSVPNSGSKPTRSQPRLSFISNSNGGTPNGKNFLASVAMPNSPMLKTEFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSNHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNKKPTEFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANRSVITGAPATIRRNFMASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNES----------------------SFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDVSLDEVLLRLNANVAKQQPLK 913          

HSP 2 Score: 508.449 bits (1308), Expect = 7.323e-167
Identity = 295/309 (95.47%), Postives = 299/309 (96.76%), Query Frame = 1
Query:   28 MTADQIAKPSLNSLNVQSNIXXXXXXXXXXXXXXXXXXXXXXNNDSSYQSLNTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLETSVQPIEPITLDRNNLKQLSKKSSDKIAKSPLSASNNKRTLEXXXXXXXXXXXXXXXXXXXGIINKGKMSMTNLSSTNGKENKNQIKWSNNEQIS 954
            MTADQIAKPSLNSLNVQSNISKKADKTSSAKSKVKKTC TVSNNDSSYQSLNTILIP HFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSK EMEMFTLNK WHEDFNLETSVQPIEPITLDRNNLKQLSKKSSDKIAKSPLSASNNKRTLENVKSTSKS LSLSNRS SVGIINKGKMSMTNLS+T+GKENKN IK  NN+ +S
Sbjct:    1 MTADQIAKPSLNSLNVQSNISKKADKTSSAKSKVKKTCATVSNNDSSYQSLNTILIPAHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKEEMEMFTLNKIWHEDFNLETSVQPIEPITLDRNNLKQLSKKSSDKIAKSPLSASNNKRTLENVKSTSKSPLSLSNRSSSVGIINKGKMSMTNLSATDGKENKNCIKSLNNQHLS 309          

HSP 3 Score: 53.1434 bits (126), Expect = 9.175e-7
Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = 1
Query:  853 GIINKGKMSMTNLSSTNGKENKNQIKWSNNEQIS 954
            GIINKGKMSMTNLSSTNGKENKN I   NN+ +S
Sbjct:  335 GIINKGKMSMTNLSSTNGKENKNPIISVNNQYLS 368          

HSP 4 Score: 50.447 bits (119), Expect = 6.286e-6
Identity = 61/245 (24.90%), Postives = 102/245 (41.63%), Query Frame = 1
Query: 1411 LPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLS--NHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLE---SSNFLK------FDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQ---KSQQKELENARLTFSVMKKNNKPT--EFDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANRSVITG 2097
            +PAH K + + F  L+ ++    ++  + Y+    E L   N   F     G+IL ++PE+YS      P K    +   K  + I PN      S+F+       F    +  R     E  +  V   + EF+L    +  E +E     + W+ DFN+E  V+ +EP+ + +   K   K+  +      +   NNK T     S+  SPL   +     S S  +I+K +M+  N S   G
Sbjct:   56 IPAHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLK---VTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKEEMEMFTLNKIWHEDFNLETSVQPIEPITLDRNNLKQLSKKSSDKIAKSPLSASNNKRTLENVKSTSKSPLSLSNR----SSSVGIINKGKMSMTNLSATDG 293          
BLAST of SMED30018579 vs. Planmine SMEST
Match: SMESG000017018.1 (SMESG000017018.1)

HSP 1 Score: 186.422 bits (472), Expect = 1.184e-49
Identity = 128/369 (34.69%), Postives = 191/369 (51.76%), Query Frame = 1
Query: 1390 EFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSN-HRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSN-----------FLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQ----KELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDNHR---LGSLSQSLIDKVRMNKANRSVITGAPATIRRNF-MASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVL 2436
            E  LKQKL  HLK L+E F +L+K+++D   K    +L   V  LS  +  F+E  LGKI+ +Y EAY ++ + +PS N  +    KIDI I+PNL + N           FL+FDF  +K+R   FLE C++ V  SYR F+LNK I   E + +++  E W+C+FNI+L V+ V+P PMP + ++    KE+ +    + +MKK N    FD      L+   N       +L QS+IDKV  NK  R            N  + SKL ++  ++  EFK    KPL  S L N+   SL ++E+                       F +YL  L ++VPGW+++L    P+L+I   + S+D+VL
Sbjct:  279 EHSLKQKLSFHLKTLFELFIKLDKVVHDIYCKGELCFLSRIVSALSPVNSPFSESHLGKIITIYHEAYLIKWERLPSGNSTKP-VKKIDITIKPNLRNDNTKSALMSPDKGFLRFDFVQLKERRLIFLERCIEHVNFSYRRFLLNKCIT-PELINDYLLNESWHCEFNIDLHVELVDPTPMPGRPEETDDFKEMTSFSQMYKIMKKKN---VFDCGSKICLRYSTNSANIDCKALPQSMIDKVNDNKMKRLAPDLHVKKGNNNVAVVSKLRDLVALLYTEFKAVQYKPLAFSYLSNIASVSLAVDEN----------------------YFIDYLCYLMKLVPGWIEELGGPPPQLSIDKSNFSIDDVL 620          

HSP 2 Score: 144.05 bits (362), Expect = 1.802e-35
Identity = 79/186 (42.47%), Postives = 119/186 (63.98%), Query Frame = 1
Query:  178 LNTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFL----LINK----NLSKVEMEMFTLNKKWHEDFNLETSVQPIEPITLDRN 711
            +N + +P+HFK +LD+FVSLD  VNKL     S+YI+++ EVLK MN ++F+  IF QIL IFPESY YEF+S P+K+ ++++E++K++PN +FG   D  P+K +K   + Q+  R   +   LL  V+++H+ FL     IN     NL KV+        +WH  F+LE  V+ I+P+ LDRN
Sbjct:   34 MNKMPLPLHFKVLLDLFVSLDFAVNKLISSHQSLYINRITEVLKGMN-HDFNERIFRQILNIFPESYFYEFNSTPIKLAKYFREQLKLVPNLSFGPAVDCSPRKLEKCLSVAQITFRKQEMQARLLKIVKQKHDLFLEKIGYINDKHEGNLIKVQ--------EWHCKFDLENCVEEIQPVFLDRN 210          

HSP 3 Score: 51.6026 bits (122), Expect = 2.624e-6
Identity = 41/168 (24.40%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  202 HFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKII--PNFNFGNKSDFIPKKSQKVFRLD--QLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLETSVQPIEP 693
            H K + ++F+ LD VV+ +  +    ++ ++   L  +N + F     G+I+ I+ E+Y  +++  P   +    +K+ I   PN    N    +    +   R D  QL  R     E  +  V   +  FLL NK ++   +  + LN+ WH +FN++  V+ ++P
Sbjct:  289 HLKTLFELFIKLDKVVHDIYCKGELCFLSRIVSALSPVN-SPFSESHLGKIITIYHEAYLIKWERLPSGNSTKPVKKIDITIKPNLRNDNTKSALMSPDKGFLRFDFVQLKERRLIFLERCIEHVNFSYRRFLL-NKCITPELINDYLLNESWHCEFNIDLHVELVDP 454          
BLAST of SMED30018579 vs. Planmine SMEST
Match: SMESG000017018.1 (SMESG000017018.1)

HSP 1 Score: 186.422 bits (472), Expect = 1.259e-49
Identity = 128/369 (34.69%), Postives = 191/369 (51.76%), Query Frame = 1
Query: 1390 EFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLSN-HRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLESSN-----------FLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHIRTEDWNCDFNIELDVKTVEPVPMPQKSQQ----KELENARLTFSVMKKNNKPTEFDSSKVSPLKTGDNHR---LGSLSQSLIDKVRMNKANRSVITGAPATIRRNF-MASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYMYIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLDEVL 2436
            E  LKQKL  HLK L+E F +L+K+++D   K    +L   V  LS  +  F+E  LGKI+ +Y EAY ++ + +PS N  +    KIDI I+PNL + N           FL+FDF  +K+R   FLE C++ V  SYR F+LNK I   E + +++  E W+C+FNI+L V+ V+P PMP + ++    KE+ +    + +MKK N    FD      L+   N       +L QS+IDKV  NK  R            N  + SKL ++  ++  EFK    KPL  S L N+   SL ++E+                       F +YL  L ++VPGW+++L    P+L+I   + S+D+VL
Sbjct:  278 EHSLKQKLSFHLKTLFELFIKLDKVVHDIYCKGELCFLSRIVSALSPVNSPFSESHLGKIITIYHEAYLIKWERLPSGNSTKP-VKKIDITIKPNLRNDNTKSALMSPDKGFLRFDFVQLKERRLIFLERCIEHVNFSYRRFLLNKCIT-PELINDYLLNESWHCEFNIDLHVELVDPTPMPGRPEETDDFKEMTSFSQMYKIMKKKN---VFDCGSKICLRYSTNSANIDCKALPQSMIDKVNDNKMKRLAPDLHVKKGNNNVAVVSKLRDLVALLYTEFKAVQYKPLAFSYLSNIASVSLAVDEN----------------------YFIDYLCYLMKLVPGWIEELGGPPPQLSIDKSNFSIDDVL 619          

HSP 2 Score: 144.05 bits (362), Expect = 1.740e-35
Identity = 79/186 (42.47%), Postives = 119/186 (63.98%), Query Frame = 1
Query:  178 LNTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDFIPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFL----LINK----NLSKVEMEMFTLNKKWHEDFNLETSVQPIEPITLDRN 711
            +N + +P+HFK +LD+FVSLD  VNKL     S+YI+++ EVLK MN ++F+  IF QIL IFPESY YEF+S P+K+ ++++E++K++PN +FG   D  P+K +K   + Q+  R   +   LL  V+++H+ FL     IN     NL KV+        +WH  F+LE  V+ I+P+ LDRN
Sbjct:   33 MNKMPLPLHFKVLLDLFVSLDFAVNKLISSHQSLYINRITEVLKGMN-HDFNERIFRQILNIFPESYFYEFNSTPIKLAKYFREQLKLVPNLSFGPAVDCSPRKLEKCLSVAQITFRKQEMQARLLKIVKQKHDLFLEKIGYINDKHEGNLIKVQ--------EWHCKFDLENCVEEIQPVFLDRN 209          

HSP 3 Score: 51.6026 bits (122), Expect = 2.556e-6
Identity = 41/168 (24.40%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  202 HFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINNFDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKII--PNFNFGNKSDFIPKKSQKVFRLD--QLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEMFTLNKKWHEDFNLETSVQPIEP 693
            H K + ++F+ LD VV+ +  +    ++ ++   L  +N + F     G+I+ I+ E+Y  +++  P   +    +K+ I   PN    N    +    +   R D  QL  R     E  +  V   +  FLL NK ++   +  + LN+ WH +FN++  V+ ++P
Sbjct:  288 HLKTLFELFIKLDKVVHDIYCKGELCFLSRIVSALSPVN-SPFSESHLGKIITIYHEAYLIKWERLPSGNSTKPVKKIDITIKPNLRNDNTKSALMSPDKGFLRFDFVQLKERRLIFLERCIEHVNFSYRRFLL-NKCITPELINDYLLNESWHCEFNIDLHVELVDP 453          
The following BLAST results are available for this feature:
BLAST of SMED30018579 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CDT11.340e-821.79chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of SMED30018579 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdt11.780e-1526.32chromatin licensing and DNA replication factor 1 [... [more]
cdt12.554e-727.23chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of SMED30018579 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CDT14.426e-1223.68chromatin licensing and DNA replication factor 1 [... [more]
CDT14.711e-1223.68chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of SMED30018579 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9I9A7|CDT1_XENLA4.867e-1323.68DNA replication factor Cdt1 OS=Xenopus laevis OX=8... [more]
sp|Q9H211|CDT1_HUMAN6.437e-821.79DNA replication factor Cdt1 OS=Homo sapiens OX=960... [more]
back to top
BLAST of SMED30018579 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PKA81.513e-1228.32DNA replication factor Cdt1 (Fragment) OS=Schistoc... [more]
A0A183TKL11.742e-1228.32DNA replication factor Cdt1 OS=Schistocephalus sol... [more]
A0A4Z2D6X12.249e-1222.62DNA replication factor Cdt1 OS=Schistosoma japonic... [more]
E7F2R53.983e-1226.32Chromatin licensing and DNA replication factor 1 O... [more]
C1L4L64.960e-1222.62DNA replication factor Cdt1 (Double parked homolog... [more]
back to top
BLAST of SMED30018579 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdt16.193e-1122.25chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of SMED30018579 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018579 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdt12.958e-1123.71chromatin licensing and DNA replication factor 1 [... [more]
cdt16.098e-1123.71chromatin licensing and DNA replication factor 1 [... [more]
back to top
BLAST of SMED30018579 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017019.17.323e-16795.39SMESG000017019.1[more]
SMESG000017018.11.184e-4934.69SMESG000017018.1[more]
SMESG000017018.11.259e-4934.69SMESG000017018.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018579 ID=SMED30018579|Name=SMED30018579|organism=Schmidtea mediterranea sexual|type=transcript|length=2562bp
ATTTGAAATTTATTTTTTAAACAATTGATGACTGCAGATCAAATTGCAAA
ACCATCTTTAAATTCGTTAAATGTTCAATCAAACATTTCTAAGAAAGCTG
ACAAAACTTCTTCTGCAAAATCTAAAGTTAAGAAAACTTGTGTTACTGTC
TCAAACAATGATTCATCTTATCAGTCATTAAACACAATTTTAATCCCAGT
ACATTTTAAAAATATTCTTGATATTTTTGTATCGTTAGATGTTGTTGTTA
ATAAACTTTCAAAACAAAGAACTTCTATATATATTGACAAAGTTGCAGAA
GTGTTAAAAGAAATGAATATTAATAATTTTGATATTGGGATTTTTGGACA
GATTCTAAGAATATTCCCTGAATCCTATTCATATGAATTCGATAGTCCAC
CACTTAAAGTAACTCGTCACTATAAAGAAAAAATGAAAATTATTCCTAAT
TTTAATTTTGGCAACAAATCAGATTTTATTCCAAAGAAATCACAAAAGGT
TTTCCGCTTGGATCAGTTAGTGAGTAGAATGGCACATCTTTATGAATGCT
TATTGGGTAAAGTGCAAGAAAGACATAACGAATTTTTATTGATTAATAAA
AATTTATCAAAAGTAGAGATGGAAATGTTTACTCTAAATAAAAAATGGCA
TGAGGATTTCAATTTGGAAACTTCTGTGCAACCGATTGAGCCAATCACGT
TGGATAGAAATAATTTAAAGCAGCTCTCTAAAAAGTCGTCTGATAAAATT
GCAAAATCGCCACTTTCTGCATCAAATAACAAGAGAACATTGGAAAATGT
AAAATCAACATCTAAATCTTCATTATCTCTTTCAAATCGGTCGCCATCAG
TTGGAATTATTAATAAAGGAAAAATGTCGATGACAAATTTATCATCAACC
AATGGAAAAGAAAATAAAAATCAGATTAAATGGTCAAATAATGAACAAAT
ATCTCCAACGATATTAAAAGAAAAGCTTATCAAAAAATCTTCATTATCTA
ATGAGAATAATTCAAACGATTTAAAGCCGTCCAATCAAAATGCAGCCAAT
GAATCTAGCAAATCAAAAGATTCTCCTATCGATAAATCAATTCAACGCAA
ATCATCGAAATTAACCGTCAGATTCTCAACTGAGGATGCTCGCCAGTCGA
ACAGCGACAGAAAAGCATTCCAATCTATCAATCGAATTCCACTGAGGAAG
TCAGCAATTACTCCATCGAAAACGACTCCAAAACGGTCGGAAAATCCCCC
ATCGGTTCCGAATTCCGGTTCAAAACCCACCCGAAGCCAGCCAAGGCTGT
CATTCATCTCCAATAGCAACGGCGGAACACCGAACGGGAAAAATTTCCTC
GCCAGCGTCGCGATGCCGAACTCACCGATGCTGAAAACCGAATTCGTCCT
CAAGCAGAAATTGCCGGCACATTTGAAAGTCCTCTACGAATCGTTCCAGG
AGCTGGAGAAACTGATCTATGACAACCGGAGGAAATGCGCGACAACCTAT
TTGCGGTCGGCAGTCGAGCACTTGTCCAATCATCGGCAGTTTACCGAATG
CCAGCTCGGTAAAATCCTTGCTGTTTATCCTGAGGCTTACTCAGTCAGAT
TGCAGCACGTCCCCTCCAAGAACGGACTCAGATCATCCACCAATAAAATC
GATATTGCCATCAGACCGAACCTGGAAAGCTCCAATTTCCTCAAATTCGA
TTTCGCCACCATGAAGAAAAGAGGCCAAAAGTTCCTGGAAAATTGCGTGC
AAATTGTCGTTTCTAGTTATCGCGAGTTTATATTGAACAAATCGATAATC
CACGTTGAAAATGTGGAAGAGCACATCAGAACCGAGGATTGGAATTGCGA
TTTCAATATCGAGCTGGACGTGAAAACCGTGGAGCCGGTGCCGATGCCCC
AGAAATCGCAACAGAAGGAACTGGAAAACGCCCGGCTAACATTTAGTGTA
ATGAAAAAGAACAATAAACCGACGGAATTCGATTCCAGCAAAGTTTCTCC
CTTGAAAACCGGTGATAACCATCGATTGGGCTCGCTGTCGCAGTCATTGA
TCGATAAGGTCAGGATGAATAAGGCCAATAGATCAGTGATTACTGGAGCT
CCAGCGACCATAAGGAGGAATTTCATGGCGTCCAAGCTGCCGGAAATCGC
CACAATTATAGCCAATGAATTCAAAATGTTTGACAATAAACCGCTGGAAA
GATCTCAATTAGTGAATCTCGTCTGTAAAAGCTTACAACTGAATGAAAGT
AACAGAATTGAATTATTTATTTATATGTATATTATCCAACGGTGCCATTT
TGTAATGGATTTAGGCTCGTTTTCTGAGTATTTAGACATGCTGGAGCAAG
TCGTGCCGGGCTGGGTGAAGGATTTGAACTGGGCCGTTCCGAGATTGACT
ATAGGAACGCCGGATCTCAGTCTTGATGAGGTGCTACTCAGATTAAATGC
AAATGTTGCCAAGCAGCAGCCTCTCAAGTGATGCCAAATTTTGTAAATAA
ATTGATGTCTTCTTTATTTGATATTTGCTGCATGTTTTATTTATTATTAT
TTTTTTCGGTGA
back to top

protein sequence of SMED30018579-orf-1

>SMED30018579-orf-1 ID=SMED30018579-orf-1|Name=SMED30018579-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=818bp
MTADQIAKPSLNSLNVQSNISKKADKTSSAKSKVKKTCVTVSNNDSSYQS
LNTILIPVHFKNILDIFVSLDVVVNKLSKQRTSIYIDKVAEVLKEMNINN
FDIGIFGQILRIFPESYSYEFDSPPLKVTRHYKEKMKIIPNFNFGNKSDF
IPKKSQKVFRLDQLVSRMAHLYECLLGKVQERHNEFLLINKNLSKVEMEM
FTLNKKWHEDFNLETSVQPIEPITLDRNNLKQLSKKSSDKIAKSPLSASN
NKRTLENVKSTSKSSLSLSNRSPSVGIINKGKMSMTNLSSTNGKENKNQI
KWSNNEQISPTILKEKLIKKSSLSNENNSNDLKPSNQNAANESSKSKDSP
IDKSIQRKSSKLTVRFSTEDARQSNSDRKAFQSINRIPLRKSAITPSKTT
PKRSENPPSVPNSGSKPTRSQPRLSFISNSNGGTPNGKNFLASVAMPNSP
MLKTEFVLKQKLPAHLKVLYESFQELEKLIYDNRRKCATTYLRSAVEHLS
NHRQFTECQLGKILAVYPEAYSVRLQHVPSKNGLRSSTNKIDIAIRPNLE
SSNFLKFDFATMKKRGQKFLENCVQIVVSSYREFILNKSIIHVENVEEHI
RTEDWNCDFNIELDVKTVEPVPMPQKSQQKELENARLTFSVMKKNNKPTE
FDSSKVSPLKTGDNHRLGSLSQSLIDKVRMNKANRSVITGAPATIRRNFM
ASKLPEIATIIANEFKMFDNKPLERSQLVNLVCKSLQLNESNRIELFIYM
YIIQRCHFVMDLGSFSEYLDMLEQVVPGWVKDLNWAVPRLTIGTPDLSLD
EVLLRLNANVAKQQPLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000136whole organism
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036390WH_DNA-bd_sf
IPR014939CDT1_Gemini-bd-like
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0000076DNA replication checkpoint
GO:0000082G1/S transition of mitotic cell cycle
GO:0000083regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0006260DNA replication
GO:0007049cell cycle
GO:0007059chromosome segregation
GO:0030174regulation of DNA-dependent DNA replication initiation
GO:0033262regulation of nuclear cell cycle DNA replication
GO:0051315attachment of mitotic spindle microtubules to kinetochore
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0016604nuclear body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014939CDT1 Geminin-binding domain-likeSMARTSM01075CDT1_2coord: 180..343
e-value: 1.2E-4
score: 23.1
IPR014939CDT1 Geminin-binding domain-likePFAMPF08839CDT1coord: 180..342
e-value: 4.1E-20
score: 72.8
NoneNo IPR availableGENE3DG3DSA:1.10.10.1420coord: 380..525
e-value: 4.0E-6
score: 28.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..63
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..94
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..140
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 95..140
NoneNo IPR availablePANTHERPTHR28637FAMILY NOT NAMEDcoord: 61..269
coord: 347..499
NoneNo IPR availablePANTHERPTHR28637:SF1DNA REPLICATION FACTOR CDT1coord: 61..269
coord: 347..499
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 174..344