gamma-aminobutyric acid receptor alpha-like

Overview
Namegamma-aminobutyric acid receptor alpha-like
Smed IDSMED30018578
Length (bp)254
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018578

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018578SMESG000018336.1 SmedASXL_011827SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018578SMESG000018336.1 dd_Smed_v6_24908_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Match: GABRA2 (gamma-aminobutyric acid type A receptor alpha2 subunit [Source:HGNC Symbol;Acc:HGNC:4076])

HSP 1 Score: 92.4337 bits (228), Expect = 5.981e-25
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Match: GABRA2 (gamma-aminobutyric acid type A receptor alpha2 subunit [Source:HGNC Symbol;Acc:HGNC:4076])

HSP 1 Score: 94.3597 bits (233), Expect = 9.054e-24
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Match: GABRA1 (gamma-aminobutyric acid type A receptor alpha1 subunit [Source:HGNC Symbol;Acc:HGNC:4075])

HSP 1 Score: 89.3521 bits (220), Expect = 1.163e-23
Identity = 38/83 (45.78%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKF G     +L+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  DG ++Y+M
Sbjct:   78 GPVSDHDMEYTIDVFFRQSWKDERLKFKG--PMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Match: GABRA2 (gamma-aminobutyric acid type A receptor alpha2 subunit [Source:HGNC Symbol;Acc:HGNC:4076])

HSP 1 Score: 92.4337 bits (228), Expect = 1.924e-23
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Match: GABRA3 (gamma-aminobutyric acid type A receptor alpha3 subunit [Source:HGNC Symbol;Acc:HGNC:4077])

HSP 1 Score: 93.2041 bits (230), Expect = 1.941e-23
Identity = 40/83 (48.19%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W D+RLKFDG    KIL LN  L   +W PDT+F NG+ S  HN+T PN  +R+ ++G ++Y+M
Sbjct:  103 GPVSDTDMEYTIDVFFRQTWHDERLKFDG--PMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM 183          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Match: lgc-36 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:Q6BET0])

HSP 1 Score: 95.9005 bits (237), Expect = 9.413e-25
Identity = 45/85 (52.94%), Postives = 59/85 (69.41%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFD--GVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            MGP+S++   YSF+CYFRQ+W D RL F+  G+   + L L+  +LD +WKPDTYF NG GSY+H IT  N  VR+  DG I+YS
Sbjct:   98 MGPVSDLFNTYSFNCYFRQKWTDDRLHFNNSGIGFRQ-LSLSMAMLDKIWKPDTYFWNGAGSYVHGITTSNRLVRLEPDGTILYS 181          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Match: lgc-37 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:G5ECN1])

HSP 1 Score: 95.5153 bits (236), Expect = 1.279e-24
Identity = 41/81 (50.62%), Postives = 55/81 (67.90%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKI-LQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNI 240
            MGP+SE NM +S DCYFRQ+W D+RL F  ++  K  + L  K+L  +W PDTY  NG  SYLH +T+PNI  R+ +DG +
Sbjct:   80 MGPVSEQNMEFSLDCYFRQKWLDRRLAFTPINPSKPEIPLASKMLKDIWIPDTYIRNGRKSYLHTLTVPNILFRVRSDGQV 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 69.3218 bits (168), Expect = 2.122e-15
Identity = 34/88 (38.64%), Postives = 48/88 (54.55%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVD-----HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            +  +SE++M ++ D Y RQ WQD RL F  +D         L +    LD +WKPDT+F N + S+ H  T  N F+RI  DG +  S
Sbjct:   71 ISAVSEVDMDFTLDFYMRQTWQDPRLAFGSLDLGLSKEIDSLTVGVDYLDRLWKPDTFFPNEKKSFFHLATTHNSFLRIEGDGTVYTS 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 69.3218 bits (168), Expect = 2.122e-15
Identity = 34/88 (38.64%), Postives = 48/88 (54.55%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVD-----HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            +  +SE++M ++ D Y RQ WQD RL F  +D         L +    LD +WKPDT+F N + S+ H  T  N F+RI  DG +  S
Sbjct:   71 ISAVSEVDMDFTLDFYMRQTWQDPRLAFGSLDLGLSKEIDSLTVGVDYLDRLWKPDTFFPNEKKSFFHLATTHNSFLRIEGDGTVYTS 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 67.0106 bits (162), Expect = 2.335e-15
Identity = 34/88 (38.64%), Postives = 48/88 (54.55%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVD-----HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            +  +SE++M ++ D Y RQ WQD RL F  +D         L +    LD +WKPDT+F N + S+ H  T  N F+RI  DG +  S
Sbjct:   71 ISAVSEVDMDFTLDFYMRQTWQDPRLAFGSLDLGLSKEIDSLTVGVDYLDRLWKPDTFFPNEKKSFFHLATTHNSFLRIEGDGTVYTS 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Match: Grd (gene:FBgn0001134 transcript:FBtr0075139)

HSP 1 Score: 110.538 bits (275), Expect = 9.379e-30
Identity = 48/83 (57.83%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            MGPISE++M YS DCYFRQ W D+RL F+G      L L+  +L  +WKPDTYF NG+ SYLH IT PN FVRI+ +G ++YS
Sbjct:  144 MGPISEVDMTYSMDCYFRQSWVDKRLAFEGAQ--DTLALSVSMLARIWKPDTYFYNGKQSYLHTITTPNKFVRIYQNGRVLYS 224          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 100.908 bits (250), Expect = 2.155e-26
Identity = 46/84 (54.76%), Postives = 62/84 (73.81%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGP+SE++M YS DCYFRQ W+D+RL F G    K L L+ K+LD +W+PDTYF NG+ S +H IT+PN  +R+  +G I+YSM
Sbjct:   42 MGPVSELDMDYSMDCYFRQYWRDKRLSFKG--PIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSM 123          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 100.908 bits (250), Expect = 2.159e-26
Identity = 46/84 (54.76%), Postives = 62/84 (73.81%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGP+SE++M YS DCYFRQ W+D+RL F G    K L L+ K+LD +W+PDTYF NG+ S +H IT+PN  +R+  +G I+YSM
Sbjct:  144 MGPVSELDMDYSMDCYFRQYWRDKRLSFKG--PIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSM 225          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335421)

HSP 1 Score: 73.1738 bits (178), Expect = 1.093e-16
Identity = 33/82 (40.24%), Postives = 53/82 (64.63%), Query Frame = 1
Query:   10 ISEMNMVYSFDCYFRQRWQDQRLKFDGVD-HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            IS++ M YS    FR++W D+RLKFD +    K L L +   + VW PD +F N +  + HNI +PN+++RI  +G+++YS+
Sbjct:   76 ISDIKMEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEA--NRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSI 155          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335419)

HSP 1 Score: 73.1738 bits (178), Expect = 1.281e-16
Identity = 33/82 (40.24%), Postives = 53/82 (64.63%), Query Frame = 1
Query:   10 ISEMNMVYSFDCYFRQRWQDQRLKFDGVD-HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            IS++ M YS    FR++W D+RLKFD +    K L L +   + VW PD +F N +  + HNI +PN+++RI  +G+++YS+
Sbjct:   76 ISDIKMEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEA--NRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSI 155          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Match: LO018287.1 (pep chromosome:GRCz11:14:4486822:4556911:-1 gene:ENSDARG00000113737.1 transcript:ENSDART00000192863.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018287.1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.640e-25
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKF+G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   75 GPVSDTDMEYTIDVFFRQSWKDERLKFEG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 155          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Match: LO018287.1 (pep chromosome:GRCz11:14:4478416:4556896:-1 gene:ENSDARG00000113737.1 transcript:ENSDART00000044678.7 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018287.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.009e-24
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKF+G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   75 GPVSDTDMEYTIDVFFRQSWKDERLKFEGP--MNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 155          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Match: gabra3 (gamma-aminobutyric acid (GABA) A receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-091204-365])

HSP 1 Score: 88.5817 bits (218), Expect = 4.510e-24
Identity = 38/83 (45.78%), Postives = 58/83 (69.88%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKFDG    ++L LN  L   +W PDT+F NG+ S  HN+T PN  +R+ ++G ++Y+M
Sbjct:   44 GPVSDTDMEYTIDVFFRQSWRDERLKFDG--PMQVLPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM 124          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Match: gabra2a (gamma-aminobutyric acid type A receptor alpha2 subunit a [Source:ZFIN;Acc:ZDB-GENE-141216-16])

HSP 1 Score: 92.0485 bits (227), Expect = 3.497e-23
Identity = 39/83 (46.99%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQRW D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  +G ++Y+M
Sbjct:   78 GPVSDTDMEYTVDVFFRQRWTDERLKFHG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIMENGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Match: gabra2a (gamma-aminobutyric acid type A receptor alpha2 subunit a [Source:ZFIN;Acc:ZDB-GENE-141216-16])

HSP 1 Score: 91.6633 bits (226), Expect = 3.609e-23
Identity = 39/83 (46.99%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQRW D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  +G ++Y+M
Sbjct:   83 GPVSDTDMEYTVDVFFRQRWTDERLKFHG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIMENGTLLYTM 163          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Match: GABRA2 (gamma-aminobutyric acid (GABA) A receptor, alpha 2 [Source:NCBI gene;Acc:100170583])

HSP 1 Score: 99.3673 bits (246), Expect = 1.125e-25
Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ WQD+RL+F G  H  IL+LN  + + +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:  127 GPVSDTDMEYTIDVFFRQNWQDERLRFKGPMH--ILRLNNLMANKIWTPDTFFHNGKKSIAHNMTMPNKLLRIQDDGTLLYTM 207          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Match: GABRA2 (gamma-aminobutyric acid (GABA) A receptor, alpha 2 [Source:NCBI gene;Acc:100170583])

HSP 1 Score: 98.2117 bits (243), Expect = 2.204e-25
Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ WQD+RL+F G  H  IL+LN  + + +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   51 GPVSDTDMEYTIDVFFRQNWQDERLRFKGPMH--ILRLNNLMANKIWTPDTFFHNGKKSIAHNMTMPNKLLRIQDDGTLLYTM 131          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Match: GABRA2 (gamma-aminobutyric acid (GABA) A receptor, alpha 2 [Source:NCBI gene;Acc:100170583])

HSP 1 Score: 98.2117 bits (243), Expect = 2.429e-25
Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ WQD+RL+F G  H  IL+LN  + + +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   49 GPVSDTDMEYTIDVFFRQNWQDERLRFKGPMH--ILRLNNLMANKIWTPDTFFHNGKKSIAHNMTMPNKLLRIQDDGTLLYTM 129          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Match: GABRA2 (gamma-aminobutyric acid (GABA) A receptor, alpha 2 [Source:NCBI gene;Acc:100170583])

HSP 1 Score: 98.2117 bits (243), Expect = 2.602e-25
Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ WQD+RL+F G  H  IL+LN  + + +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   76 GPVSDTDMEYTIDVFFRQNWQDERLRFKGPMH--ILRLNNLMANKIWTPDTFFHNGKKSIAHNMTMPNKLLRIQDDGTLLYTM 156          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Match: GABRA2 (gamma-aminobutyric acid (GABA) A receptor, alpha 2 [Source:NCBI gene;Acc:100170583])

HSP 1 Score: 98.2117 bits (243), Expect = 2.617e-25
Identity = 40/83 (48.19%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ WQD+RL+F G  H  IL+LN  + + +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   77 GPVSDTDMEYTIDVFFRQNWQDERLRFKGPMH--ILRLNNLMANKIWTPDTFFHNGKKSIAHNMTMPNKLLRIQDDGTLLYTM 157          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Match: Gabra2 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 2 [Source:MGI Symbol;Acc:MGI:95614])

HSP 1 Score: 94.3597 bits (233), Expect = 5.048e-24
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Match: Gabra1 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1 [Source:MGI Symbol;Acc:MGI:95613])

HSP 1 Score: 89.3521 bits (220), Expect = 6.623e-24
Identity = 38/83 (45.78%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKF G     +L+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  DG ++Y+M
Sbjct:   77 GPVSDHDMEYTIDVFFRQSWKDERLKFKG--PMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTM 157          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Match: Gabra3 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3 [Source:MGI Symbol;Acc:MGI:95615])

HSP 1 Score: 93.2041 bits (230), Expect = 1.769e-23
Identity = 40/83 (48.19%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W D+RLKFDG    KIL LN  L   +W PDT+F NG+ S  HN+T PN  +R+ ++G ++Y+M
Sbjct:  144 GPVSDTDMEYTIDVFFRQTWHDERLKFDG--PMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM 224          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Match: Gabra4 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 4 [Source:MGI Symbol;Acc:MGI:95616])

HSP 1 Score: 93.2041 bits (230), Expect = 1.885e-23
Identity = 41/84 (48.81%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHP-KILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S++ M Y+ D +FRQ W D+RLK+DG   P +IL+LN  ++  VW PDT+F NG+ S  HN+T PN   RI  +G I+Y+M
Sbjct:   84 GPVSDVEMEYTMDVFFRQTWIDKRLKYDG---PIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTM 164          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Match: Gabra4 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 4 [Source:MGI Symbol;Acc:MGI:95616])

HSP 1 Score: 93.2041 bits (230), Expect = 1.928e-23
Identity = 41/84 (48.81%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHP-KILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S++ M Y+ D +FRQ W D+RLK+DG   P +IL+LN  ++  VW PDT+F NG+ S  HN+T PN   RI  +G I+Y+M
Sbjct:  110 GPVSDVEMEYTMDVFFRQTWIDKRLKYDG---PIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTM 190          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Match: sp|Q24352|GBRAL_DROME (Gamma-aminobutyric acid receptor alpha-like OS=Drosophila melanogaster OX=7227 GN=Grd PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.402e-29
Identity = 48/83 (57.83%), Postives = 60/83 (72.29%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            MGPISE++M YS DCYFRQ W D+RL F+G      L L+  +L  +WKPDTYF NG+ SYLH IT PN FVRI+ +G ++YS
Sbjct:  144 MGPISEVDMTYSMDCYFRQSWVDKRLAFEGAQ--DTLALSVSMLARIWKPDTYFYNGKQSYLHTITTPNKFVRIYQNGRVLYS 224          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Match: sp|P23576|GBRA2_RAT (Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.698e-23
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNSMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Match: sp|P26048|GBRA2_MOUSE (Gamma-aminobutyric acid receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Gabra2 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.531e-23
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Match: sp|P10063|GBRA2_BOVIN (Gamma-aminobutyric acid receptor subunit alpha-2 OS=Bos taurus OX=9913 GN=GABRA2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.602e-23
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ+W+D+RLKF G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQKWKDERLKFKG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Match: sp|P34903|GBRA3_HUMAN (Gamma-aminobutyric acid receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GABRA3 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 9.322e-23
Identity = 40/83 (48.19%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W D+RLKFDG    KIL LN  L   +W PDT+F NG+ S  HN+T PN  +R+ ++G ++Y+M
Sbjct:  103 GPVSDTDMEYTIDVFFRQTWHDERLKFDG--PMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM 183          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Match: B7Q4M6 (Neur_chan_LBD domain-containing protein (Fragment) OS=Ixodes scapularis OX=6945 GN=8035841 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.773e-32
Identity = 52/84 (61.90%), Postives = 69/84 (82.14%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISE++M YS DCYFRQRW DQRLKF+G  +P  + L+ K+L+ +WKPDTYF+NG+GSYLH IT PN  +RI+ +G+++YSM
Sbjct:   22 MGPISELDMEYSMDCYFRQRWTDQRLKFNGTINP--ISLHIKMLERIWKPDTYFINGKGSYLHTITQPNKLLRIYRNGDVLYSM 103          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Match: A0A1I8F3M5 (Neur_chan_LBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 3.735e-32
Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISE +M+YSFDCYFRQ W D RL F   D+   LQLN+K+L  +WKPDTY +NG GSYLHNIT PN+  RI N G I+YSM
Sbjct:   77 MGPISERSMIYSFDCYFRQEWTDTRLTFPAHDNFTHLQLNEKMLREIWKPDTYIVNGMGSYLHNITSPNVLFRIKNTGEILYSM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Match: A0A1I8GZV5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.734e-30
Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISE +M+YSFDCYFRQ W D RL F   D+   LQLN+K+L  +WKPDTY +NG GSYLHNIT PN+  RI N G I+YSM
Sbjct:   77 MGPISERSMIYSFDCYFRQEWTDTRLTFPAHDNFTHLQLNEKMLREIWKPDTYIVNGMGSYLHNITSPNVLFRIKNTGEILYSM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Match: A0A1I8I9C2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 3.790e-30
Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISE +M+YSFDCYFRQ W D RL F   D+   LQLN+K+L  +WKPDTY +NG GSYLHNIT PN+  RI N G I+YSM
Sbjct:   77 MGPISERSMIYSFDCYFRQEWTDTRLTFPAHDNFTHLQLNEKMLREIWKPDTYIVNGMGSYLHNITSPNVLFRIKNTGEILYSM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Match: A0A3S4R2A6 (Gamma-aminobutyric acid receptor alpha-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_10752 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.597e-30
Identity = 50/84 (59.52%), Postives = 63/84 (75.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGP+SE+NM YS DCYFRQ+W D+RLK++G      L LN  +L+ +WKPDTYF NG+GSYLH IT PN F+RI+  G + YSM
Sbjct:   26 MGPMSELNMEYSLDCYFRQKWLDKRLKYEGSYES--LSLNINMLEKIWKPDTYFHNGKGSYLHTITRPNKFLRIYKSGQVYYSM 107          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Match: ENSAMXT00000057615.1 (gamma-aminobutyric acid receptor subunit alpha-2-like [Source:NCBI gene;Acc:103033058])

HSP 1 Score: 94.3597 bits (233), Expect = 3.511e-24
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKF+G     IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQSWKDERLKFEG--PMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Match: gabra2a (gamma-aminobutyric acid receptor subunit alpha-2 [Source:NCBI gene;Acc:103030391])

HSP 1 Score: 92.0485 bits (227), Expect = 2.402e-23
Identity = 39/83 (46.99%), Postives = 58/83 (69.88%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQRW D+RLKF G  +  IL+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  +G ++Y+M
Sbjct:   78 GPVSDADMEYTVDVFFRQRWTDERLKFRGPMN--ILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIMENGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Match: gabra4 (gamma-aminobutyric acid type A receptor alpha4 subunit [Source:NCBI gene;Acc:103023162])

HSP 1 Score: 91.6633 bits (226), Expect = 4.785e-23
Identity = 40/84 (47.62%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHP-KILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S++ M Y+ D +FRQ W DQRL+++G   P +IL+LN  ++  VW PDT+F NG+ S  HN+T PN   RI  +G I+Y+M
Sbjct:   84 GPVSDVEMEYTMDVFFRQTWVDQRLRYEG---PIEILRLNNLMVTKVWTPDTFFRNGKRSVAHNMTAPNKLFRIMKNGTILYTM 164          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:103042270])

HSP 1 Score: 91.2781 bits (225), Expect = 5.477e-23
Identity = 38/84 (45.24%), Postives = 57/84 (67.86%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPK-ILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+  M Y+ D +FRQ W+D+RL+F G   P  +L LN  L   +W PDT+F+NG+ S  HN+T PN  +R+ +DG ++Y+M
Sbjct:   85 GPVSDTEMEYTIDVFFRQSWKDERLRFKG---PMGMLPLNNLLASNIWTPDTFFLNGKKSIAHNMTTPNKLLRLQDDGTLLYTM 165          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:103042270])

HSP 1 Score: 90.8929 bits (224), Expect = 6.560e-23
Identity = 38/84 (45.24%), Postives = 57/84 (67.86%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPK-ILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+  M Y+ D +FRQ W+D+RL+F G   P  +L LN  L   +W PDT+F+NG+ S  HN+T PN  +R+ +DG ++Y+M
Sbjct:   80 GPVSDTEMEYTIDVFFRQSWKDERLRFKG---PMGMLPLNNLLASNIWTPDTFFLNGKKSIAHNMTTPNKLLRLQDDGTLLYTM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 93.5893 bits (231), Expect = 2.056e-24
Identity = 41/84 (48.81%), Postives = 59/84 (70.24%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHP-KILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S++ M Y+ D +FRQ W D+RLKFDG   P +IL+LN  +++ +W PDTYF NG+ S  HN+T PN   RI  +G ++Y+M
Sbjct:   81 GPVSDVEMDYTMDVFFRQTWVDERLKFDG---PIEILRLNNLMVNRIWTPDTYFRNGKKSIAHNMTAPNKLFRIMQNGTVLYTM 161          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008303.1 (pep scaffold:Pmarinus_7.0:GL481596:63007:72479:-1 gene:ENSPMAG00000007514.1 transcript:ENSPMAT00000008303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 9.462e-24
Identity = 38/83 (45.78%), Postives = 54/83 (65.06%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+  M Y+ D +FRQ W+D+RLKF G     +L LN  +   +W PDT+F NG+ S  HN+T PN  +RI  DG ++Y+M
Sbjct:   72 GPVSDTEMEYTIDMFFRQYWKDERLKFQG--PMGVLPLNNMMASKIWTPDTFFYNGKKSVAHNMTTPNKLLRIMEDGTLLYTM 152          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000073.1 (pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1 gene:ENSPMAG00000000064.1 transcript:ENSPMAT00000000073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 2.416e-18
Identity = 34/81 (41.98%), Postives = 57/81 (70.37%), Query Frame = 1
Query:   10 ISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            ISE+NM Y+   + RQRWQD+RL F+G    K L L+ +L++ +W PDT+ ++ + S+LH+IT+ N  +RI  +G ++Y++
Sbjct:   71 ISEINMDYTATIFLRQRWQDERLCFEG---NKSLSLDGRLVELLWVPDTFIVDSKRSFLHDITVENRLIRIFPNGTVLYAL 148          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 73.1738 bits (178), Expect = 2.322e-17
Identity = 33/84 (39.29%), Postives = 52/84 (61.90%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPK-ILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            G I+E  M Y  + + RQ+W D RL +   ++P   L L+  +LD++WKPD +F N +G+  H +T  N  +RI  DGN++YS+
Sbjct:   18 GSIAETTMDYRVNIFLRQQWNDPRLAYS--EYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSI 99          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Match: gabrz (gamma-aminobutyric acid (GABA) A receptor, zeta [Source:ZFIN;Acc:ZDB-GENE-080303-26])

HSP 1 Score: 68.9366 bits (167), Expect = 8.068e-16
Identity = 32/84 (38.10%), Postives = 53/84 (63.10%), Query Frame = 1
Query:   10 ISEMNMV---YSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            ISE+NM    Y+   + RQRW D+RL FD     K L L+ +L+  +W PDT+ ++ + S+LH +T+ N  +RI  +G ++Y++
Sbjct:   44 ISEINMAGQDYTATIFLRQRWVDERLCFDA---NKSLSLDGRLVQLLWVPDTFIVDSKRSFLHAVTVENRLIRIFPNGTVLYAL 124          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 68.1662 bits (165), Expect = 1.678e-15
Identity = 32/84 (38.10%), Postives = 51/84 (60.71%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            +G ISE +M +    ++RQ WQD RL +D   + K L LN +++D +W PD YF+N +    H++T  N  VR+  DG + +S+
Sbjct:   17 IGDISEADMEFRVMFFYRQYWQDTRLAYDYTGYNKRLALNARMVDYMWIPDIYFVNEKSGIKHDLTKQNEVVRVWPDGRVFHSI 100          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 68.1662 bits (165), Expect = 1.956e-15
Identity = 28/82 (34.15%), Postives = 50/82 (60.98%), Query Frame = 1
Query:    7 PISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
             + EMNM ++ D Y RQ W+D+RL+F+      +L L+  +   +W P TYF+  + +Y H++T  N  +++  DG++ YS+
Sbjct:   59 AMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSI 140          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Match: EDO33940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQS7])

HSP 1 Score: 64.6994 bits (156), Expect = 5.629e-15
Identity = 32/84 (38.10%), Postives = 50/84 (59.52%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            +G I+E+NM ++   YFRQ W+D RL +    + K L  N ++L  +W PDT+F   +    ++IT  N  VRI  +G ++YSM
Sbjct:   37 IGDINEINMEFTTIMYFRQYWEDPRLAYADTGYTKRLAFNPEMLKFIWVPDTHFPGIKDGLKNDITASNEVVRIFPNGTLLYSM 120          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Match: EDO34692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK5])

HSP 1 Score: 66.6254 bits (161), Expect = 5.885e-15
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 1
Query:   28 VYSFDCYFRQRWQDQRLKFDGVD-HPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            +++ D Y RQ W+D RL FD V  +  +L LN++ +D +W P TYF N + +Y H++T  N  + I  +G++ YS+
Sbjct:    1 MFTIDMYLRQYWRDPRLIFDPVPVNTDVLTLNRQTIDEIWIPSTYFFNAKKAYFHDVTTENYLLMIKPNGDVFYSV 76          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Match: EDO45677 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS31])

HSP 1 Score: 63.929 bits (154), Expect = 7.547e-14
Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 1
Query:   16 EMNMVYSFDCYFRQRWQDQRLKFD---GVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            E +M ++ + YFRQ W D RL F    G     ++ L   L D++W+PDTYF N     +H +T+ N ++R+++DG ++ S+
Sbjct:   18 EADMEFTAEMYFRQAWHDPRLAFGVTMGNSTVPVITLYGDLSDSLWQPDTYFENEVQGKIHELTIKNKYMRVYSDGRVMTSL 99          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Match: gabra6a (gamma-aminobutyric acid receptor subunit alpha-6 [Source:NCBI gene;Acc:101161166])

HSP 1 Score: 92.0485 bits (227), Expect = 1.910e-23
Identity = 38/83 (45.78%), Postives = 58/83 (69.88%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S++ M Y+ D +FRQ W D+RLKF+G    +IL+LN +++D +W PDT+F N + S  HN+T PN   RI  +G ++Y+M
Sbjct:   67 GPVSDVKMEYTMDMFFRQMWVDERLKFEG--PTEILRLNNRMVDKIWTPDTFFRNSKKSISHNMTTPNKLFRIMQNGTVLYTM 147          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Match: gabra1 (gamma-aminobutyric acid type A receptor alpha1 subunit [Source:NCBI gene;Acc:101165194])

HSP 1 Score: 90.8929 bits (224), Expect = 6.406e-23
Identity = 37/84 (44.05%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            +GP+S+ +M Y+ D +FRQ W+D+RLKF G     +L+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  +G ++Y+M
Sbjct:   79 IGPVSDHDMEYTIDVFFRQSWKDERLKFKG--PMAVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEEGTLLYTM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Match: gabra1 (gamma-aminobutyric acid type A receptor alpha1 subunit [Source:NCBI gene;Acc:101165194])

HSP 1 Score: 90.8929 bits (224), Expect = 6.406e-23
Identity = 37/84 (44.05%), Postives = 58/84 (69.05%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            +GP+S+ +M Y+ D +FRQ W+D+RLKF G     +L+LN  +   +W PDT+F NG+ S  HN+T+PN  +RI  +G ++Y+M
Sbjct:   79 IGPVSDHDMEYTIDVFFRQSWKDERLKFKG--PMAVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEEGTLLYTM 160          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Match: ENSORLT00000011902.2 (gamma-aminobutyric acid receptor subunit alpha-2 [Source:NCBI gene;Acc:101158539])

HSP 1 Score: 90.5077 bits (223), Expect = 8.705e-23
Identity = 38/83 (45.78%), Postives = 57/83 (68.67%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RL F G  +  IL LN  +   +W PDT+F NG+ S  HN+T+PN  +RI +DG ++Y+M
Sbjct:   78 GPVSDTDMEYTIDVFFRQSWKDERLTFHGPMN--ILPLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIKDDGTLLYTM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Match: gabra3 (gamma-aminobutyric acid receptor subunit alpha-3 [Source:NCBI gene;Acc:101165582])

HSP 1 Score: 90.1225 bits (222), Expect = 1.272e-22
Identity = 38/83 (45.78%), Postives = 58/83 (69.88%), Query Frame = 1
Query:    4 GPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            GP+S+ +M Y+ D +FRQ W+D+RLKFDG    ++L LN  L   +W PDT+F NG+ S  HN+T PN  +R+ ++G ++Y+M
Sbjct:   85 GPVSDTDMEYTIDVFFRQSWRDERLKFDG--PMQVLPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTM 165          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 181.415 bits (459), Expect = 6.980e-58
Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM
Sbjct:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 84          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 181.415 bits (459), Expect = 2.340e-57
Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM
Sbjct:   61 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 144          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Match: SMESG000026005.1 (SMESG000026005.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.994e-14
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query:   10 ISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSM 252
            ISE+NM Y+   Y  Q WQD+RL F+      ++ +     + +W PDT+  N + S+LH++T  N  +RI+ DG I Y M
Sbjct:   78 ISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGM 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Match: SMESG000008993.1 (SMESG000008993.1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.489e-14
Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
Query:   25 MVYSFDCYFRQRWQDQRLKFDGVDHPKILQLN---QKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            M YS D Y RQ W D RL+++ ++  K    N     L D +W PD +F NG+  Y+HN+T PN  +R+  +G ++YS
Sbjct:   81 MQYSTDVYLRQAWIDSRLRWEHLEEFKHYNSNIVSPSLKDEIWLPDLFFRNGKKGYIHNMTTPNYLMRLQPNGEVLYS 158          
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Match: SMESG000077704.1 (SMESG000077704.1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.579e-14
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 1
Query:    1 MGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLN---QKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYS 249
            +  +S   M YS D Y RQ W D RL ++ +D  K    N     L   +W PD +F NG+  Y+H +TLPN  +R+  +G I+YS
Sbjct:   66 INSVSVTQMEYSTDVYLRQEWVDSRLAWNNLDKFKSYNANIVSPSLKKVLWLPDLFFRNGKEGYVHKMTLPNYLMRLSPNGLILYS 151          
The following BLAST results are available for this feature:
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRA25.981e-2546.99gamma-aminobutyric acid type A receptor alpha2 sub... [more]
GABRA29.054e-2446.99gamma-aminobutyric acid type A receptor alpha2 sub... [more]
GABRA11.163e-2345.78gamma-aminobutyric acid type A receptor alpha1 sub... [more]
GABRA21.924e-2346.99gamma-aminobutyric acid type A receptor alpha2 sub... [more]
GABRA31.941e-2348.19gamma-aminobutyric acid type A receptor alpha3 sub... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgc-369.413e-2552.94Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
lgc-371.279e-2450.62Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
unc-492.122e-1538.64Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
unc-492.122e-1538.64Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
unc-492.335e-1538.64Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grd9.379e-3057.83gene:FBgn0001134 transcript:FBtr0075139[more]
CG89162.155e-2654.76gene:FBgn0030707 transcript:FBtr0301233[more]
CG89162.159e-2654.76gene:FBgn0030707 transcript:FBtr0301232[more]
GluClalpha1.093e-1640.24gene:FBgn0024963 transcript:FBtr0335421[more]
GluClalpha1.281e-1640.24gene:FBgn0024963 transcript:FBtr0335419[more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018287.14.640e-2546.99pep chromosome:GRCz11:14:4486822:4556911:-1 gene:E... [more]
LO018287.11.009e-2446.99pep chromosome:GRCz11:14:4478416:4556896:-1 gene:E... [more]
gabra34.510e-2445.78gamma-aminobutyric acid (GABA) A receptor, alpha 3... [more]
gabra2a3.497e-2346.99gamma-aminobutyric acid type A receptor alpha2 sub... [more]
gabra2a3.609e-2346.99gamma-aminobutyric acid type A receptor alpha2 sub... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRA21.125e-2548.19gamma-aminobutyric acid (GABA) A receptor, alpha 2... [more]
GABRA22.204e-2548.19gamma-aminobutyric acid (GABA) A receptor, alpha 2... [more]
GABRA22.429e-2548.19gamma-aminobutyric acid (GABA) A receptor, alpha 2... [more]
GABRA22.602e-2548.19gamma-aminobutyric acid (GABA) A receptor, alpha 2... [more]
GABRA22.617e-2548.19gamma-aminobutyric acid (GABA) A receptor, alpha 2... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabra25.048e-2446.99gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra16.623e-2445.78gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra31.769e-2348.19gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra41.885e-2348.81gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra41.928e-2348.81gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24352|GBRAL_DROME9.402e-2957.83Gamma-aminobutyric acid receptor alpha-like OS=Dro... [more]
sp|P23576|GBRA2_RAT1.698e-2346.99Gamma-aminobutyric acid receptor subunit alpha-2 O... [more]
sp|P26048|GBRA2_MOUSE3.531e-2346.99Gamma-aminobutyric acid receptor subunit alpha-2 O... [more]
sp|P10063|GBRA2_BOVIN3.602e-2346.99Gamma-aminobutyric acid receptor subunit alpha-2 O... [more]
sp|P34903|GBRA3_HUMAN9.322e-2348.19Gamma-aminobutyric acid receptor subunit alpha-3 O... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B7Q4M61.773e-3261.90Neur_chan_LBD domain-containing protein (Fragment)... [more]
A0A1I8F3M53.735e-3264.29Neur_chan_LBD domain-containing protein OS=Macrost... [more]
A0A1I8GZV52.734e-3064.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I9C23.790e-3064.29Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S4R2A65.597e-3059.52Gamma-aminobutyric acid receptor alpha-like protei... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057615.13.511e-2446.99gamma-aminobutyric acid receptor subunit alpha-2-l... [more]
gabra2a2.402e-2346.99gamma-aminobutyric acid receptor subunit alpha-2 [... [more]
gabra44.785e-2347.62gamma-aminobutyric acid type A receptor alpha4 sub... [more]
gabra55.477e-2345.24gamma-aminobutyric acid type A receptor alpha5 sub... [more]
gabra56.560e-2345.24gamma-aminobutyric acid type A receptor alpha5 sub... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabra6a2.056e-2448.81gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
ENSPMAT00000008303.19.462e-2445.78pep scaffold:Pmarinus_7.0:GL481596:63007:72479:-1 ... [more]
ENSPMAT00000000073.12.416e-1841.98pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1... [more]
glra22.322e-1739.29glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gabrz8.068e-1638.10gamma-aminobutyric acid (GABA) A receptor, zeta [S... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO404781.678e-1538.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354101.956e-1534.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339405.629e-1538.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346925.885e-1538.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456777.547e-1435.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabra6a1.910e-2345.78gamma-aminobutyric acid receptor subunit alpha-6 [... [more]
gabra16.406e-2344.05gamma-aminobutyric acid type A receptor alpha1 sub... [more]
gabra16.406e-2344.05gamma-aminobutyric acid type A receptor alpha1 sub... [more]
ENSORLT00000011902.28.705e-2345.78gamma-aminobutyric acid receptor subunit alpha-2 [... [more]
gabra31.272e-2245.78gamma-aminobutyric acid receptor subunit alpha-3 [... [more]
back to top
BLAST of gamma-aminobutyric acid receptor alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018336.16.980e-58100.00SMESG000018336.1[more]
SMESG000018336.12.340e-57100.00SMESG000018336.1[more]
SMESG000026005.12.994e-1438.27SMESG000026005.1[more]
SMESG000008993.16.489e-1439.74SMESG000008993.1[more]
SMESG000077704.18.579e-1438.37SMESG000077704.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018578 ID=SMED30018578|Name=gamma-aminobutyric acid receptor alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=254bp
ATGGGTCCAATCTCAGAAATGAATATGGTTTATTCATTTGATTGCTACTT
TCGCCAACGATGGCAAGATCAAAGACTAAAATTTGATGGCGTTGACCATC
CGAAAATTTTACAACTCAATCAAAAACTGCTGGATACGGTGTGGAAACCC
GATACCTATTTCATGAATGGTGAAGGTTCATATCTTCACAATATCACTTT
GCCAAATATTTTCGTTCGAATTCACAATGACGGAAATATCGTCTATTCCA
TGAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005254chloride channel activity
GO:0004890GABA-A receptor activity
GO:0005216ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0032590dendrite membrane
GO:0034707chloride channel complex
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:1902711GABA-A receptor complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006821chloride transport
GO:0007214gamma-aminobutyric acid signaling pathway
GO:0034220ion transmembrane transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 1..84
e-value: 3.0E-28
score: 100.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 3..84
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 3..83
e-value: 1.9E-18
score: 66.7
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 8..84
NoneNo IPR availablePANTHERPTHR18945:SF835GAMMA-AMINOBUTYRIC ACID RECEPTOR ALPHA-LIKEcoord: 8..84
NoneNo IPR availableCDDcd19007LGIC_ECD_GABAR_GRD-likecoord: 1..84
e-value: 2.25897E-47
score: 146.617