Dynein intermediate chain 2, ciliary

Overview
NameDynein intermediate chain 2, ciliary
Smed IDSMED30018570
Length (bp)2502
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein intermediate chain 2, ciliary (SMED30018570) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30018570) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein intermediate chain 2, ciliary (SMED30018570) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein intermediate chain 2, ciliary (SMED30018570) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018570

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018570SMESG000023117.1 SmedASXL_005077SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018570SMESG000023117.1 SmedASXL_005078SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018570SMESG000023117.1 SmedASXL_000141SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018570SMESG000023117.1 SmedASXL_005079SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018570SMESG000023117.1 dd_Smed_v6_39721_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 251.906 bits (642), Expect = 5.078e-72
Identity = 188/594 (31.65%), Postives = 287/594 (48.32%), Query Frame = 2
Query:  719 GNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            G++ +    G    + E +     Q K   +L ++    ER  QT  N VR+    TE P    FS +  Q  IYD Y+EE+ + EK            K    + M++L+ + S  + L  L +   ++ERM+  N   +I  DF  +DD ADE R    GTLLPLWK +  K  R                   +VT + W P+Y DL  +  G Y+F   S  G +  +SLKN   PE++  + SG MCLDIH +    VAVG Y+G+VA+YN+   K  +Q   C S  +   H D V  VKW      ++DQ         +L F SV  DG+++ W + +  +  I +I          +LK++     V    Q   +   ++FD H++    +++GT+ G I   K S+        S S  F     AH   + ++ WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT D   +++DL I++   +C   + + K      LT + FN  H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  162 GSQTDVPAAGAAEKVTEEELMTPKQPKE-RKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQ-VGTLLPLWKFQNDKAKRL------------------SVTALCWNPKYRDLFAVGYGSYDFMKQS-RGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLK--KPHSQPSFCSS-AKSGKHSDPVWQVKW---QKDDMDQ---------NLNFFSVSSDGRIVSWTLVKRKLVHIDVI----------KLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKN----RLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 694          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: DNAI1 (dynein axonemal intermediate chain 1 [Source:HGNC Symbol;Acc:HGNC:2954])

HSP 1 Score: 251.906 bits (642), Expect = 5.363e-72
Identity = 188/594 (31.65%), Postives = 287/594 (48.32%), Query Frame = 2
Query:  719 GNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            G++ +    G    + E +     Q K   +L ++    ER  QT  N VR+    TE P    FS +  Q  IYD Y+EE+ + EK            K    + M++L+ + S  + L  L +   ++ERM+  N   +I  DF  +DD ADE R    GTLLPLWK +  K  R                   +VT + W P+Y DL  +  G Y+F   S  G +  +SLKN   PE++  + SG MCLDIH +    VAVG Y+G+VA+YN+   K  +Q   C S  +   H D V  VKW      ++DQ         +L F SV  DG+++ W + +  +  I +I          +LK++     V    Q   +   ++FD H++    +++GT+ G I   K S+        S S  F     AH   + ++ WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT D   +++DL I++   +C   + + K      LT + FN  H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  158 GSQTDVPAAGAAEKVTEEELMTPKQPKE-RKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQ-VGTLLPLWKFQNDKAKRL------------------SVTALCWNPKYRDLFAVGYGSYDFMKQS-RGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLK--KPHSQPSFCSS-AKSGKHSDPVWQVKW---QKDDMDQ---------NLNFFSVSSDGRIVSWTLVKRKLVHIDVI----------KLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKN----RLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 690          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 102.064 bits (253), Expect = 1.704e-21
Identity = 91/363 (25.07%), Postives = 157/363 (43.25%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            NV+ + W     DLL +  GH+ F      G  C +S+KN   PE +  +  G   +D      N +AVG++NG++A+YN+   ++ +   V  S      H+  V  ++WI +       +T + K+      +S+  DG++  W I + G+    L+     +   N+   + +       ++      F  H +D   Y+ GT+ GHI +   S           +E +      H G +  + WN +  +VFLS S D  + +W   N++  +      + V D  WS  S+ + AA   +  + ++DL IS   PL  +T     K      T ILF      + V DS G V +Y++
Sbjct:  487 NVSSLAWNKTNPDLLAVGYGHFGFK-EQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNV---RSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRG----TTGDGKREI---LVSISADGRISKWVIRK-GLDCYDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPKDTNIYLAGTEEGHIHKCSCSY----------NEQYLDTYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANEN-RVEIWDLHISTLDPLIVNTANPGIK-----FTTILFAKQTDCLLVGDSDGQVSVYEL 821          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR34 (WD repeat domain 34 [Source:HGNC Symbol;Acc:HGNC:28296])

HSP 1 Score: 88.9669 bits (219), Expect = 1.098e-17
Identity = 90/364 (24.73%), Postives = 168/364 (46.15%), Query Frame = 2
Query: 1400 ICGFSL--KNLKV--PEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMEN-----ELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHII-------QSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHV-LDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNH-HTIAVSDSRGIVVIYKMSPNLRKK-PKERKGVE 2434
            +C ++L  ++L+   P  V+   S  +CL  H  + ++VA G Y+G V V+++++ +     L+ R+   +  H D V+ V W+ E   +           +  + LSV  DGKV+LW+    GVGQ+ L T      M+      +LK   +  T +    A   SSFD       +I+GT+ G  +       ++ L+R  S+    + ++      + H G I S+  + +H N+FLSA  DG + +++ L       L + LK  +   +WS     V AA +    + ++DL  S   P    T++  +      +  + FN      +A  D++G V ++++S    ++ P+E + ++
Sbjct:  195 VCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDP---LLWRTGLTDDTHTDPVSQVVWLPEPGHS-----------HRFQVLSVATDGKVLLWQ--GIGVGQLQL-TEGFALVMQQLPRSTKLKKHPRGET-EVGATAVAFSSFDPR----LFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQF---TFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKY-LFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKP----TVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLD 528          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Match: WDR78 (WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:26252])

HSP 1 Score: 84.3445 bits (207), Expect = 3.250e-16
Identity = 90/381 (23.62%), Postives = 154/381 (40.42%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRG 2446
            NV+ + W     DLL +  GH+ F      G  C +S+KN   PE +  +  G   +D      N +AVG++NG++A+YN+   ++ +   V  S      H+  V  ++WI +       +T + K+      +S+  DG++  W I + G+    L              + +K  T   + +       D                  ++ +SR+     F+ + +          G +  + WN +  +VFLS S D  + +W   N++  +      + V D  WS  S+ + AA   +  + ++DL IS   PL  +T     K      T ILF      + V DS G V +Y+    LR  P     +E  RG
Sbjct:  253 NVSSLAWNKTNPDLLAVGYGHFGFK-EQKRGLACCWSIKNPMWPERIYQSPYGVTAVDFSIGAPNLLAVGYHNGTIAIYNV---RSNSNVPVLDSSESPQKHLGPVWQLQWIEQDRG----TTGDGKREI---LVSISADGRISKWVIRK-GLDCYDL--------------MRLKRTTAASNKKGGEKEKKD------------------EALISRQAPGMCFAFHPK----------GPVYKVTWNPFCHDVFLSCSADWGVIIWQQENVKPSLSFYPATSVVYDVAWSPKSSYIFAAANEN-RVEIWDLHISTLDPLIVNTANPGIK-----FTTILFAKQTDCLLVGDSDGQVSVYE----LRNMPTV---LETGRG 566          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Match: dyci-1 (DYnein Chain, light Intermediate [Source:UniProtKB/TrEMBL;Acc:O45087])

HSP 1 Score: 58.9214 bits (141), Expect = 1.356e-8
Identity = 87/381 (22.83%), Postives = 164/381 (43.04%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKV-PEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGL-VCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENIS-SFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMW-------NFYHPNVFLSASVDGSLKVWNT------LNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNL 2401
            VT M +   Y DLL ++ G  +   +   G I  ++ K+ ++  EF++Y  S    +   R  ++ +  G  +G + V++   ++  ++ L + RS      H  +V+ +  +          T N        F+S+  DG++  W +  D + Q                 +D K    K    A     SF I E   T+++GT  G I+ +  SR  ++         +      H+G +T I +       +F H  +F+S+S D ++K+W+T       + ESH    DL   V D  WS     V A++ AD  I+V++L    + P+    L +  +   V++ +++++P+   + V D  G V +Y +  +L
Sbjct:  286 VTGMAFSEHYPDLLAVSYGPCDIP-NEPPGVIVVWNTKSKRMTAEFIVYCQSEIQSVAFARFHAHLLLAGCESGQICVWD---NRLTSRKLPINRSPLTTQAHTYTVSCLAVV---------GTKNAHN-----FVSLSRDGRICSWNV--DNLTQ----------------PVDGKELMTKEGKAASATRMSFPIGE-MQTFVVGTDTGEILAA--SRNGADPAVIKTDVCY----KGHSGTLTGIEFHRASGVVDFSH--LFISSSHDWTVKLWSTKDANLKFSFESHP---DL---VLDVAWSPVHPAVFASIDADGNIFVWNLNEDVEGPVA--RLRAGAEGESVYMNRLIWSPDGKHVFVGDDEGRVHMYDVRESL 613          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0071521)

HSP 1 Score: 207.994 bits (528), Expect = 2.024e-56
Identity = 161/545 (29.54%), Postives = 256/545 (46.97%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSL-CREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENEL--KLDVKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLR---KKPKER 2422
            +LI++   CERG  T  N  R +   T  P   +F  +V Q  IYD Y+E    ++K      K  +++       +  S I    +     L+   +LERMI  N+  +I  D+  W+DPADE R+   G LLPLWK +       Y+   K+           NVTD+ + P Y DL  +  G ++F   +  G +C F++KN   P+++I T  G MC DIH        +G Y+G+VAVYN+ +   K    V R + C+   H + V  +KW       LD +        ++ F SV  DG+V  W + ++ +     +T  I  + EN L    D    T+K        S    H  D   +++GT+ G+I +        +  FSS    +     AH   +  I +N ++ N+F+S   D  +KVW  +  +   +  DL   V D KW+ +S+TV AAVT +  ++V+DL +++   +C   ++  +K     LT++ FN     I V D +G+    K+SPNLR   K PK++
Sbjct:  218 KLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD--GTKKEERKRGKREKKFRDKSAI--AEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREG-EGNLLPLWKFQ-------YDKTKKM-----------NVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNL-REDCKEPLYVSRGVNCK---HGECVWQIKW------GLDMADG------EVNFFSVSSDGRVFNWILMQNKL----WVTTIITLYRENGLVDGPDGTKVTLK-----SGGSCMVFHPVDNKIFLVGTECGYIYK-------CSTAFSSK---YLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFI-FDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNK---LTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQ 700          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0345666)

HSP 1 Score: 207.994 bits (528), Expect = 2.024e-56
Identity = 161/545 (29.54%), Postives = 256/545 (46.97%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSL-CREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENEL--KLDVKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLR---KKPKER 2422
            +LI++   CERG  T  N  R +   T  P   +F  +V Q  IYD Y+E    ++K      K  +++       +  S I    +     L+   +LERMI  N+  +I  D+  W+DPADE R+   G LLPLWK +       Y+   K+           NVTD+ + P Y DL  +  G ++F   +  G +C F++KN   P+++I T  G MC DIH        +G Y+G+VAVYN+ +   K    V R + C+   H + V  +KW       LD +        ++ F SV  DG+V  W + ++ +     +T  I  + EN L    D    T+K        S    H  D   +++GT+ G+I +        +  FSS    +     AH   +  I +N ++ N+F+S   D  +KVW  +  +   +  DL   V D KW+ +S+TV AAVT +  ++V+DL +++   +C   ++  +K     LT++ FN     I V D +G+    K+SPNLR   K PK++
Sbjct:  218 KLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD--GTKKEERKRGKREKKFRDKSAI--AEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREG-EGNLLPLWKFQ-------YDKTKKM-----------NVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNL-REDCKEPLYVSRGVNCK---HGECVWQIKW------GLDMADG------EVNFFSVSSDGRVFNWILMQNKL----WVTTIITLYRENGLVDGPDGTKVTLK-----SGGSCMVFHPVDNKIFLVGTECGYIYK-------CSTAFSSK---YLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFI-FDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNK---LTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQ 700          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: CG9313 (gene:FBgn0034566 transcript:FBtr0342788)

HSP 1 Score: 207.608 bits (527), Expect = 2.110e-56
Identity = 161/545 (29.54%), Postives = 256/545 (46.97%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSL-CREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENEL--KLDVKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLR---KKPKER 2422
            +LI++   CERG  T  N  R +   T  P   +F  +V Q  IYD Y+E    ++K      K  +++       +  S I    +     L+   +LERMI  N+  +I  D+  W+DPADE R+   G LLPLWK +       Y+   K+           NVTD+ + P Y DL  +  G ++F   +  G +C F++KN   P+++I T  G MC DIH        +G Y+G+VAVYN+ +   K    V R + C+   H + V  +KW       LD +        ++ F SV  DG+V  W + ++ +     +T  I  + EN L    D    T+K        S    H  D   +++GT+ G+I +        +  FSS    +     AH   +  I +N ++ N+F+S   D  +KVW  +  +   +  DL   V D KW+ +S+TV AAVT +  ++V+DL +++   +C   ++  +K     LT++ FN     I V D +G+    K+SPNLR   K PK++
Sbjct:  219 KLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQFGANVLQWVIYDSYMENFAESQKD--GTKKEERKRGKREKKFRDKSAI--AEQLNKKYLKCWQILERMINQNIYDDIAHDYRYWEDPADEFREG-EGNLLPLWKFQ-------YDKTKKM-----------NVTDILFNPSYYDLFAVCFGSHDFMKQTNEGYLCLFTVKNPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYDGNVAVYNL-REDCKEPLYVSRGVNCK---HGECVWQIKW------GLDMADG------EVNFFSVSSDGRVFNWILMQNKL----WVTTIITLYRENGLVDGPDGTKVTLK-----SGGSCMVFHPVDNKIFLVGTECGYIYK-------CSTAFSSK---YLMTYYAHNMSVYRIDFNRFNSNIFVSCGADWMVKVWEDMRPDPLFI-FDLGAAVGDVKWAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVPKRKNK---LTRLSFNEKLAFIVVGDEKGVTTSLKLSPNLRMMVKPPKKQ 701          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072538)

HSP 1 Score: 56.225 bits (134), Expect = 1.004e-7
Identity = 79/365 (21.64%), Postives = 155/365 (42.47%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMH----GNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDG--VGQIHLITNNINSWMENELKLDVKNFTVKFDN--QAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAV---TADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRG 2368
            V+D+ +C    D+L +  G Y+FS  S H    G++  +S+KN   PE   Y       ++      + +A+G Y+GSV V +++  +     +  RS          V +++WI + + +  ++  +        FLS+ +DG V  ++I +    +G   +I   +    E            + +   Q  +I++  +H+D   Y + T  G I +  ++ +          E+       H G +T + ++ + P +FL+   D  +++W        +  +D    V  AKWS   +T++  V   TA++  +  +LL     P+  H + SS      F T   F+    T+ + + RG
Sbjct:  300 VSDIDFCRSNGDILAVAYGLYSFS--SQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTS---PGSSPVVAIRWIKQVSDDDHETDID-------PFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKD--IYYVLTDEGCIHKCSINYQ------HQYLEVL----RCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETANVWDFRRNLL----RPMSKHKMDSS------FNTVARFSHCGRTLVIGNERG 630          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Match: Dic61B (gene:FBgn0263988 transcript:FBtr0072539)

HSP 1 Score: 55.8398 bits (133), Expect = 1.496e-7
Identity = 79/365 (21.64%), Postives = 155/365 (42.47%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMH----GNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDG--VGQIHLITNNINSWMENELKLDVKNFTVKFDN--QAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAV---TADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRG 2368
            V+D+ +C    D+L +  G Y+FS  S H    G++  +S+KN   PE   Y       ++      + +A+G Y+GSV V +++  +     +  RS          V +++WI + + +  ++  +        FLS+ +DG V  ++I +    +G   +I   +    E            + +   Q  +I++  +H+D   Y + T  G I +  ++ +          E+       H G +T + ++ + P +FL+   D  +++W        +  +D    V  AKWS   +T++  V   TA++  +  +LL     P+  H + SS      F T   F+    T+ + + RG
Sbjct:  380 VSDIDFCRSNGDILAVAYGLYSFS--SQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTS---PGSSPVVAIRWIKQVSDDDHETDID-------PFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKD--IYYVLTDEGCIHKCSINYQHQYL------EVL----RCHDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETANVWDFRRNLL----RPMSKHKMDSS------FNTVARFSHCGRTLVIGNERG 710          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 264.233 bits (674), Expect = 4.241e-77
Identity = 200/601 (33.28%), Postives = 294/601 (48.92%), Query Frame = 2
Query:  707 RRFSGNEVEDEIDGEDTDIVEMDF-TNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKG------LFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWN-TLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            RR      E E  G D  +  +     K + KV  Q        +R  QT  N  REI   TE P    FS +  Q  IYD Y+EE+ R EK        F N + ++ K       K++    + ++ +  L +P  ++ERM+  N+  E+  DF  ++D ADE R    GTLLPLWK +  K        AK ++          VT + W   YSDL  + +G Y F+     G +  ++LKN   PEF+  T SG MC+DIH   S  VAVG Y+G V+VY++   + K+   +  S+     H  +V  VKW      +LD +           F SV  DG+V+ W +    V    + T+ I     +++  D+KN        A   +S D H +    +++GT+ G I   K S+  S+         F     AH   ++ + WN +HPNVF+S   D  +K+W+ T+N  S V   +LK+ VTD  WS +S+TV AAVTAD  ++V+DL I++   LC   ++S K      L  I FNP H  I V D RG V+  K+SPNLRKKPKE+KG E+ +GP+ E   ++ ++
Sbjct:  128 RRLMAKHTEREDCGGDERLENVPIKPGKREQKVTNQF----NFIDRASQTLNNLPREISCQTEPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEEDRSK-------KKMIQAEAQSDDISQLAKPAKIIERMVNQNIFDEVAQDFMYFEDAADEFRGE-KGTLLPLWKFQYDK--------AKGLS----------VTALCWNHIYSDLFAVGLGSYEFT-QQERGMLLFYTLKNPSFPEFIFNTDSGVMCVDIHEQLSYLVAVGLYDGCVSVYDL---RKKSDQPMYNSIASSGKHTGAVWQVKW---QKDDLDSNH---------NFFSVSTDGRVVSWTL----VKHEIVFTDIIKLPPVDKVPDDLKNVV------ATAGTSLDFHKQKDHHFLVGTEAGKI--HKGSKYYSSK--------FLEMYDAHFMTVSCVRWNPFHPNVFISCGWDWMVKIWDHTIN--SPVFTFELKSSVTDVAWSPYSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVSKK----TRLLHIEFNPVHPIIIVGDDRGRVISLKLSPNLRKKPKEKKGQELPKGPEVEIAKMEQLL 656          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 221.861 bits (564), Expect = 1.917e-62
Identity = 168/558 (30.11%), Postives = 269/558 (48.21%), Query Frame = 2
Query:  842 GIQTSFNEVREIGVFTES-PISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPI----PSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKW----IYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWME-NELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
              QT+ N  RE+   TES P+   +S +  Q  IYD Y EE+ +       + K N+    +      LS +       +  L  L     +LE  +  N++ +I+ DF  ++D ADE R    GTLLPLW+ + +K+                   S +V+ + W  +Y+DL  + +G + F+     G +  ++ +N   PEF+  T SG MC+DIH  +S+ VAVG +NG+V VYN+    AK+   +  S+     H  +V  VKW    +Y + T                F SV  DG+V+ W +     G+  L + NI      +++  D+ N  V          + D H +    +++GT+ G I +            S++   F     AH  M++ + WN ++P VF++  +D  + +W+    +S V   DLK+ V D  W+ +S+TV AAVTAD  ++V+DL I+    LC   ++S+K+     LT I FNP H  I V + RG V+  K+SPNLRK PKE KG E + G + E   ++ ++
Sbjct:   88 ATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSSTKKDEKENEIAEGAEGVHGNLSLLRDFTDKSDHDLAMLSTAAKLLEYAVNENINGDIIADFKHFEDEADEFRGD-KGTLLPLWEFQYNKVK------------------SLHVSALCWNKKYNDLFAVGLGSHKFTELEC-GMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLM---AKDDQPIYNSMASSGKHSGTVWQVKWWEDDLYGNHT----------------FFSVSADGRVVSWTL-----GKYELFSTNIIKLPPMDKVPDDLNNVIVTAG------LTLDFHKQKPYHFLVGTEAGKIHKG-----------STHYTRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDE-TTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKR----HLTCIEFNPVHPIIIVGNDRGRVISLKLSPNLRKNPKEEKGKEPSTGAEVEIAKMEKLL 579          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: dnai1.1 (dynein, axonemal, intermediate chain 1, paralog 1 [Source:ZFIN;Acc:ZDB-GENE-040910-7])

HSP 1 Score: 218.779 bits (556), Expect = 1.550e-61
Identity = 171/561 (30.48%), Postives = 272/561 (48.48%), Query Frame = 2
Query:  842 GIQTSFNEVREIGVFTES-PISDEFSVSVTQATIYDKYIEEVFR---TEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILL----DFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKW----IYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWME-NELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
              QT+ N  RE+   TES P+   +S +  Q  IYD Y EE+ +   + K    NS   K + I+         I S ++ L  L     +LE  +  N++ +I+     DF  ++D ADE R    GTLLPLW+ + +K+                   S +V+ + W  +Y+DL  + +G + F+     G +  ++ +N   PEF+  T SG MC+DIH  +S+ VAVG +NG+V VYN+    AK+   +  S+     H  +V  VKW    +Y + T                F SV  DG+V+ W +     G+  L + NI      +++  D+ N  V          + D H +    +++GT+ G I +            S++   F     AH  M++ + WN ++P VF++  +D  + +W+    +S V   DLK+ V D  W+ +S+TV AAVTAD  ++V+DL I+    LC   ++S+K+     LT I FNP H  I V + RG V+  K+SPNLRK PKE KG E + G + E   ++ ++
Sbjct:   56 ATQTTINPPREVACQTESQPLLVNYSATANQWEIYDFYQEELQKRTSSTKKCSHNSNIQKIQQIARNKNSIFGRIMSDHD-LAMLSTAAKLLEYAVNENINGDIIAAQTSDFKHFEDEADEFRGD-KGTLLPLWEFQYNKVK------------------SLHVSALCWNKKYNDLFAVGLGSHKFTELEC-GMLLFYTWRNNNHPEFLFNTDSGVMCVDIHEQKSHLVAVGLFNGNVCVYNLM---AKDDQPIYNSMASSGKHSGTVWQVKWWEDDLYGNHT----------------FFSVSADGRVVSWTL-----GKYELFSTNIIKLPPMDKVPDDLNNVIVTAG------LTLDFHKQKPYHFLVGTEAGKIHKG-----------STHYTRFIKTYEAHFRMVSCVRWNPFNPKVFITCGMDWRVNIWDE-TTDSPVFTFDLKSSVMDVAWAPYSSTVFAAVTADGKVHVFDLSINRFEALCQQRVVSTKR----HLTCIEFNPVHPIIIVGNDRGRVISLKLSPNLRKNPKEEKGKEPSTGAEVEIAKMEKLL 549          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 114.775 bits (286), Expect = 1.087e-25
Identity = 107/389 (27.51%), Postives = 178/389 (45.76%), Query Frame = 2
Query: 1229 CSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVT-DAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            C  L R ++ + +L        +  NV+ M W  +  DLL +  G   F  +   G +C +SLKN   P+ V +  SG   LD   + +N +AVG Y+G++A+YN+    ++   +   S C  +H     TS  W      + D   A+  +I     +SV  DG++  W IH   +  + L+   I+   + + K  + + T            FD H  D   Y++GT+ GHI          +   SS +E +  +  AH   +  + W+ +  +VFLS S D ++++W   +L+  V+       V  D  WS H ATV  AV ++  + ++DL +S   P    TL++      V  T +LF+P    + V DS G V +YK+
Sbjct:  412 CPFLERLWDFSCELT-------MGRNVSCMVWNKKNPDLLAVGYGQVEFK-NPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNV--QTSEQTPITDSSDCANLH-----TSPVWQLTWIDHEDGLAADKGEI----LVSVSSDGRISKW-IHYKSMECVDLMKLKIH---DLQWKRHISSLTPGM--------CFDFHPNDSKIYLVGTEEGHI----------HKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQ-DLQIPVMGFTSGQRVVFDIMWSPHCATVFGAV-SEGKVEIWDLRVSSLDP----TLVNWTSP-GVNPTALLFSPETDCVLVGDSEGQVTVYKL 752          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Match: wdr78 (WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-050522-322])

HSP 1 Score: 114.775 bits (286), Expect = 1.087e-25
Identity = 107/389 (27.51%), Postives = 178/389 (45.76%), Query Frame = 2
Query: 1229 CSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVT-DAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            C  L R ++ + +L        +  NV+ M W  +  DLL +  G   F  +   G +C +SLKN   P+ V +  SG   LD   + +N +AVG Y+G++A+YN+    ++   +   S C  +H     TS  W      + D   A+  +I     +SV  DG++  W IH   +  + L+   I+   + + K  + + T            FD H  D   Y++GT+ GHI          +   SS +E +  +  AH   +  + W+ +  +VFLS S D ++++W   +L+  V+       V  D  WS H ATV  AV ++  + ++DL +S   P    TL++      V  T +LF+P    + V DS G V +YK+
Sbjct:  412 CPFLERLWDFSCELT-------MGRNVSCMVWNKKNPDLLAVGYGQVEFK-NPNSGLVCCWSLKNPTWPDRVFHCESGVTALDFSASNANQLAVGMYDGTIAIYNV--QTSEQTPITDSSDCANLH-----TSPVWQLTWIDHEDGLAADKGEI----LVSVSSDGRISKW-IHYKSMECVDLMKLKIH---DLQWKRHISSLTPGM--------CFDFHPNDSKIYLVGTEEGHI----------HKCSSSYNEQYLESYKAHKRPVYKVTWSPFCSDVFLSCSSDWTIQLWRQ-DLQIPVMGFTSGQRVVFDIMWSPHCATVFGAV-SEGKVEIWDLRVSSLDP----TLVNWTSP-GVNPTALLFSPETDCVLVGDSEGQVTVYKL 752          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 114.39 bits (285), Expect = 1.967e-25
Identity = 114/443 (25.73%), Postives = 180/443 (40.63%), Query Frame = 2
Query: 1094 LVVLERMIYHNVSTEILLDF------SDWDDPADEIRKSFTGTLLP----LWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFD-IHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            L  +ER++  N     L  +      +D ++  D+I    +  + P    LW   C             +T G       NV+ + W  + SDLL +  G + F+     G  C +SLKN+  PE + +   G   +D      N +AVG YNG+VA+YN+  ++      V  S      H   V  +KWI     NL               +SV  DG++  W I +       +      S    +   + +     F ++      FD + +D   Y+ GT+ GHI +   S           +E F      H G +  I W+ + P+VFLS S D  + +W    L   +   +  N V D  WS  SA +  AVT +  + ++DL  S   P     LI ++    V LT ILF  N + + + DS G V +Y++
Sbjct:  372 LFFMERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACD------------VTKGH------NVSSISWNKKNSDLLAVGYGQFGFT-EQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNE---DFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEI-------LVSVCADGRITRWHIRKGLDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSY----------NEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDP-----LIVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 769          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 114.005 bits (284), Expect = 2.817e-25
Identity = 114/443 (25.73%), Postives = 180/443 (40.63%), Query Frame = 2
Query: 1094 LVVLERMIYHNVSTEILLDF------SDWDDPADEIRKSFTGTLLP----LWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFD-IHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            L  +ER++  N     L  +      +D ++  D+I    +  + P    LW   C             +T G       NV+ + W  + SDLL +  G + F+     G  C +SLKN+  PE + +   G   +D      N +AVG YNG+VA+YN+  ++      V  S      H   V  +KWI     NL               +SV  DG++  W I +       +      S    +   + +     F ++      FD + +D   Y+ GT+ GHI +   S           +E F      H G +  I W+ + P+VFLS S D  + +W    L   +   +  N V D  WS  SA +  AVT +  + ++DL  S   P     LI ++    V LT ILF  N + + + DS G V +Y++
Sbjct:  372 LFFMERVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACD------------VTKGH------NVSSISWNKKNSDLLAVGYGQFGFT-EQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNE---DFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEI-------LVSVCADGRITRWHIRKGLDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSY----------NEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDP-----LIVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 769          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: creb5 (cAMP responsive element binding protein 5 [Source:Xenbase;Acc:XB-GENE-950883])

HSP 1 Score: 113.235 bits (282), Expect = 3.526e-25
Identity = 100/363 (27.55%), Postives = 155/363 (42.70%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFD-IHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            NV+ + W  + SDLL +  G + F+     G  C +SLKN+  PE + +   G   +D      N +AVG YNG+VA+YN+  ++      V  S      H   V  +KWI     NL               +SV  DG++  W I +       +      S    +   + +     F ++      FD + +D   Y+ GT+ GHI +   S           +E F      H G +  I W+ + P+VFLS S D  + +W    L   +   +  N V D  WS  SA +  AVT +  + ++DL  S   P     LI ++    V LT ILF  N + + + DS G V +Y++
Sbjct:  379 NVSSISWNKKNSDLLAVGYGQFGFT-EQKGGMACCWSLKNIMWPERIFHCECGVTAVDFSAVHPNLLAVGMYNGTVAIYNVQNNE---DFPVLDSSDNPNKHTSPVWQLKWIEHDRGNLGDDKGEI-------LVSVCADGRITRWHIRKGLDCNDLMKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGMCFDFLPKDSNIYLAGTEEGHIHKCSCSY----------NEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSADWCIHLWQQDVLSPILTFSNTTNAVYDIMWSPSSALMFGAVTEN-RVEIWDLGTSTIDP-----LIVNEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL 714          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: rwdd2b (RWD domain containing 2B [Source:Xenbase;Acc:XB-GENE-963133])

HSP 1 Score: 85.1149 bits (209), Expect = 1.438e-16
Identity = 78/339 (23.01%), Postives = 151/339 (44.54%), Query Frame = 2
Query: 1406 GFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDI-HEDGITYIIGTKIGHIIQSKLS-RELSNATFSSNSEIFGSNK---TAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSP-LCCHTLISSKKIYRVFLTKILFN-PNHHTIAVSDSRGIVVIYKMSPNL 2401
            GF+  N   P+ V+   S  MCL  H ++ + +A G +NG V V++ ++    +  L+ R+      H D+V  V W+ E +           Q +  +  SV  DGK+++W++ ++G    HL+  +  + +  ++  + K       + A  ++     H D   +I+G + G++++   S + L+     S+  +    +   + H G + S+  + +H N+FLSA  DG   +++ L  +  V     +  +   +WS     V AA + D  + + D   S   P LC     S + +Y      + FN      +A  D  G V I+++S + 
Sbjct:  171 GFNANN---PDTVLDVPSSVMCLAWHPSQPSLIAGGLFNGDVLVWDTSR---TDDPLIGRTGHVGDTHTDAVYQVGWMQEKS-----------QGHRHQVFSVSSDGKILVWQMEKEG----HLVLLDGFALVAQQIPSNTKIHKPGRGDTAVGVTCLSYSHFDPSLFIVGVEGGYLLKCSSSVQTLAPINMGSSVPLRAPAQFTFSPHGGPVYSVTCSPFHRNLFLSAGTDGHAHLYSMLQAKPLVSLQLSQKYLFSIRWSPVRPLVFAAASGDGEVVLVDFAKSFQKPSLCIKQTASGRPVY-----CLEFNHAQSQLLAAGDGTGTVKIWQLSSDF 483          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 61.6178 bits (148), Expect = 4.169e-9
Identity = 82/376 (21.81%), Postives = 139/376 (36.97%), Query Frame = 2
Query: 1289 NQISGNVTDMKWCPRYSDLLLLTIGHYNFSIH----SMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNL 2401
            N+I    T + W P  S  L +     +F       S    I    + N   PE  +  +S  +CL+ +   S+ +  G YNG +A ++      +  G    S   E  H D V  V W+ +S T  +     C         S   DG+++ W I +       LI             LD+       DN    +S          +++GT+ G I+         N    +  E        H G I SI  N ++P  FL+   D + ++W+    ES ++        +TDA WS    TV      D  + V+D +  +++P      +S + +Y + +       N   +A     G+  + ++S  L
Sbjct:  138 NEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPN--KPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWD-----TRKGGNPMESTVIEHSHRDPVYKVIWL-QSKTGTE-----C--------FSASTDGQILWWDIRKLSEPTEKLI-------------LDISK-KENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVS-------CNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVG-DWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNP-SLSVKVSGEPLYSIRMQD-----NGRFVACGSQMGVTTLMELSKGL 464          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 248.44 bits (633), Expect = 6.969e-71
Identity = 171/564 (30.32%), Postives = 278/564 (49.29%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            +L ++    ER  QT  N +R+     E P    FS +  Q  IYD Y++E+ + EK            K    + M++L+ + S ++ +  + +   ++ERM+  N   ++  DF  ++D ADE R    GTLLPLWK +  K  R                    VT + W P+Y DL  +  G Y+F   S  G +  +S+KN   PE++  + SG MCLD+H +    V VG+Y+G+VA+YN+   K  +     RS  +   H D V  VKW      ++D         ++L F SV  DG+++ W + +  +  I +I          +LK +     +    Q   +   ++FD H++    +++GT+ G I   K S+        S S  F     AH   + +++WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT D   +V+DL +++   +C   +++ KK     +T + FNP H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  188 KLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYRDQ-EGTLLPLWKFQNDKAKRL------------------AVTALCWNPKYKDLFAVGHGSYDFMKQS-RGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNL---KKPHSQPCFRSTSKSGKHTDPVWQVKW---QKDDMD---------HNLNFFSVSSDGRIVSWTLVKSELVHIDII----------KLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNK---ITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 692          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 96.6709 bits (239), Expect = 4.984e-20
Identity = 97/388 (25.00%), Postives = 163/388 (42.01%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTA--NCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVN--RGPK 2452
            NV+ + W     DLL +  G++ F      G  C +S+KN   PE +  +  G   +D   +  N +AVG++NG+VA+YN+   ++ +   V  S      H+  V  V+WI +     D+ T   + ++I     +S+  DG++  W I +       +      +    +     K        QA  +  F  H +D   Y+ GT+ G I +   S           +E +      H G +  + WN + P+VFLS S D  + +W+   ++  +        V D  WS  SA + AA   +  + ++DL IS   PL  +      K      T +LF      + V DS G V +Y++  N+       +G  +N   GPK
Sbjct:  446 NVSSLSWNKANPDLLAVGYGNFGFR-EQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNV---QSSHNIPVLDSSESPQKHLGPVWQVQWIEQ-----DRGTTGDDKREI----LVSISADGRISKWIIRKGLDCHDLMRLKRTTATGGKKGGEKEKKGEALISRQAPGM-CFAFHPKDTNIYLAGTEEGLIHKCSCSY----------NEQYLETYRGHKGPVYKVTWNPFCPDVFLSCSADWGVMIWHQDTVKPFLSFYPTTYVVYDVSWSPKSAYIFAAANEN-RVEIWDLQISTLDPLIVNVANPGIK-----FTTVLFAKETDCLLVGDSDGQVAVYELR-NMPTASDTSRGDVINILLGPK 802          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr34 (WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:1919070])

HSP 1 Score: 89.7373 bits (221), Expect = 4.668e-18
Identity = 83/355 (23.38%), Postives = 162/355 (45.63%), Query Frame = 2
Query: 1400 ICGFSLK----NLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWME----NELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGS----NKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDA-KWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNH-HTIAVSDSRGIVVIYKMSPNLRKK-PKE 2419
            +C ++L     N + P  V+   S  MCL  H  + +++A G Y+G V V+++++       L+ R+   +  H D V  V W+ E            +  +  + LS   DGKV+LW+    G GQ+ L      +  +     +LK   +  T +    +   SSF    D   +++GT+ G  ++  L+ E++  T   +S    +      + H G + S+  + +H N+FLSA  DG + +++ L  +  +  + L +    A +WS     V AA + +  + ++DL  S   P    ++  ++    V+   + FN      +A  D++G+V ++++S    ++ P+E
Sbjct:  196 VCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPSHIAGGLYSGEVLVWDMSR---PEDPLLWRTGLTDDTHTDPVYQVLWLPEP-----------RHSHRFQVLSAATDGKVLLWR--GSGAGQLRLTKGFALAVQQLPRSTKLKKPPRGET-EVGVTSVAFSSF----DSSLFVLGTEGGFPLKCSLASEVAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAQP-LTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSSQKPTV--SITQTQDGSPVYC--LEFNSQQTQLLAAGDAKGMVKVWQLSTAFTEQGPRE 524          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Dnaic1 (dynein, axonemal, intermediate chain 1 [Source:MGI Symbol;Acc:MGI:1916172])

HSP 1 Score: 71.2478 bits (173), Expect = 1.158e-14
Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 2
Query: 2219 MIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            M +V+DL +++   +C   +++ KK     +T + FNP H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:    1 MAHVFDLAVNKYEAICNQPVVAKKKNK---ITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 86          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Match: Wdr78 (WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:2385328])

HSP 1 Score: 62.003 bits (149), Expect = 2.193e-9
Identity = 46/162 (28.40%), Postives = 78/162 (48.15%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTA--NCKQIYDLKFLSVGEDGKVILWKIHE--DGVGQIHL 1777
            NV+ + W     DLL +  G++ F      G  C +S+KN   PE +  +  G   +D   +  N +AVG++NG+VA+YN+   ++ +   V  S      H+  V  V+WI +     D+ T   + ++I     +S+  DG++  W I +  D  G  HL
Sbjct:  446 NVSSLSWNKANPDLLAVGYGNFGFR-EQKKGMACCWSIKNPMWPERIYQSSYGVTSVDFSNSSPNLLAVGYHNGTVAIYNV---QSSHNIPVLDSSESPQKHLGPVWQVQWIEQ-----DRGTTGDDKREI----LVSISADGRISKWIIRKGLDCHGHEHL 594          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q9UI46|DNAI1_HUMAN (Dynein intermediate chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAI1 PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.576e-71
Identity = 188/594 (31.65%), Postives = 287/594 (48.32%), Query Frame = 2
Query:  719 GNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            G++ +    G    + E +     Q K   +L ++    ER  QT  N VR+    TE P    FS +  Q  IYD Y+EE+ + EK            K    + M++L+ + S  + L  L +   ++ERM+  N   +I  DF  +DD ADE R    GTLLPLWK +  K  R                   +VT + W P+Y DL  +  G Y+F   S  G +  +SLKN   PE++  + SG MCLDIH +    VAVG Y+G+VA+YN+   K  +Q   C S  +   H D V  VKW      ++DQ         +L F SV  DG+++ W + +  +  I +I          +LK++     V    Q   +   ++FD H++    +++GT+ G I   K S+        S S  F     AH   + ++ WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT D   +++DL I++   +C   + + K      LT + FN  H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  158 GSQTDVPAAGAAEKVTEEELMTPKQPKE-RKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQ-VGTLLPLWKFQNDKAKRL------------------SVTALCWNPKYRDLFAVGYGSYDFMKQS-RGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLK--KPHSQPSFCSS-AKSGKHSDPVWQVKW---QKDDMDQ---------NLNFFSVSSDGRIVSWTLVKRKLVHIDVI----------KLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKN----RLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 690          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q16959|DYI2_HELCR (Dynein intermediate chain 2, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.188e-70
Identity = 180/582 (30.93%), Postives = 279/582 (47.94%), Query Frame = 2
Query:  725 EVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFE 2458
            + E+  +GE  D  E      +++K   +L ++    ER  QT  N  RE G  TE P    FS +  Q  IYD Y+E++ + EK     +  +K+      + K+L+ + + ++ +  +     ++ERM+  N   ++  DF  ++D +DE R    GTLLPLWK         Y+ + +L            VT + W P+Y DL  +  G Y+F   S  G I  ++LKN   PEFV  T SG MC+DI       + VG+ +GSV V+N+    A     V +S  +   H D V  V W  +   N            +L F SV  DG+V+ W + ++ +    +I          +L+LD          Q   +   + FD H +    +++GT+ G I   K S+  S+         F     AH   +  +MWN +HP +F+S S D S+K+W+       +   DL + V D  W+ +S+TV AAVTAD  ++V+DL +++  P+C   ++  KK     LT I FNPN   + V D RG V   K+SPNLRK PK++KG  +N GP+ E
Sbjct:  163 KTEEPKEGEKRD--EESTPAPAEAKSDQKLTNQFNFSERASQTYNNPYRERGTQTEPPPRANFSSTANQWEIYDAYMEDLEKQEKAKEKKAAPSKKDDDK--SKKKLTALETQSDDMSRISHAAKIIERMVNQNTFDDVSQDFKYYEDMSDEFRDQ-EGTLLPLWKFS-------YDKSKRLA-----------VTSVCWNPKYKDLFAVAHGSYDFMKQS-RGMILFYTLKNPSFPEFVYPTDSGVMCIDIRPEHPYLICVGYCDGSVGVFNVTSTDANP---VFQSTAKTGKHTDPVWQVAWQKDDLDN------------NLNFFSVSSDGRVVAWTLVKNELTYTDVI----------QLQLDSAPQDGPEGTQLTPLGCGTCFDFHKQTDYLFLVGTEEGKI--HKCSKAYSSQ--------FLDTFEAHHMAVYKVMWNHFHPKIFISCSADWSVKIWDHTYRNGPMFTFDLGSAVGDVAWAPYSSTVFAAVTADGKVHVFDLNLNKYEPICEQAVVQKKKTK---LTHITFNPNFPIVLVGDDRGYVSSLKLSPNLRKVPKDKKGAALNHGPEAE 682          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q8C0M8|DNAI1_MOUSE (Dynein intermediate chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.875e-70
Identity = 171/564 (30.32%), Postives = 278/564 (49.29%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            +L ++    ER  QT  N +R+     E P    FS +  Q  IYD Y++E+ + EK            K    + M++L+ + S ++ +  + +   ++ERM+  N   ++  DF  ++D ADE R    GTLLPLWK +  K  R                    VT + W P+Y DL  +  G Y+F   S  G +  +S+KN   PE++  + SG MCLD+H +    V VG+Y+G+VA+YN+   K  +     RS  +   H D V  VKW      ++D         ++L F SV  DG+++ W + +  +  I +I          +LK +     +    Q   +   ++FD H++    +++GT+ G I   K S+        S S  F     AH   + +++WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT D   +V+DL +++   +C   +++ KK     +T + FNP H  I V D RG ++  K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  188 KLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKQEKTKEKEKAKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDTADEYRDQ-EGTLLPLWKFQNDKAKRL------------------AVTALCWNPKYKDLFAVGHGSYDFMKQS-RGMLLLYSMKNPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNL---KKPHSQPCFRSTSKSGKHTDPVWQVKW---QKDDMD---------HNLNFFSVSSDGRIVSWTLVKSELVHIDII----------KLKTEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYMFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMAVDAVLWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNK---ITHVQFNPIHPIIIVGDDRGHIICLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 692          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q5XIL8|DNAI1_RAT (Dynein intermediate chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnai1 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 8.758e-69
Identity = 169/564 (29.96%), Postives = 274/564 (48.58%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            +L ++    ER  QT  N +R+     E P    FS +  Q  IYD Y++E+ + EK            K    + M++L+ + S ++ +  + +   ++ERM+  N   ++  DF  ++D ADE R    GTLLPLWK +  K  R                    VT + W P+Y DL  +  G Y+F   S  G +  +S+KN   PE++  + SG MCLD+H +    V VG+Y+G+VA+YN+   K  +     RS  +   H D V  VKW      ++D         ++L F SV  DG+++ W + +  +  I +I          +LK +     +    Q   +   ++FD H++    +++GT+ G I +             S S  F     AH   + +++WN YH  VF+S S D ++K+W+   +++ +   DL   V D  W+ +S+TV AAVT D   +V+DL +++   +C   +++ KK     +T + FNP H  I V D RG +   K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  192 KLTNQFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYVDELEKLEKTKEKEKTKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYRDQ-EGTLLPLWKFQNDKAKRL------------------AVTALCWNPKYKDLFAVGHGSYDFMKQS-RGMLLLYSMKNPSFPEYMFSSESGIMCLDMHMDHPYLVVVGYYDGNVAIYNL---KKPHSQPCFRSTSKSGKHTDPVWQVKW---QKDDMD---------HNLNFFSVSSDGRIVSWTLVKSELVHIDVI----------KLKDEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYLFLVGTEEGKIYKCS----------KSYSSQFLDTYDAHNMAVDAVLWNPYHARVFISCSSDWTVKIWDHA-IKTPMFIYDLNAAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNK---ITHVQFNPIHPIIIVGDDRGHITCLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 696          
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Match: sp|Q32KS2|DNAI1_BOVIN (Dynein intermediate chain 1, axonemal OS=Bos taurus OX=9913 GN=DNAI1 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.833e-66
Identity = 173/562 (30.78%), Postives = 273/562 (48.58%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNK-QKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNI-NSWMENELKLDVKNFTVKFDNQAENISSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            +L +K    ER  QT  N +R+     E P    FS +  Q  IYD Y+EE+ + EK            K +  + M++++ + S ++ +  + +   ++ERM+  N   ++  DF  ++D ADE R    GTLLPLWK +  K  R                    VT + W P+Y+DL  +  G Y+F   S  G +  +S+KN   PE++  + SG MCLD+H +    V VG Y+G+VA+YN+   K  +     RS  +   H D V  V+W      ++D         ++L F SV  DG+++ W + +  +    +I   +  S  E    L +              ++FD H E    +++GT+ G I   K S+        S S  F     AH   + ++ WN YH  VF+S S D ++K+W+   +++ +   DL + V D  W+ +S+TV AAVT +   +V+DL I++   +C   +++ KK     LT + FNP H  I V D RG V   K+SPNLRK PKE+KG EV +GP  E   L  +++
Sbjct:  189 KLTNKFNFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIYDAYMEELEKQEKTKEKEKTKTPVAKKMGKMAMRKMTSMESQSDDITKVTQAAKIVERMVNQNTYDDVAQDFKYYEDAADEYRDQ-EGTLLPLWKFQNDKAKRL------------------AVTALCWNPKYNDLFAVGHGSYDFMKQS-RGMLLLYSMKNPSFPEYIFSSESGIMCLDMHVDHPYLVVVGHYDGNVAIYNL---KKPHSQPSFRSSAKSGKHTDPVWQVRW---QKDDMD---------HNLNFFSVSSDGRIVSWTLVKSELVHTDVIKLKVEGSTTEGLEGLQIHTVGCG--------TAFDFHREIDYLFLVGTEEGKIY--KCSK--------SYSSQFLDTYDAHNMAVDAVSWNPYHTKVFMSCSSDWTVKIWDH-TIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTNGKTHVFDLSINKYEAICNQPVVAKKKNK---LTHVQFNPIHPIIIVGDDRGHVTCLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLN 693          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A4S2L4T2 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009831 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.831e-85
Identity = 201/599 (33.56%), Postives = 307/599 (51.25%), Query Frame = 2
Query:  716 SGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKG-----LFANSKF-NKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            +   VE+E + E        F   ++     +L ++   CER  QT  N  RE G  TE P    FS +VTQ  IYD Y  +  + ++      +    K+  KQK       K+ S   + N+ L    +P+ +LERMI  N   E+  DF  ++DP+DE R    GTLLPLW     K ARK  V A                 + W PRY+DL  +  G Y+F   S +G IC +++KN + PE++  T SG + LD+H    + + VGFY+GSV VYNI QHK+   G +  S  +   H D V  V+W      +LD          +L F SV  DG+V  W + ++GVG +H   N++  +    LK+   +      +Q   +   ++FD H      +++ T+ G +   K S+  S       S+  GS + AH   +  + WN +HP++F++ S D ++K+W+  N +  V   DL + V D  W+ +S+TV AAVTAD  ++VYDL +++  PL C+ L+++KK  +  LT + FNP +  I V D RG V   K+SPNLRKKPKE+KG++  +GP+ E   L+ ++
Sbjct:  116 TAGPVEEEANKEGA------FVETAEGMQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYDADYQKQQEKTKEKKVAGGPKYEGKQK-------KKSSHADTLNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQ-NGTLLPLWNFTFEK-ARKLAVTA-----------------LCWSPRYNDLFAVGHGSYDFMKQS-NGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKS---GPLYMSTAKTGKHTDPVWEVRW---QPNDLDA---------NLNFFSVSADGRVTSWTLVKEGVGSMHECPNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLSHLFLVATEEGMVY--KCSKAYS-------SQYLGSYE-AHHMSVYRVAWNHFHPDIFITCSADWTVKIWDH-NKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPL-CNQLVTAKK--KTKLTHLAFNPKYSIIIVGDDRGQVTSLKLSPNLRKKPKEKKGLDQPKGPEMEVRKLEKIL 652          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: C3Y1H7 (WD_REPEATS_REGION domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_242526 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.022e-81
Identity = 194/555 (34.95%), Postives = 285/555 (51.35%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVW-NTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFE 2458
            +L ++    ER  QT  N  RE G  TE P    FS +  Q  IYD Y+E++ R EK         +Q++    N K++S I S  + +  + +P  +LERM+  N   +I  DF  W+D +DE R+   GTLLPLWK         YE + +L            VT + W P+Y DLL +  G Y+F +    G IC +SLKN   PEF+  T +G MCLDIH    + VAVGFY+GSV V+++ +   K Q  + +   +   H D V  VKW  +   N            ++ F S+G DG+V+ W + ++ +    L T+ I       LKLD          Q   +   ++FD H +    +++GT+ G I   K S+  S+         F     AH   + S+ WN +HP +FLS S D ++K+W +T N+   +   DL + V D  W+ +S+TV AAVT+D  ++V+DL +++   LC   +++ KK     LT I FNPN+  I V D RG V   K+SPNLRK PKE+KGVE  +GP+ E
Sbjct:  146 KLTNQFNFSERASQTFNNPYRERGTQTEPPPRVNFSSTANQWEIYDAYVEDIQRQEKSKEKKGFRGQQEST---NRKKISAIESQGDDITRIEKPAKILERMVNQNTYDDIAQDFKYWEDVSDEYREQ-EGTLLPLWKFS-------YEKSKRLA-----------VTSICWDPKYRDLLAVGHGSYDF-LKQTRGLICLYSLKNPSFPEFIYNTETGVMCLDIHPAYPHLVAVGFYDGSVGVFSLTE---KIQEPMYKCTAKGGKHTDPVWEVKWQKDDLDN------------NMNFFSIGGDGRVVSWTLVKNEL----LCTDVI------LLKLDESPADGAEGTQLFTLGCGTAFDFHKQTDYLFLVGTEEGKI--HKCSKAYSSQ--------FLDTFDAHHMAVHSVRWNTFHPKIFLSCSADWTVKIWEHTSNMP--LFTFDLGSSVGDVAWAPYSSTVFAAVTSDGKVHVFDLNVNKYEALCEQVVVTKKKTK---LTHIEFNPNYPMIIVGDDRGYVTSLKLSPNLRKMPKEKKGVEAAKGPEVE 637          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A4S2L493 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009831 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.037e-81
Identity = 200/602 (33.22%), Postives = 307/602 (51.00%), Query Frame = 2
Query:  716 SGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKG-----LFANSKF-NKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQ-----IHLITNNINSWMENEL-KLDVKNFTVKFDNQAENISSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            +   VE+E + E        F   ++     +L ++   CER  QT  N  RE G  TE P    FS +VTQ  IYD Y  +  + ++      +    K+  KQK       K+ S   + N+ L    +P+ +LERMI  N   E+  DF  ++DP+DE R    GTLLPLW     K ARK  V A                 + W PRY+DL  +  G Y+F   S +G IC +++KN + PE++  T SG + LD+H    + + VGFY+GSV VYNI QHK+   G +  S  +   H D V  V+W      +LD          +L F SV  DG+V  W + ++ +GQ     + ++T++ +S   ++L  LD               ++FD H      +++ T+ G +   K S+  S       S+  GS + AH   +  + WN +HP++F++ S D ++K+W+  N +  V   DL + V D  W+ +S+TV AAVTAD  ++VYDL +++  PL C+ L+++KK  +  LT + FNP +  I V D RG V   K+SPNLRKKPKE+KG++  +GP+ E   L+ ++
Sbjct:  116 TAGPVEEEANKEGA------FVETAEGMQPKKLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYDADYQKQQEKTKEKKVAGGPKYEGKQK-------KKSSHADTLNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQ-NGTLLPLWNFTFEK-ARKLAVTA-----------------LCWSPRYNDLFAVGHGSYDFMKQS-NGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKS---GPLYMSTAKTGKHTDPVWEVRW---QPNDLDA---------NLNFFSVSADGRVTSWTLVKNDMGQFDALVLKMVTSSGDSSEPSQLITLDCG-------------TAFDFHRTLSHLFLVATEEGMVY--KCSKAYS-------SQYLGSYE-AHHMSVYRVAWNHFHPDIFITCSADWTVKIWDH-NKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPL-CNQLVTAKK--KTKLTHLAFNPKYSIIIVGDDRGQVTSLKLSPNLRKKPKEKKGLDQPKGPEMEVRKLEKIL 642          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A075A3K8 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_12527 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.425e-81
Identity = 200/601 (33.28%), Postives = 299/601 (49.75%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKY------IEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIP-----SGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWK----------------------------IHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI---SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            +L ++   CER  QT  N  RE G  TE P    FS +VTQ  IYD Y      ++E  + +K   A     KQK  S  +   L PI        N+ L    +P+ +LERMI  N   E+  DF  ++DP+DE R    GTLLPLW     K ARK  V A                 + W PRY+DL  +  G Y+F   S +G IC +++KN + PE++  T SG + LD+H    + + VGFY+GSV VYNI QHK+   G +  S  +   H D V  V+W      +LD          +L F SV  DG+V  W                             + ++GVG +H   N++  +    LK+   +      +Q   +   ++FD H      +++ T+ G +   K S+  S       S+  GS + AH   +  + WN +HP++F++ S D ++K+W+  N +  V   DL + V D  W+ +S+TV AAVTAD  ++VYDL +++  PLC + L+++KK  +  LT + FNP +  I V D RG V+  K+SPNLRKKPKE+KG++  +GP+ E   L+ ++
Sbjct:  141 KLTNQFNFCERSTQTYNNPHRERGNMTEPPPRATFSANVTQWIIYDDYEADQQKLQEKTKEKKVAGAQKYEGKQKKKSS-HADTLLPITYDYPFQQNDDLSRFAQPIKILERMINQNTHDEVAQDFKYYEDPSDEYRDQ-NGTLLPLWNFAFEK-ARKLAVTA-----------------LCWSPRYNDLFAVGHGSYDFMKQS-NGLICFYTMKNPEYPEYIFETDSGVLSLDLHHGLPHMLCVGFYDGSVGVYNINQHKS---GPLYMSTAKTGKHTDPVWEVRW---QPNDLDA---------NLNFFSVSADGRVTSWTLVKLLKLNDYKLLSVVHFSFVVSITFNTVLQEGVGSMHECPNDMGQFDALVLKMVTSSGDSSEPSQLITLDCGTAFDFHRTLPHLFLVATEEGMVY--KCSKAYS-------SQYLGSYE-AHHMSVYRVAWNHFHPDIFITCSADWTVKIWDH-NKKDPVFMYDLGSPVGDVAWAPYSSTVFAAVTADGRVHVYDLSVNKYEPLC-NQLVTAKK--KTKLTHLAFNPKYSIIIVGDDRGQVISLKLSPNLRKKPKEKKGLDQPKGPEMEIRKLEKIL 691          
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Match: A0A3B3SKD9 (Dynein, axonemal, intermediate chain 1, paralog 2 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.360e-78
Identity = 197/599 (32.89%), Postives = 303/599 (50.58%), Query Frame = 2
Query:  719 GNEVEDEIDGED-TDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRL---SPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI-----SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVID 2485
            G  V +E   E+  D  E   T + Q     +L ++    ER  QT  N +R+    TE P    FS +  Q  IYD Y+EE+ + E+    N + +K +++     K     + + + ++ +  +     ++ERM+  N   +I  DF  ++D +DE R+   GTLLPLW+ +  K        AK +T          VT + W P+Y DL  + +G Y+FS    HG +  +SLKN   PE++  T+SG +CLDIH + S  VAVGFY+GSVAVYN+   K ++     RS  +   H D V  VKW  +     D    +C       F SV  DG+V  W + ++      L+  +I        KL V   TV+   +A ++     +SFD H+     +++GT+ G I   K S+  S+         F     AH   + ++ WN +HP VF+S S D ++K+W+   + S +   DL   V D  WS +S+ V AAVT D  ++V+DL +++  P+ CH L+++KK     LT I FNP H  I V D  G V   K+SPNLRKKPKE+KG E+ +GP+ E   ++ +++
Sbjct:  106 GEGVAEEFGAEERPDSAESKSTRREQ-----KLTNQFNFSERASQTLNNPLRQRECQTEPPPRANFSATANQWEIYDAYVEELQKQER----NKEKHKAQSMKKEEEKSRKKTAVVETQSDDITNVGRAAKIMERMVNQNAFDDIAQDFKYFEDASDEFREQ-EGTLLPLWRFQYDK--------AKRLT----------VTALCWNPKYKDLFAVGLGSYDFSKQG-HGMLIFYSLKNSTFPEYIYPTLSGILCLDIHSSLSYLVAVGFYDGSVAVYNL---KEEDDEATYRSTAKSGKHTDPVWQVKWQKD-----DMDNNHC-------FFSVSSDGRVASWTLVKN-----ELLFTDIT-------KLSVGGATVERSEEARHLTMACGTSFDFHKKIDYLFLVGTEEGKI--HKCSKAYSSQ--------FLETYDAHNMAVEAVRWNPFHPKVFISCSSDWTVKIWDH-TVRSPMFTFDLNCAVGDVVWSPYSSAVFAAVTIDGKVHVFDLTVNKYEPI-CHQLVAAKKTK---LTHIEFNPVHPIIIVGDDHGFVTSLKLSPNLRKKPKEKKGQELPKGPEVEVAKMEKLLN 633          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 258.07 bits (658), Expect = 5.303e-75
Identity = 188/598 (31.44%), Postives = 296/598 (49.50%), Query Frame = 2
Query:  731 EDEIDGEDTDIVEM-DFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKR----LSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENI--------SSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            ED  D E+    E  D  +    K+  ++ ++    ER  QT  N  RE G  TE P   +FS +  Q  IYD Y+EE+ + E+     SK  ++  +S     +    ++ + + ++ +  + +   ++ERM+  N   +I  DF  ++D +DE R+   GTLLPLWK +  K        AK ++          VT + W   Y DL  + +G Y F+     G +  +SLKN   PE++  T+SG MCLDIH+  S+ VAVGFY+GSV VYN+   K +    + +S  +   H D V  VKW  +   N            +  F S+  DG+V+ W + ++      L+  +I       ++L V+       N  E +        +SFD H+     ++IGT+ G I   K S+      +SS    F     AH   + ++ WN +HP VF+S S D ++K+W+   ++S +   DL   V D  WS +S+TV AAVT D  ++V+DL I++   +C   + + K      LT I FNP +  I V D RG V   K+SPNLR+KPKE+KG E+ +GP+ E   ++ ++
Sbjct:  102 EDTGDAEEGAGEERPDSVDVKSGKMERKVTNQFNYSERASQTLNNPPRERGCQTEPPPRAKFSATANQWEIYDAYVEELQKQEQ-----SKEKQKTLVSKKEEDKGKKKMTVVENPSDDITKVAKVTKIIERMVTQNTFDDIAQDFKYFEDASDEFREQ-EGTLLPLWKFQYDK--------AKHLS----------VTALCWLCNYKDLFAVGLGSYKFTKQG-RGMLLFYSLKNSTYPEYIFTTLSGVMCLDIHKQLSSLVAVGFYDGSVGVYNL---KEEGPQPIYKSTAKMGKHTDPVWQVKWQKDDIDN------------NHNFFSISSDGRVVSWTLVKN-----ELVFTDI-------IRLSVEG---SISNGQEGMQLPAMACGTSFDFHQQIDYLFLIGTEEGKI--HKCSK-----CYSSQ---FLETYAAHNMAVDAVKWNQFHPKVFISCSSDWTVKIWDH-TIKSPMFTFDLNAPVGDVAWSPYSSTVFAAVTTDGKVHVFDLSINKYEAICQQAVAAKK----TKLTHIEFNPVYPIIIVGDDRGYVTSLKLSPNLRRKPKEKKGQELPKGPEVEVAKMEKLL 629          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:103046564])

HSP 1 Score: 109.383 bits (272), Expect = 4.323e-24
Identity = 104/374 (27.81%), Postives = 168/374 (44.92%), Query Frame = 2
Query: 1295 ISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMH-GNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISS------FDIHEDGIT-YIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDI-DLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            ++ +V+ M W  +  DLL   +G+    I+    G +C +SLKN + P+ +    S    LD   + ++ +AVG ++GS+ +YN+     K   ++  S C +  H   V  VKWI     + +Q++A   +   L  +SV  DG+V  W   E        +T            +D+   TV  ++    ISS      FD H +    Y+ GT  GHI +   S           +E F     AH G +  + W+ + P+VFLS S D ++++W   +L + VL     +N V D  WS   ATV   +  D  + +++L  S   P    T++S      V LT +LF      + V DS G V +YK+
Sbjct:  424 VAHDVSCMAWNKKNPDLL--AVGYEQLDINDQKSGLVCCWSLKNPQWPDRIFQCESAVTSLDFSASNASQLAVGMHDGSIVIYNV--QFTKKTPVIDSSNC-DPKHTGPVWQVKWI-----DCEQNSAGASEAEML--ISVAADGRVCKWFFRE-------CLTC-----------IDLMKLTVMRNDSGALISSQAPGLCFDFHRNNSNIYLTGTGEGHIHKCSCSY----------NEQFLDTYKAHKGPVRKVTWSPFCPDVFLSCSADWTIQLWRQ-DLFTPVLGFTSTQNAVHDVMWSPRWATVFGVINED-RVEIWNLGASTQDP----TVVSVAN-PGVKLTSLLFASETDCVLVGDSEGRVSVYKL 750          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: wdr34 (WD repeat domain 34 [Source:NCBI gene;Acc:103022287])

HSP 1 Score: 70.4774 bits (171), Expect = 3.642e-12
Identity = 74/347 (21.33%), Postives = 151/347 (43.52%), Query Frame = 2
Query: 1400 ICGFSLK----NLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNN--INSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNK------TAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNL 2401
            +C ++L     N K P+ VI T +  MC+  H  R + +A G Y+G V V++ +   +    ++ ++   +  H + V  VKW+  +               DL  LS    G+++LW + E   G++ L +    +   +      +           +  +S +D+     ++++G++ G +++   S + + A    N E            +A  G + S+ ++ +H N+F+S   DG  ++ + L   + +L + + +  V   +WS     V AAVT   ++ V+DL      P    T+  +      +  +  F+P    +AV ++ G V I+++S  L
Sbjct:  158 VCTWNLDRSKLNPKQPDMVIDTATPVMCVSFHPLRPSLIAGGLYSGEVIVWDTS---STQDPVLAQTGISQDTHREPVYEVKWVPGARRG------------DLAVLSACSGGRILLWSV-EAAEGRLSLTSGYALVRQQVPQSSSSNKSRGGTNIGVTSLTLSPWDLD----SFLVGSEGGLVLKCAFSSQ-TVAAVPPNGESVALRAPAQFSFSARAGPVHSLHFSPFHRNLFVSVGTDGLAQIHSMLQPRA-LLTMRVSDSYVFGVRWSPVRPLVFAAVTGQGLVQVFDLGRRSLRPAA--TIDQNTGGQPAYCLE--FSP-RQLLAVGNADGTVNIWQLSAEL 477          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 61.2326 bits (147), Expect = 3.446e-9
Identity = 72/330 (21.82%), Postives = 131/330 (39.70%), Query Frame = 2
Query: 1283 EQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHS--MHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGIT-YIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSP 2260
            + N++    T + W P  S  L +      F   S  M  +   + ++    PE  +  +S  +CL+ +   S+ +  G YNG +A ++    +  +Q +   ++  E  H D V  V W+ +S T  D             F S   DG+V+ W I +       L+ +        + KLD          QA    S +      T +++GT+ G ++         N    + +E      + H G I S+  N + P  FL+   D + ++W+    ES ++    +   ++D  WS    +V   V  D  + V+D L  ++ P
Sbjct:  149 DPNEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDT---RKGSQPVEMSTI--EHSHRDPVYKVIWL-QSKTGTD-------------FFSASTDGQVLWWDIRKMSEPTERLVLDP-----SKKGKLD----------QALGAISLEFETTMPTKFMVGTEQGMVVS-------CNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVG-DWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDP 436          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 60.8474 bits (146), Expect = 4.035e-9
Identity = 67/327 (20.49%), Postives = 131/327 (40.06%), Query Frame = 2
Query: 1289 NQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHS--MHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSP 2260
            N++    T + W P  S  L +      F   S  M  +   + ++    PE  +  +S  +CL+ +   S+ +  G YNG +A ++    +  +Q +   ++  E  H D V  V W+ +S T  D             F S   DG+V+ W I +       L+   ++   + +L   +   +++F+                 +++GT+ G ++         N    + +E      + H G I S+  N + P  FL+   D + ++W+    ES ++    +   ++D  WS    +V   V  D  + V+D L  ++ P
Sbjct:  159 NEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDT---RKGSQPVEMSTI--EHSHRDPVYKVIWL-QSKTGTD-------------FFSASTDGQVLWWDIRKMSEPTERLV---LDPSKKGKLDQALGAISLEFETTMPT-----------KFMVGTEQGMVVS-------CNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVG-DWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDP 444          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004773.1 (pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 gene:ENSPMAG00000004320.1 transcript:ENSPMAT00000004773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.536 bits (667), Expect = 2.456e-78
Identity = 179/563 (31.79%), Postives = 273/563 (48.49%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAIS----PINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            +L ++    ER  QT  N +RE    TE P    FS +V Q  +YD Y EE+ R EK      +            P   K+ + + +  + +  + +   ++ERM+  N   +I  DF  ++D +DE R+   GTLLPLW+ +C +        A+ +T          VT + W P Y DL ++  G Y F      G +  F+LKN   PEFV  T SG M +D+H  R + VA G Y+G+VAVYN+A     +     RS  R   H D V  VKW  +   N            +L F SV  DG+V  W + ++ +  + ++  ++       L  D    T+       + +SFD H      +++GT+ G I+  K S+  S+         F     AH   + ++ WN +H  VF S S D SLK+W      + V   DL   V D  W+ +S+TV AAVTAD  ++V+D+ +++   LC  + +S+KK  +  LT + FNP+   + V D RG+V   K+SPNLR+ PKE+KG E  RGP+ E   L+ ++
Sbjct:    3 KLTNQFNFSERASQTFNNPLREKSSQTEPPPRANFSATVNQWEVYDAYGEELKRQEKAKEKQQQKGGGGGRRDEGGPRATKKFTLVETQGDDITKVAKAAKIIERMVNQNTFDDIAQDFRYFEDASDEYREQ-DGTLLPLWRFQCEQ--------ARRLT----------VTALCWNPCYHDLFVVGFGSYEFQKQG-RGALVVFTLKNPSFPEFVFATESGVMGVDVHDARPHLVAAGLYDGTVAVYNLA--APVDAQPSHRSSARSGKHTDPVWQVKWQRDDLDN------------NLNFFSVSSDGRVASWTLIKNELLCMDVVKLSVEEGQAAPLGEDPALETLS------SGTSFDFHRQIDHMFLVGTEDGTIL--KCSKAYSSQ--------FLDTYDAHHMAVEAVRWNPFHTRVFASCSADWSLKIWEHTAKWAPVFTFDLGAAVGDVAWAPYSSTVFAAVTADGKVHVFDVNVNKYEALCTQS-VSTKKHTK--LTHVAFNPSQPVLIVGDDRGVVSSLKLSPNLRRVPKEKKGQEAARGPEAETAKLERLL 512          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000105.1 (pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 gene:ENSPMAG00000000091.1 transcript:ENSPMAT00000000105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.450e-12
Identity = 78/293 (26.62%), Postives = 133/293 (45.39%), Query Frame = 2
Query: 1607 HIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENIS---------SFDIH-EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFN-PNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGP 2449
            H+ +V  V+W+      L+Q      +   L   S+  DG+V  W + +       L   ++            +   V+   + +N +           D H +D   Y+ GT+ G I          +    S SE    + +AH G +  ++W+ + P VFLS S D S+++W  ++L S VL +   +  V D  WS HS T+LAA+TA   ++V+DL  S   P+    L+S  +   V +T++ F+    H + V DS G V +Y++   L+ K +  +  EV+ GP
Sbjct:    2 HMGAVWQVQWV-----RLEQGGGGEDRGETLT--SISADGRVTRWAVRKG------LDCQDLMRLKRTGEGRTRRTAGVEGQRERKNEALIWRLACGTCVDFHPQDSNVYLAGTEEGFI----------HRCSCSYSEQHLQSYSAHQGPVYRVLWSPFEPEVFLSCSSDWSVRLWR-VDLTSPVLTLQCGSQAVLDVAWSPHSPTLLAALTA-EALHVWDLSSSTLDPV----LVSPGR-RGVHMTRVAFSRAPGHCLLVGDSDGHVTLYQLKGLLQTKVRSPRPGEVSSGP 264          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.345e-11
Identity = 83/351 (23.65%), Postives = 144/351 (41.03%), Query Frame = 2
Query: 1397 NICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNF----TVKFDNQAE---NISSFDIHEDGITYIIGTKIGHIIQSKL------SRELSNATFSSNSEIFGSNKTAHTGMITSIMWN-FYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKND-VTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHT-IAVSDSRGIVVIYKMSPNL 2401
            N+C   L    +P+  +      +CL  H      +A G  +G V V++ +Q +     L+  S      H   VT V+W++              Q   L  +S G DG V+ W++         L T  I     N + L  K+     T+    Q+E    I++F + ED    + G + G +++  L      +R+        +  +F   K  H G + ++ ++ F    V + A  DG ++V++ L L   VL +      V  A WS     VLAA TA+  + ++DL I +  P+  H + +S  +  V  + + FNP     +AV    G   ++ +   L
Sbjct:  172 NVCRRGLIP-DMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDTSQEEDP---LLAHSGVNATTHQQPVTQVQWVHSPG-----------QSRVLLLMSAGLDGCVMTWRVE--------LSTRKITP--NNRVVLLAKHLPSTSTLSKKVQSELPLGITAFSLSEDSSMCVAGLEGGQVVRCLLEPLEQPTRKDQPPLNRKSPALFPFVK--HQGPVYAVNFSPFNRRGVSVQAGTDGQVRVFSAL-LHDPVLVVRAATSYVLAAAWSPARPLVLAASTAEGELLLFDLAIKDSGPV--HCIQASPSLSPV--SCLAFNPKQPGLLAVGLQSGAARVWTLPSEL 490          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 56.225 bits (134), Expect = 2.086e-8
Identity = 85/379 (22.43%), Postives = 148/379 (39.05%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKV-PEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWI-YESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIH-----EDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMW-------NFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNL 2401
            +T + W  +Y +LL+ T  +   S H   G    ++ K  K  PE+V +  S  M     R   N V  G Y+G + +++   +++     V R+      H   V  V  +  ++A NL               +SV  DG++  W +      +D +  +H  + +I          DV NF                       ++G++ G +  +   R  S A  S   E+F      H G +T I         +F H  +FL++S D ++K+W T N +      D  + V D  WS    ++ A+V     + +++L    + P    T+     + RV  T      +   +AV DS G + IY++   L
Sbjct:  245 ITSLDWSAQYPELLVATYNNNEDSPHEPDGVALVWNTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWD---NRSNRMTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNL---------------ISVSTDGRMCSWSLDMLSQPQDSMELVHKQSKSIAVTCMTFPVGDVNNF-----------------------VVGSEEGSVYTA--CRHGSKAGIS---EVF----EGHQGPVTGIHSHSAAGPIDFSH--LFLTSSFDWTIKLWTTKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNLNSDTEVPAASVTIDGCPALNRVRWTH-----SGRELAVGDSEGHLWIYEIGEQL 566          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Match: TEX1 (Protein involved in mRNA export; component of the transcription export (TREX) complex [Source:SGD;Acc:S000005197])

HSP 1 Score: 48.9062 bits (115), Expect = 2.130e-6
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 2
Query: 2012 AHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDL 2239
            AHTG IT I  + +  N F++ S+DG+  VWN  +L   ++  DL + VT     CH   +L   T D M+Y YDL
Sbjct:  251 AHTGPITEIKMDPWGRN-FITGSIDGNCYVWNMKSLCCELIINDLNSAVTTLD-VCHLGKILGICTEDEMVYFYDL 324          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 276.174 bits (705), Expect = 5.383e-82
Identity = 187/551 (33.94%), Postives = 273/551 (49.55%), Query Frame = 2
Query:  794 SKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHED-GITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRK--KPKER-KGVE 2434
            SK   +L ++    ER  QT  N  RE G  TE P    FS S  Q  IYD Y+E++ R EK     S+  +         K+L+ +    + +  + +P  ++ERM+  N   +I  DF  W+DP+DE R+   GTLLPLWK    K  R                    VT + W P Y+DL  +  G Y+F      G +  FSLKN   PE+ I T SG MCLDIH    + +A GFY+GSVAVY+I++   K    + +S  +   H D V  VKW  +   N            +L F SV  DG+V+ W I +  +    +I   +    E      +K+            +SFD H+     +++GT+ G I       + S    S+  + F     AH   + S+ WN +HP  F+S S D ++K+W+  +LE  +   DL + V D +W+ +++TV AA TAD  I+VYDL +++  PLC  ++++ KK     LT + FNP+H  + V DSRG V   K+SPNLRK  +PKE+ KGVE
Sbjct:  151 SKKEQKLTNQFNFSERASQTYNNPYRERGTATEPPPRANFSASANQWEIYDAYVEDLERQEKIKEKESRKTQTLKKEEDKKKKLTQVEMQGDDITRISKPAQIVERMVNQNTYDDIAQDFKYWEDPSDEFREP-DGTLLPLWKFSWEKSKRL------------------AVTSLCWNPIYNDLFSVAHGSYDFLKQDGGGAMSFFSLKNPSYPEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEKMNKP---LHQSTAKTGKHTDPVWQVKWQKDDLDN------------NLNFFSVSSDGRVVQWTIVKSELSHTDIINLELPEKSEGPEGTQIKSLGCG--------TSFDFHKTINYLFLVGTEEGKI------HKCSKTYTSTYLDTFD----AHHMSVYSVRWNPFHPKTFISCSADWTVKIWDHTHLEP-MFTFDLNSSVGDVQWAPYASTVFAACTADGKIHVYDLNVNKYEPLCEQSVVAKKKSK---LTHLAFNPDHPILIVGDSRGYVNSLKVSPNLRKATQPKEKAKGVE 645          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO34474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP67])

HSP 1 Score: 91.2781 bits (225), Expect = 4.581e-20
Identity = 87/332 (26.20%), Postives = 138/332 (41.57%), Query Frame = 2
Query: 1427 KVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWI-YESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHL-------ITNNINSWMENELKLD--VKNFTVKFDNQAENISSFDIHE-DGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            + PE V +  +G   LD      N +AVG Y+G++A+YNI   +  +      S      H   V  ++W+  E   N D+        +D   +S+  DG+V  W I + G     L       +T        +E K D  +  F   F         FD    D   Y+ GT+ GH+ +   S           +E +  +   HTG I  + WN  +P  FL+ S D S+++W+       +  +     V D  WS   AT+ A V  D  + ++DL ++   P     ++S   +    LT +LF  N  TI V DS G V +Y++
Sbjct:    8 QYPERVFHLNTGVTALDFSGAHPNLLAVGLYDGTIAIYNI---RCTDDSPALDSSESVGKHTSPVWQLQWVDREQGGNGDE--------HDEILVSISADGRVTKWSIRK-GFESADLMKLKRINVTKQKAGGGGSERKSDALISRFAAGF--------CFDFSPNDANIYLAGTEEGHVHKCSCSY----------NEQYLESFHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDRQFPVMSFLSSTKSVNDISWSPDCATLFACVN-DRAVEIWDLSLNTLDP-----VVSFVPVQDCKLTTVLFALNTATILVGDSEGQVTVYQL 303          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 75.8702 bits (185), Expect = 2.682e-14
Identity = 90/427 (21.08%), Postives = 179/427 (41.92%), Query Frame = 2
Query: 1172 ADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLL--TIGHYNFSIHSMHGNICGFSLK----NLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKT----AHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKK-PKE 2419
            A+ I  +F G  +  W+ K S +  ++    +LI     NQ+   +T + W    S +      + H ++  H    ++C ++L     N+   +  +   S  + L  H      +A G +NG V +++++    +++ LV  S      H + V  + W+      LD  +   K     + LS   DGKV+LW++       + L+   I       +   ++    K D +    +    HED   +++G++ G I +  ++         ++S   GS  T     H G + S+  + YH N+FL+   DG+++++  L  +  +        +   +WS     V +  T D  + +YD+ ++  +P+     +S KK        I        +A  DS G++ I+++S  L  + P+E
Sbjct:   86 ANAISHAFDGYDVD-WEEKSSAVTCQH----RLINQASGNQL--QITSLSWNSTGSVIAAAYGRLDHEDWCTHK--SSLCTWNLDRRGINVNKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDLS---CEDEMLVASSGMGNDSHREPVNKIMWL------LDPDSKGKK----YQILSASGDGKVLLWQVPPIESQDLRLVGGYI--LQTGAVPRSLRTSKAKGDMEMGVTTLSFSHEDKTLFVLGSEAGGIFKCSVNSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTMLQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPVTT-IDVSDKKPVHTLEYNIH---RRQLVATGDSEGVIKIWRLSDELTTQGPRE 484          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 50.0618 bits (118), Expect = 3.382e-6
Identity = 77/374 (20.59%), Postives = 145/374 (38.77%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKV-PEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIH-----EDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYII---GTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNL 2401
            VT + W  +Y +LL+ +  +   + H   G    ++LK  K  PE++ +  S  M     +   N +  G Y+G + +++   +++  +  V R+      H   V  V  +          T N   +     +SV  DGK+  W +      +D +   +  + ++     + L  DV NF V               E+G  Y     G+K G          +S+        + G +  + +G I     +F H  +FL++S D +LK+W+  +   +    D  + + D KWS     + A V     + +++L    + P+      S+       L  + +  +   I+V D  G V IY +   L
Sbjct:  135 VTCLDWSNQYPELLVASYNNNEDAPHEPDGVALIWNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWD---NRSSKRTPVQRTPLSATAHTHPVYCVNVV---------GTQNAHNL-----ISVSTDGKMCSWSLDMLSQPQDSMELQYKQSKSVAVTCMSFLAGDVNNFVVG-------------SEEGTVYTACRHGSKAG----------ISDVFEGHYGPVTGIDTHSASGPI-----DFSH--LFLTSSFDWTLKLWSHKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRLDLWNLNSDTEVPIA-----STATESLTALNNVQWTQSGQQISVGDDDGRVYIYDVGEQL 456          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 187.963 bits (476), Expect = 1.237e-51
Identity = 136/470 (28.94%), Postives = 218/470 (46.38%), Query Frame = 2
Query: 1073 LGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            L  + E   ++ER +  N   +I +DF  ++DP+DE      GTL+PLW  +       Y+    L            V+ + W  RY D+  + +G  ++      G +  +SLKN   PE+   T SG  C+DIH ++S  VA GFY+G+VAVYN+   K K    VC S      H+D V  + W  +   N            +  F SV  DG+++ W           L+  N++ ++ ++       +            SFD              G I+      + S        E++     AH   + ++ WN +HP VF+S S D ++K+W+   + + + +IDLK  V D  +S H++TV AAVT    +Y YD+ IS    +C   +++ +K     LTK+ FNP H  I + D +G +  +K+SPNLRK+PK +KG E+   P+ E   L+  +
Sbjct:   34 LSKIRESCKLMERAVVQNSLCDIAIDFKFYEDPSDEFI-GHEGTLMPLWNFR-------YKGTKHL-----------TVSALCWNRRYLDMFAVGMGTEDYFDQQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKP---VCASSPETGKHMDPVIQLCWQKDDINN------------NHNFYSVSLDGQIVSWT----------LVKVNMHVYVFSQ-------YLEVLQLYLLLNLSFD-----------PLYGQILVFFFFFQCSMTYTGHPMEVY----DAHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDH-TVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEAICQQEVVNKRKGQ---LTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNKKGQEIPIDPQEEVGKLEKFL 433          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai1.2 (dynein, axonemal, intermediate chain 1, paralog 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1302])

HSP 1 Score: 166.007 bits (419), Expect = 5.074e-44
Identity = 133/465 (28.60%), Postives = 214/465 (46.02%), Query Frame = 2
Query: 1082 LLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNS-EIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQ 2473
            L+E  ++L    Y +     L+DF  ++DP+DE      GTL+PLW  +      K+   + L      +  +    ++  C   S +LL    +++       G +  +SLKN   PE+   T SG  C+DIH ++S  VA GFY+G+VAVYN+   K K    VC S      H+D V  + W                                           Q   I NN N +    + LDV   ++ F     N+           +++GT  G I++  +       T++ +  E++     AH   + ++ WN +HP VF+S S D ++K+W+   + + + +IDLK  V D  +S H++TV AAVT    +Y YD+ IS    +C   +++ +K     LTK+ FNP H  I + D +G +  +K+SPNLRK+PK +KG E+   P+ E   L+
Sbjct:   42 LMETKILLFFFFYFDS----LIDFKFYEDPSDEFI-GHEGTLMPLWNFRYK--GTKHLTVSALCWMQSIHTCTNLKKNVFICVFVSSVLLFPEDYFD---QQCGGMVLIYSLKNPTYPEYAYKTASGVRCVDIHPHKSYLVAAGFYDGNVAVYNLKVEKLKP---VCASSPETGKHMDPVIQLCW-------------------------------------------QKDDINNNHNFY---SVSLDVSCTSIDFHKDIPNL-----------FLVGTLEGMILKCSM-------TYTGHPMEVYD----AHLLSVGTVKWNPFHPKVFISCSCDMTVKIWDH-TVTTPISNIDLKEPVEDVAFSPHTSTVFAAVTRRGTVYFYDVSISIYEAICQQEVVNKRKGQ---LTKLEFNPIHLIIIIGDGKGCIHSFKLSPNLRKRPKNKKGQEIPIDPQEEVGKLE 421          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: wdr78 (WD repeat domain 78 [Source:NCBI gene;Acc:101174321])

HSP 1 Score: 103.219 bits (256), Expect = 3.638e-22
Identity = 97/365 (26.58%), Postives = 160/365 (43.84%), Query Frame = 2
Query: 1304 NVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIH--EDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVT-DAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            +V+ M W  +  DLL +  G ++ S +   G +C +SLKN   PE V+   S    LD    R +++AVG ++GS+A+Y+I Q+       +  S C    H+  V  ++W      N  +     ++  ++  +SVG DG++I W +    +G   L+      +   + K           +    +   D H  E GI Y+ GT  G I          +    SN++ +      H   +  + W     ++FLS S D ++++W T N  + +L       V  D KWS   ATV AAV  D  + V+DL +S     C   +I    +  V L  +LF  +   + V DS G V +Y +
Sbjct:  393 SVSSMAWNKKNPDLLAVGYGEFD-STNERAGLVCCWSLKNPTWPERVVRCESAVTSLDFSATRPSHLAVGLFDGSIAIYDI-QNPDSISLFLDSSKCPS-RHLGPVWQLRW------NQQEFGLPAEERLEV-LISVGADGRIIKWVVCTGNLGHTELMKLKRTIYKNPDAKTTESISQSLISSLIPAL-CLDFHPTEPGI-YLTGTWEGLI----------HKCSCSNNQQYLDTYRKHYCAVNYVAWCPLSDDIFLSCSADCTIQLW-TQNQHNPMLSFSTTRKVVHDIKWSPKWATVFAAV-YDEQLEVWDLNLS-----CLSPVIVQPALPGVRLASLLFASHTDCVVVGDSCGQVTVYHL 728          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: ENSORLT00000002152.2 (WD repeat-containing protein 78 [Source:NCBI gene;Acc:101160807])

HSP 1 Score: 80.8777 bits (198), Expect = 2.727e-15
Identity = 88/379 (23.22%), Postives = 162/379 (42.74%), Query Frame = 2
Query: 1307 VTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILW----------------KIHED--GVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKM 2389
            +T M W  +  ++L ++    + S  S    IC +SL N   P+ +    S    +D   +   ++AVG Y+GSVA+YN+ Q + +   +   S C   H       ++ +++ A N  +S  +  +  ++  +S+  DG++ +W                +IH+D  G G   ++   I S +     LD                 F   E  I Y++G+  G I +  L+          N++ F  +   H   +  I W+ + P++FLS S D ++++W    L   +    + + V   +WS   +TV AA+     + V++L  +  SP+  H   +      V LT +LF      + V DS G V +Y++
Sbjct:  401 ITSMTWNKKNLNILAVSYSDCDPS-SSRASFICCWSLNNPLWPQRIFSCPSRVASMDFSSSDHGHLAVGMYDGSVAIYNV-QIQDRGACVATSSKCPNRH-------LRPVWQVAWNKQESKFSGLEAEEV-LVSMSADGRISMWQRCNNHLECIDLMKIRRIHDDKRGNGVSKMVGETILSEVSPGHCLD-----------------FHPKESDI-YLVGSWDGLIHKCSLN----------NNQQFLDSYQKHLLAVNDIQWSPFSPDLFLSCSSDCTIQLWRHTCLSPLLSFKSVHSQVCAVRWSPERSTVFAAIYRQ-QVEVWELSSNILSPVVVHHAAAG-----VTLTALLFARGTDCVLVGDSEGKVTVYQL 735          
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 59.6918 bits (143), Expect = 9.951e-9
Identity = 90/402 (22.39%), Postives = 158/402 (39.30%), Query Frame = 2
Query: 1289 NQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHS-MHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVT---DAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVI 2482
            +Q+   VT + W P     L        F   S +  +   + ++   +PE V+   S  +CL+ +   S  +  G YNG VA ++    +   Q +   S+  E  H D V  V W+ +S T  D  +A+              DG+V+ W + +       LI   ++   E  L   +   +++F+                 +++GT+ G II         N    + +E        H G + ++  N + P  FL+   D   ++W+    ES +  I+ KN V+   DA WS    +V   V  + ++ ++D+L ++  P    TL  S K+    L  I    N   +A    +G   + ++S  L    K  K +       FERE  +  I
Sbjct:  156 HQVKRTVTSLSWSPDRGRKLAAAYSSVVFQQTSQLSTDSYIWDVEKPSIPEMVLKPPSPLVCLEYNPRVSYTLMGGCYNGQVAYWDT---RRGCQTVAYSSV--EHSHKDPVYKVIWL-QSKTGTDAFSAST-------------DGQVLWWDVRKLSEPTERLI---LDLSKEGNLGRALGGISLEFEITMPT-----------KFMVGTEEGLIIS-------CNRKAKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVG-DWCARIWSEDIKESSI--INTKNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDP----TL--SVKVCDGGLYSIRVEENGRLVACGSEKGEATLLEISSGLSVPQKNEKSL---VAAMFERETKREKI 505          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000023117.1 (SMESG000023117.1)

HSP 1 Score: 1546.95 bits (4004), Expect = 0.000e+0
Identity = 763/765 (99.74%), Postives = 765/765 (100.00%), Query Frame = 2
Query:  197 SKKDLRKEHTKVLKAENPFIQKERIYYNYKLRSYVFPTNVEHMVCHFQQDCKLEYRPKDTVDSTINENLDSLSVXXXXXXXXXXXXXXLCELSTNREVSLSEILLDTPQEKETPSKFGRVTFNNQERKWHVRVENIDFTNSENNVTVEEISVRNLGCSGENKNPTKTRRIRRFSGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVIDRF 2491
            S++DLRKEHTKVLKAENPFIQKERIYYNYKLRSYVFPTNVEHMVCHFQQDCKLEYRPKDTVDSTINENLDSLSVENENNNFDFNSANDLCELSTNREVSLSEILLDTPQEKETPSKFGRVTFNNQERKWHVRVENIDFTNSENNVTVEEISVRNLGCSGENKNPTKTRRIRRFSGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVIDRF
Sbjct:    5 SEEDLRKEHTKVLKAENPFIQKERIYYNYKLRSYVFPTNVEHMVCHFQQDCKLEYRPKDTVDSTINENLDSLSVENENNNFDFNSANDLCELSTNREVSLSEILLDTPQEKETPSKFGRVTFNNQERKWHVRVENIDFTNSENNVTVEEISVRNLGCSGENKNPTKTRRIRRFSGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNATFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERKGVEVNRGPKFERENLQHVIDRF 769          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000066594.1 (SMESG000066594.1)

HSP 1 Score: 220.32 bits (560), Expect = 3.468e-61
Identity = 167/537 (31.10%), Postives = 256/537 (47.67%), Query Frame = 2
Query:  833 CERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKY---IEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLV-VLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELKLDVKNFTVKFDNQAENISSFDIHEDGI-TYIIGTKIGHIIQSKLSRELSNATFSSNSEI-FGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNLESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCCHTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKERK 2425
            C R  QT  N ++     +E P    FS ++ Q+ IYD Y    +   R  K    N     QK I P + KR+S +   + G    + P+V +LERMI  N   EI  DFS ++DPADE R    GTLLPLWK    K  RK  V                 T + W   Y DL +++ G Y        G ICG+SLKN   PE+ ++T S  + +D++ N    +  G  +G V + ++ +  + N  +   S      H D    VKW+     N+            + F S+  DG++  W      V +  L   +I +  +  L +D++    +F    E+ +   +H     T+++GT+ G+I          N+   SNS+     N+  H  +I  ++W+ +HP++F S S D ++ +WN     + +  +DL   VT   W+ +S+TVLAAVT D  + VYD  I+   PL C  + SSK  ++V LT+I+F+ N+  I + DSRG     K+SPNLRK PK +K
Sbjct:  178 CHRATQTLNNPLQTKITQSEYPPRKMFSDNLDQSVIYDSYEIDFKRQNRINKSRLTNFG-GSQKIIVP-DKKRISLVHEKHFGDITPILPVVKILERMINLNTFDEIAQDFSYYEDPADEFRFDSHGTLLPLWKFSFDK-TRKLPV-----------------TSIIWSSFYKDLFVVSHGMYEIVSFEEQGAICGYSLKNPSYPEYTLFTKSPVLAIDMNINDHRLICAGLLDGGVMIISLHEKSSSNPVIRLSSNMHSKKHRDPCWQVKWLPIEKDNI------------MAFYSISSDGRICEW-----SVNKYELNCQDIVALRQINLPIDMETVADRF---LESGTCIALHPKKYHTFLVGTQDGNIYY----HLTMNSNMKSNSDYSMTFNENIHKMIIYQLVWSNWHPDIFASCSADWTIGIWNCRQ-SNPLFVLDLGFAVTSIAWAPYSSTVLAAVTVDRKVRVYDFSINRLEPLVCQVVGSSK--HKVSLTQIVFSDNYPIILIGDSRGNTHSMKLSPNLRKIPKVKK 667          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001830.1 (SMESG000001830.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.205e-47
Identity = 115/355 (32.39%), Postives = 174/355 (49.01%), Query Frame = 2
Query:  683 NPTKTRRIRRFSGNEVEDEIDGEDTDIVEMDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKI 1747
            NP   + I RF  N   +++  +    VE + + K       +L ++   CER  QT  N  R+ G  TE P    FS ++TQ  IYD Y+E+  + ++     + F  +  +   + K+L+ I +  + +  + +P+ ++ERM+  N   EI  DF  ++DP+DE R    GTLLPLW+    K        AK I           VT + W P+Y DL  +  G Y+F   S +G IC ++LKN   PE++  T SG + LD+HR+  + + VGFY+G+V VYNI Q K+   G +  S  +   H D V  VKW  E   N            +L F SV  DG+V  W +
Sbjct:   64 NPHAPQNIVRF--NFKTEDLSSQKETPVEPEVSEK-------KLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTK--VEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQ-QGTLLPLWRFTFDK--------AKKIA----------VTALSWSPKYHDLFAVGHGSYDFMKQS-NGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKS---GPLYLSTAQTGKHTDPVWEVKWQREDFDN------------NLNFYSVSADGRVTSWTL 372          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 173.326 bits (438), Expect = 9.846e-47
Identity = 106/313 (33.87%), Postives = 158/313 (50.48%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKI 1747
            +L ++   CER  QT  N  R+ G  TE P    FS ++TQ  IYD Y+E+  + ++     + F  +  +   + K+L+ I +  + +  + +P+ ++ERM+  N   EI  DF  ++DP+DE R    GTLLPLW+    K        AK I           VT + W P+Y DL  +  G Y+F   S +G IC ++LKN   PE++  T SG + LD+HR+  + + VGFY+G+V VYNI Q K+   G +  S  +   H D V  VKW  E   N            +L F SV  DG+V  W +
Sbjct:  154 KLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTK--VEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQ-QGTLLPLWRFTFDK--------AKKIA----------VTALSWSPKYHDLFAVGHGSYDFMKQS-NGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKS---GPLYLSTAQTGKHTDPVWEVKWQREDFDN------------NLNFYSVSADGRVTSWTL 429          
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Match: SMESG000001839.1 (SMESG000001839.1)

HSP 1 Score: 172.94 bits (437), Expect = 2.134e-46
Identity = 106/313 (33.87%), Postives = 158/313 (50.48%), Query Frame = 2
Query:  809 QLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSVSVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNEGLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLWKIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHYNFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFYNGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQSTANCKQIYDLKFLSVGEDGKVILWKI 1747
            +L ++   CER  QT  N  R+ G  TE P    FS ++TQ  IYD Y+E+  + ++     + F  +  +   + K+L+ I +  + +  + +P+ ++ERM+  N   EI  DF  ++DP+DE R    GTLLPLW+    K        AK I           VT + W P+Y DL  +  G Y+F   S +G IC ++LKN   PE++  T SG + LD+HR+  + + VGFY+G+V VYNI Q K+   G +  S  +   H D V  VKW  E   N            +L F SV  DG+V  W +
Sbjct:  176 KLTNQFNFCERASQTYNNPARDRGNVTEPPPRSNFSDNITQWVIYDAYLEDFEKQQQSKEKKATFGTK--VEEKSKKKLTSIETAADEMSKIAKPIKIVERMVNQNTFDEISQDFKYYEDPSDEYRDQ-QGTLLPLWRFTFDK--------AKKIA----------VTALSWSPKYHDLFAVGHGSYDFMKQS-NGLICFYTLKNPSYPEYIFETQSGVLSLDLHRSLPHMLCVGFYDGAVGVYNITQRKS---GPLYLSTAQTGKHTDPVWEVKWQREDFDN------------NLNFYSVSADGRVTSWTL 451          
The following BLAST results are available for this feature:
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAI15.078e-7231.65dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
DNAI15.363e-7231.65dynein axonemal intermediate chain 1 [Source:HGNC ... [more]
WDR781.704e-2125.07WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR341.098e-1724.73WD repeat domain 34 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR783.250e-1623.62WD repeat domain 78 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dyci-11.356e-822.83DYnein Chain, light Intermediate [Source:UniProtK... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93132.024e-5629.54gene:FBgn0034566 transcript:FBtr0071521[more]
CG93132.024e-5629.54gene:FBgn0034566 transcript:FBtr0345666[more]
CG93132.110e-5629.54gene:FBgn0034566 transcript:FBtr0342788[more]
Dic61B1.004e-721.64gene:FBgn0263988 transcript:FBtr0072538[more]
Dic61B1.496e-721.64gene:FBgn0263988 transcript:FBtr0072539[more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.24.241e-7733.28dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.11.917e-6230.11dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
dnai1.11.550e-6130.48dynein, axonemal, intermediate chain 1, paralog 1 ... [more]
wdr781.087e-2527.51WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr781.087e-2527.51WD repeat domain 78 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb51.967e-2525.73cAMP responsive element binding protein 5 [Source:... [more]
creb52.817e-2525.73cAMP responsive element binding protein 5 [Source:... [more]
creb53.526e-2527.55cAMP responsive element binding protein 5 [Source:... [more]
rwdd2b1.438e-1623.01RWD domain containing 2B [Source:Xenbase;Acc:XB-GE... [more]
ogfod34.169e-921.812-oxoglutarate and iron-dependent oxygenase domain... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaic16.969e-7130.32dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
Wdr784.984e-2025.00WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
Wdr344.668e-1823.38WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:191... [more]
Dnaic11.158e-1439.33dynein, axonemal, intermediate chain 1 [Source:MGI... [more]
Wdr782.193e-928.40WD repeat domain 78 [Source:MGI Symbol;Acc:MGI:238... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UI46|DNAI1_HUMAN2.576e-7131.65Dynein intermediate chain 1, axonemal OS=Homo sapi... [more]
sp|Q16959|DYI2_HELCR4.188e-7030.93Dynein intermediate chain 2, ciliary OS=Heliocidar... [more]
sp|Q8C0M8|DNAI1_MOUSE4.875e-7030.32Dynein intermediate chain 1, axonemal OS=Mus muscu... [more]
sp|Q5XIL8|DNAI1_RAT8.758e-6929.96Dynein intermediate chain 1, axonemal OS=Rattus no... [more]
sp|Q32KS2|DNAI1_BOVIN1.833e-6630.78Dynein intermediate chain 1, axonemal OS=Bos tauru... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L4T25.831e-8533.56WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
C3Y1H71.022e-8134.95WD_REPEATS_REGION domain-containing protein OS=Bra... [more]
A0A4S2L4931.037e-8133.22WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A075A3K84.425e-8133.28WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A3B3SKD92.360e-7832.89Dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.25.303e-7531.44dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr784.323e-2427.81WD repeat domain 78 [Source:NCBI gene;Acc:10304656... [more]
wdr343.642e-1221.33WD repeat domain 34 [Source:NCBI gene;Acc:10302228... [more]
dnai2b3.446e-921.82dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b4.035e-920.49dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004773.12.456e-7831.79pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 g... [more]
ENSPMAT00000000105.11.450e-1226.62pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 ... [more]
wdr341.345e-1123.65WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
dync1i2a2.086e-822.43dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TEX12.130e-639.47Protein involved in mRNA export; component of the ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO361985.383e-8233.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344744.581e-2026.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432312.682e-1421.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490793.382e-620.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai1.21.237e-5128.94dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
dnai1.25.074e-4428.60dynein, axonemal, intermediate chain 1, paralog 2 ... [more]
wdr783.638e-2226.58WD repeat domain 78 [Source:NCBI gene;Acc:10117432... [more]
ENSORLT00000002152.22.727e-1523.22WD repeat-containing protein 78 [Source:NCBI gene;... [more]
dnai29.951e-922.39dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
back to top
BLAST of Dynein intermediate chain 2, ciliary vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023117.10.000e+099.74SMESG000023117.1[more]
SMESG000066594.13.468e-6131.10SMESG000066594.1[more]
SMESG000001830.11.205e-4732.39SMESG000001830.1[more]
SMESG000001839.19.846e-4733.87SMESG000001839.1[more]
SMESG000001839.12.134e-4633.87SMESG000001839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018570 ID=SMED30018570|Name=Dynein intermediate chain 2, ciliary|organism=Schmidtea mediterranea sexual|type=transcript|length=2502bp
GTATAGAAGATCTTGATGAAAAGAACTTTTATACAGAAAGTGTTACACTT
ATAAATTGAATTTGTTTAAACATATTAAACTCAGCAATAAACTAACAAAC
TATAAATTTAATTTATGGAAAAAATATCAGAAGAAGTAAGATTAAGAAAT
TTCTGGTGAATTAATAACAATGTTTGTTGTATTAAAACATTTACAATCTA
AAAAGGATCTCAGAAAAGAACATACTAAAGTTTTGAAAGCTGAAAATCCA
TTCATCCAAAAAGAACGAATTTATTACAACTACAAGTTGAGAAGCTATGT
ATTTCCTACAAATGTGGAACATATGGTCTGTCATTTTCAACAGGACTGTA
AACTTGAATATCGTCCTAAAGATACTGTTGACAGTACAATTAATGAAAAT
CTGGATTCATTAAGCGTAGAGAATGAAAATAATAATTTTGATTTTAATAG
TGCAAATGATCTCTGTGAATTGAGTACAAATAGAGAAGTTTCTCTTTCTG
AAATTTTACTGGATACACCACAGGAAAAAGAAACGCCATCAAAATTTGGA
CGGGTTACTTTTAATAATCAAGAAAGAAAATGGCATGTTAGAGTAGAAAA
TATTGACTTTACAAATTCAGAAAACAATGTTACGGTAGAAGAAATTTCCG
TAAGAAATCTTGGCTGTTCAGGAGAAAATAAAAATCCAACCAAAACTAGA
AGAATCAGAAGATTCTCTGGAAATGAAGTTGAAGATGAGATTGATGGAGA
AGATACTGACATTGTGGAAATGGATTTTACAAACAAAAGTCAGTCAAAGG
TTTTTACTCAACTTATTGATAAATCAAGAGTCTGTGAGAGAGGCATTCAA
ACTTCTTTCAATGAAGTTAGAGAAATCGGAGTGTTCACCGAATCTCCAAT
AAGTGATGAATTCAGTGTCTCTGTCACTCAAGCGACTATATATGACAAAT
ATATTGAAGAGGTTTTTAGAACTGAGAAAGGTTTATTTGCTAATTCCAAA
TTCAACAAACAGAAGGCAATCAGCCCGATAAACATGAAAAGGTTATCCCC
CATTCCGTCGGGAAATGAAGGCCTCGGCTATTTATTGGAGCCACTCGTCG
TGTTGGAAAGGATGATTTATCACAATGTTTCAACGGAAATCCTGTTAGAC
TTCTCCGACTGGGATGATCCAGCTGATGAAATTAGAAAATCTTTTACTGG
AACTTTGTTGCCGTTGTGGAAAATAAAATGTTCAAAATTAGCTCGGAAAT
ACGAAGTGAATGCAAAACTAATCACGCACGGAGAACAGAATCAAATTTCT
GGAAACGTAACCGACATGAAATGGTGTCCAAGATACAGTGATTTACTCTT
ACTGACAATTGGTCATTATAATTTTTCAATCCATTCAATGCATGGCAACA
TCTGTGGATTCAGCTTGAAAAATCTAAAAGTCCCAGAATTTGTCATCTAC
ACCATCAGTGGGGCTATGTGTTTGGATATTCACCGAAATAGATCAAATTA
TGTTGCAGTTGGATTTTACAATGGATCAGTGGCAGTGTATAATATAGCTC
AGCACAAAGCCAAAAACCAGGGACTCGTCTGCCGGAGTCTGTGTCGAGAA
ATCCATCACATCGATTCTGTCACATCGGTCAAATGGATTTATGAAAGTGC
CACAAATCTCGATCAAAGCACCGCAAATTGCAAACAAATTTATGATTTGA
AGTTTTTGTCTGTTGGAGAAGATGGGAAAGTAATTCTTTGGAAAATTCAT
GAAGATGGAGTCGGTCAAATTCATTTAATTACGAACAACATCAATTCATG
GATGGAAAATGAATTAAAATTAGACGTAAAGAATTTCACTGTAAAGTTTG
ATAATCAAGCAGAAAACATTTCATCGTTTGATATCCATGAGGACGGAATA
ACGTACATTATCGGTACAAAAATAGGCCACATAATACAGTCGAAATTGTC
TCGAGAACTGTCCAATGCAACATTTTCATCGAATTCCGAAATATTCGGTT
CCAATAAAACTGCCCATACCGGAATGATTACGTCAATTATGTGGAATTTC
TATCATCCCAATGTATTTCTGTCAGCATCTGTCGATGGTTCTTTGAAGGT
CTGGAACACGTTAAATCTAGAAAGTCATGTATTGGACATCGATCTGAAAA
ATGACGTGACGGATGCCAAATGGTCATGCCATTCTGCGACAGTTTTAGCA
GCCGTTACAGCAGATCTAATGATTTATGTGTATGACCTACTTATCTCCGA
AGATTCGCCTTTATGCTGCCATACCTTGATAAGCTCGAAGAAAATCTACA
GAGTTTTCCTTACAAAGATTCTATTCAATCCCAATCATCACACGATTGCT
GTTTCTGATAGCAGAGGTATTGTCGTGATTTATAAAATGTCACCTAATCT
AAGGAAGAAACCAAAAGAAAGAAAAGGAGTTGAAGTTAATCGAGGTCCGA
AATTCGAAAGAGAAAACCTTCAACATGTCATCGATAGATTTTAAATGTGA
TT
back to top

protein sequence of SMED30018570-orf-1

>SMED30018570-orf-1 ID=SMED30018570-orf-1|Name=SMED30018570-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=775bp
MFVVLKHLQSKKDLRKEHTKVLKAENPFIQKERIYYNYKLRSYVFPTNVE
HMVCHFQQDCKLEYRPKDTVDSTINENLDSLSVENENNNFDFNSANDLCE
LSTNREVSLSEILLDTPQEKETPSKFGRVTFNNQERKWHVRVENIDFTNS
ENNVTVEEISVRNLGCSGENKNPTKTRRIRRFSGNEVEDEIDGEDTDIVE
MDFTNKSQSKVFTQLIDKSRVCERGIQTSFNEVREIGVFTESPISDEFSV
SVTQATIYDKYIEEVFRTEKGLFANSKFNKQKAISPINMKRLSPIPSGNE
GLGYLLEPLVVLERMIYHNVSTEILLDFSDWDDPADEIRKSFTGTLLPLW
KIKCSKLARKYEVNAKLITHGEQNQISGNVTDMKWCPRYSDLLLLTIGHY
NFSIHSMHGNICGFSLKNLKVPEFVIYTISGAMCLDIHRNRSNYVAVGFY
NGSVAVYNIAQHKAKNQGLVCRSLCREIHHIDSVTSVKWIYESATNLDQS
TANCKQIYDLKFLSVGEDGKVILWKIHEDGVGQIHLITNNINSWMENELK
LDVKNFTVKFDNQAENISSFDIHEDGITYIIGTKIGHIIQSKLSRELSNA
TFSSNSEIFGSNKTAHTGMITSIMWNFYHPNVFLSASVDGSLKVWNTLNL
ESHVLDIDLKNDVTDAKWSCHSATVLAAVTADLMIYVYDLLISEDSPLCC
HTLISSKKIYRVFLTKILFNPNHHTIAVSDSRGIVVIYKMSPNLRKKPKE
RKGVEVNRGPKFERENLQHVIDRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0007368determination of left/right symmetry
GO:0030030cell projection organization
GO:0030317flagellated sperm motility
GO:0036158outer dynein arm assembly
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0030286dynein complex
GO:0036157outer dynein arm
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 422..458
e-value: 3.1
score: 13.9
coord: 696..739
e-value: 38.0
score: 7.1
coord: 605..646
e-value: 1.3E-4
score: 31.4
coord: 652..689
e-value: 19.0
score: 8.9
coord: 471..525
e-value: 0.81
score: 17.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 613..646
score: 10.174
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 595..758
e-value: 2.0E-13
score: 52.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 349..591
e-value: 7.8E-13
score: 50.2
NoneNo IPR availablePANTHERPTHR12442:SF11DYNEIN INTERMEDIATE CHAIN 1, AXONEMALcoord: 9..758
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 9..758
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 613..698
score: 9.731
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 374..739