Pyruvate kinase

Overview
NamePyruvate kinase
Smed IDSMED30018556
Length (bp)1825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyruvate kinase (SMED30018556) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyruvate kinase (SMED30018556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018556SMESG000045839.1 dd_Smed_v4_51910_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30018556SMESG000045839.1 PL08004B1E04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30018556SMESG000045839.1 PL08004B1E04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30018556SMESG000045839.1 PL08004B1E04_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30018556SMESG000045839.1 PL06012A2B10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30018556SMESG000045839.1 PL06012A2B10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30018556SMESG000045839.1 PL06012A2B10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 319/531 (60.08%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 319/531 (60.08%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 319/531 (60.08%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 319/531 (60.08%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 320/531 (60.26%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  +H +L ++L+    +  D T + A+ AVEA+    +G IIV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 294/531 (55.37%), Postives = 380/531 (71.56%), Query Frame = 2
Query:   80 RIMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            R MT        YF Q Q++    A + +EH C LD+   P   R TGI+CT+GPA  S E+++ +I  GMNIARLNFSHGS+EYH  TI  VR+   SF +  R + IALDTKGPEIRTGL+ G  +AE+ L  G  I LTTD  + E      L+VDY NI KV  +  ++Y+DDGLISL+V+ +  + + C +ENGG LGS+KG+N+PG  VDLPAVSEKD +DL F  EQ +D++FASFIR+   I  IR +LGEKGK +KIIAKIE+ EG+   DEI++  DG++VARGDLGIEIP EKVF+AQKM+I KCN+ GKPVICATQMLESM++KPRPTRAE SDVANAVLDGADCVMLSGETAKG YP++A+  MH IC+EAEA  +H  L  +L      P D++H++AIAA  AA+   A  I+++TT+GRSA   SR++P  PIL ++R+   CRQ HL+RG+ P++Y AE+   DW  D+D R+  A+ + K RGF+ +G+ +V+VTGWR G+G TNTLRIIT E
Sbjct:   30 RRMTIEEEHAGDYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSD-KRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERA-ADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 558          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 294/531 (55.37%), Postives = 380/531 (71.56%), Query Frame = 2
Query:   80 RIMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            R MT        YF Q Q++    A + +EH C LD+   P   R TGI+CT+GPA  S E+++ +I  GMNIARLNFSHGS+EYH  TI  VR+   SF +  R + IALDTKGPEIRTGL+ G  +AE+ L  G  I LTTD  + E      L+VDY NI KV  +  ++Y+DDGLISL+V+ +  + + C +ENGG LGS+KG+N+PG  VDLPAVSEKD +DL F  EQ +D++FASFIR+   I  IR +LGEKGK +KIIAKIE+ EG+   DEI++  DG++VARGDLGIEIP EKVF+AQKM+I KCN+ GKPVICATQMLESM++KPRPTRAE SDVANAVLDGADCVMLSGETAKG YP++A+  MH IC+EAEA  +H  L  +L      P D++H++AIAA  AA+   A  I+++TT+GRSA   SR++P  PIL ++R+   CRQ HL+RG+ P++Y AE+   DW  D+D R+  A+ + K RGF+ +G+ +V+VTGWR G+G TNTLRIIT E
Sbjct:   34 RRMTIEEEHAGDYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSD-KRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERA-ADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 562          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 294/531 (55.37%), Postives = 380/531 (71.56%), Query Frame = 2
Query:   80 RIMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            R MT        YF Q Q++    A + +EH C LD+   P   R TGI+CT+GPA  S E+++ +I  GMNIARLNFSHGS+EYH  TI  VR+   SF +  R + IALDTKGPEIRTGL+ G  +AE+ L  G  I LTTD  + E      L+VDY NI KV  +  ++Y+DDGLISL+V+ +  + + C +ENGG LGS+KG+N+PG  VDLPAVSEKD +DL F  EQ +D++FASFIR+   I  IR +LGEKGK +KIIAKIE+ EG+   DEI++  DG++VARGDLGIEIP EKVF+AQKM+I KCN+ GKPVICATQMLESM++KPRPTRAE SDVANAVLDGADCVMLSGETAKG YP++A+  MH IC+EAEA  +H  L  +L      P D++H++AIAA  AA+   A  I+++TT+GRSA   SR++P  PIL ++R+   CRQ HL+RG+ P++Y AE+   DW  D+D R+  A+ + K RGF+ +G+ +V+VTGWR G+G TNTLRIIT E
Sbjct:  385 RRMTIEEEHAGDYFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSD-KRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERA-ADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 913          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 293/533 (54.97%), Postives = 383/533 (71.86%), Query Frame = 2
Query:   86 MTTSNFQE----TSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            M+  +FQ+    + Y  Q Q++    A + +EH C LD+   P   R TGI+CT+GPA  S E+++ +I  GMNIARLNFSHGS+EYH  TI  VR+   SF +  R + IALDTKGPEIRTGL+ G  +AE+ L  G  I LTTD  + E      L+VDY NI KV  +  ++Y+DDGLISL+V+ +  + + C +ENGG LGS+KG+N+PG  VDLPAVSEKD +DL F  EQ +D++FASFIR+   I  IR +LGEKGK +KIIAKIE+ EG+   DEI++  DG++VARGDLGIEIP EKVF+AQKM+I KCN+ GKPVICATQMLESM++KPRPTRAE SDVANAVLDGADCVMLSGETAKG YP++A+  MH IC+EAEA  +H  L  +L      P D++H++AIAA  AA+   A  I+++TT+GRSA   SR++P  PIL ++R+   CRQ HL+RG+ P++Y AE+   DW  D+D R+  A+ + K RGF+ +G+ +V+VTGWR G+G TNTLRIIT E
Sbjct:    1 MSDDSFQKELEASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSD-KRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERA-ADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 531          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 293/533 (54.97%), Postives = 383/533 (71.86%), Query Frame = 2
Query:   86 MTTSNFQE----TSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            M+  +FQ+    + Y  Q Q++    A + +EH C LD+   P   R TGI+CT+GPA  S E+++ +I  GMNIARLNFSHGS+EYH  TI  VR+   SF +  R + IALDTKGPEIRTGL+ G  +AE+ L  G  I LTTD  + E      L+VDY NI KV  +  ++Y+DDGLISL+V+ +  + + C +ENGG LGS+KG+N+PG  VDLPAVSEKD +DL F  EQ +D++FASFIR+   I  IR +LGEKGK +KIIAKIE+ EG+   DEI++  DG++VARGDLGIEIP EKVF+AQKM+I KCN+ GKPVICATQMLESM++KPRPTRAE SDVANAVLDGADCVMLSGETAKG YP++A+  MH IC+EAEA  +H  L  +L      P D++H++AIAA  AA+   A  I+++TT+GRSA   SR++P  PIL ++R+   CRQ HL+RG+ P++Y AE+   DW  D+D R+  A+ + K RGF+ +G+ +V+VTGWR G+G TNTLRIIT E
Sbjct:    1 MSDDSFQKELEASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSD-KRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERA-ADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRIITAE 531          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084214)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 304/511 (59.49%), Postives = 390/511 (76.32%), Query Frame = 2
Query:  149 AARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFG---NVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
             A + LEH C L   S   + R +GIVCT+GPAS S E+++ M+  GMNIAR+NFSHGS+EYH  T+  VRQ   ++        PVAIALDTKGPEIRTGLI GSGTAE+ LK G  I LTT++++ E      +YVDY NI+ V K   +++VDDGLISL+V+ +G + + C +ENGG+LGS+KG+N+PG  VDLPAVSEKDK DL+F  EQE+DM+FASFIR+ +A+ EIR +LGEKGK++KII+KIE+ +G+   DEI+ + DGI+VARGDLGIEIP EKVF+AQK MI +CNK GKPVICATQMLESM+ KPRPTRAE SDVANAVLDGADCVMLSGETAKG YPLE V+TM + C+EAEA  +H  L  DL  G    ID +H+ AIAAVEAA+ + A  I+V+TTSG+SA  +S++RP+CPI+ VTR   T RQ HL+RGL PL Y+ E   GDW++D+D R++F + + KK GF++ G++VV+VTGW+ GSG TNT+RI+T+E
Sbjct:   25 GADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDLVRGAGT-IDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYK-EPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE 533          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084213)

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 304/511 (59.49%), Postives = 390/511 (76.32%), Query Frame = 2
Query:  149 AARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFG---NVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
             A + LEH C L   S   + R +GIVCT+GPAS S E+++ M+  GMNIAR+NFSHGS+EYH  T+  VRQ   ++        PVAIALDTKGPEIRTGLI GSGTAE+ LK G  I LTT++++ E      +YVDY NI+ V K   +++VDDGLISL+V+ +G + + C +ENGG+LGS+KG+N+PG  VDLPAVSEKDK DL+F  EQE+DM+FASFIR+ +A+ EIR +LGEKGK++KII+KIE+ +G+   DEI+ + DGI+VARGDLGIEIP EKVF+AQK MI +CNK GKPVICATQMLESM+ KPRPTRAE SDVANAVLDGADCVMLSGETAKG YPLE V+TM + C+EAEA  +H  L  DL  G    ID +H+ AIAAVEAA+ + A  I+V+TTSG+SA  +S++RP+CPI+ VTR   T RQ HL+RGL PL Y+ E   GDW++D+D R++F + + KK GF++ G++VV+VTGW+ GSG TNT+RI+T+E
Sbjct:    4 GADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDLVRGAGT-IDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYK-EPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE 512          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG2964 (gene:FBgn0031462 transcript:FBtr0077722)

HSP 1 Score: 446.817 bits (1148), Expect = 6.660e-151
Identity = 225/506 (44.47%), Postives = 333/506 (65.81%), Query Frame = 2
Query:  158 STLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQ----VTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRII 1663
            + L H C LD+  + ++ R   ++ T+  +S++ + I  MI  G+NI RLNFSH S+E H +TIE + +    +    G + R VAIA DT+GP+IRTGL+ G    +V L+SG+ + L+ +    +  ++  +YVDY NII + K   ++++DDG + L +  +G + + C + +GG L +   + +P   +DLPAVSEKD  D+ F+ +  +D +FAS +RS   + E+R +LGEKGKH+KIIAK++S   + RF EIL + DG+L++R DLG +IP EK+FI QK ++G+CNKVGKPVI A+ +LESM   P PTRAE  D+ANA++DGADC+MLS E A G +P E V T   +CREAE V +  +L  DL   +   +D  HS+AIAAVE A  + A  IIV+TTSGRSA L+S+ RP+CPI+ +TR + T R  +L RG+ P+ Y  E P  D+  D+D R++FA+  AKK G + +G+ +VIV+ W+ G G TN +R++
Sbjct:   14 TQLSHICELDLAQQASHQRLVSLIATISVSSRNADTIYTMIMRGVNIFRLNFSHESHEMHSKTIELINEALERIHKETGQI-RTVAIAADTRGPQIRTGLLDG----DVFLRSGDNLRLSINRDLYDKGNKEAVYVDYPNIINLTKTGDRLFIDDGRLLLHILEVGVDGLLCEVIHGGQLNNNCNVILPEIEIDLPAVSEKDMFDIQFSIKANVDFLFASAVRSAKNVKELRTVLGEKGKHIKIIAKMDSKIALSRFSEILRAADGLLLSRADLGTQIPIEKLFITQKSILGQCNKVGKPVIVASHILESMRTLPHPTRAECFDLANAIIDGADCIMLSSEVAIGSFPKETVATCDTLCREAEKVLWFRDLFSDLVSEVRGELDAAHSLAIAAVETAKRTNATLIIVLTTSGRSATLVSKFRPRCPIMAITRCERTARWVYLHRGVLPILYTLE-PSTDYATDVDARVQFAMTSAKKWGIIDDGDPIVIVSAWKDGGGFTNNVRVV 513          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7069 (gene:FBgn0038952 transcript:FBtr0084215)

HSP 1 Score: 431.024 bits (1107), Expect = 3.564e-142
Identity = 214/409 (52.32%), Postives = 292/409 (71.39%), Query Frame = 2
Query:  290 MNIARLNFSHGSYEYHKETIETVRQVTLSF---GNVYRPVAIALDTKGPEIRTG-LIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGL-TLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYE 1501
            M + R+NFSHGS+EYH +TI+  R+    +     + R +AIALDTKGPEIRTG L  G+  AE+ LK+G+ +TL+T ++  +  +++ +YVDY  + ++ K   +++VDDGLI+L+VK    +E+ C +ENGG LGS KGIN+PG  VDLP+V+EKDKQDL F AEQ++DM+FASFIR  +A+ EIR +LG  G  +KII+KIE+H+G++  D+I+   DGI+VARGD+GIEIPTE V +AQK ++ KCNKVGKPVICATQM+ESM  KPRPTRAEASDVANA+ DG D VMLSGETAKG YP+E V  M +IC + EAV +++ LQ  LK  + T   D   +V  A  EAA++  A  I+V +     AQ++S  RP CPI+++T  +    Q  L+RG++PL  E
Sbjct:    1 MRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGNDRAEIELKTGDKVTLSTKKEMADKSNKDNIYVDYQRLPQLVKPGNRVFVDDGLIALIVKESKGDEVICQVENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDMIFASFIRDANALKEIRQVLGPAGACIKIISKIENHQGLVNIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGCDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLKREIRTSAADHISAVTTAIAEAATVGQARAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAQSLLFRGIYPLLVE 409          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7362 (gene:FBgn0038258 transcript:FBtr0331700)

HSP 1 Score: 251.136 bits (640), Expect = 2.905e-73
Identity = 130/267 (48.69%), Postives = 183/267 (68.54%), Query Frame = 2
Query:  701 INMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILG--EKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTL-PIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPL 1492
            IN  G   DL A++E+DK DL F A+Q++DM+FASFIR   A+ EIR  LG     +H+KII+KIES + +   DEI+   DGI+VA G++G EI  E V +AQK ++ KCNKVGKPVICA QM+ SMI KPRPTRAE+SDVANA+LDG D ++LS ETAKG YP++ V  M +IC + E+V +++ +Q +LK  + +   D   +V+ A  EAA++S A  I+V +     +Q++S+ RP CPI+++T       Q  L+RG++PL
Sbjct:  109 INPQGVAADLNAITEQDKLDLKFGADQKVDMIFASFIRDAKALKEIRQALGACPSSEHIKIISKIESQQALANIDEIIRESDGIMVALGNMGNEIALEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKPRPTRAESSDVANAILDGCDALVLSDETAKGKYPVQCVQCMARICAKVESVLWYESIQNNLKSEVRINAADHISAVSTAIAEAATVSQAQAIVVASPCSIVSQMVSQMRPPCPIVLLTGCPHEAAQSLLFRGVYPL 375          

HSP 2 Score: 75.0998 bits (183), Expect = 9.614e-14
Identity = 34/75 (45.33%), Postives = 51/75 (68.00%), Query Frame = 2
Query:  218 TGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEI 433
            T I+CT+GP+S  PEV+ N+I+AGM + RL+FS G+++ H + I+  R+    +     + R +AIALDTKGP I
Sbjct:   35 TSIICTIGPSSSQPEVLLNLIHAGMKVVRLDFSDGTHDCHCQAIQAARKAIAMYAEETGLPRSLAIALDTKGPVI 109          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 327/523 (62.52%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S + +K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRPV IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ + E+CDE+TL++DY NI KV ++  K+Y+DDGLISL V  IG++ + C IENGG+LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DM+FASFIR  + +  +R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CNK GKP+ICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH ++ +DL+  L L  D   ++AI AVEA+   L+   IV+T SGRSA L+SR+RP+ PIL VTR + T RQ HL+RG+ P+YY +  P  D W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   11 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRCLPLSTDPAEAIAIGAVEASFKILSSAFIVLTGSGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNS--PSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPV 531          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S + +K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRPV IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ + E+CDE+TL++DY NI KV ++  K+Y+DDGLISL V  IG++ + C IENGG+LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DM+FASFIR  + +  +R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CNK GKP+ICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA TFH +L + L+    L  D + +VA+ AVEA+    A  II++T +GRSA L+SR+RP+ PIL VTR + T RQ HL+RG+ P+YY +  P  D W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   11 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNS--PSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPV 531          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S + +K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRPV IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ + E+CDE+TL++DY NI KV ++  K+Y+DDGLISL V  IG++ + C IENGG+LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DM+FASFIR  + +  +R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CNK GKP+ICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA TFH +L + L+    L  D + +VA+ AVEA+    A  II++T +GRSA L+SR+RP+ PIL VTR + T RQ HL+RG+ P+YY +  P  D W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   11 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLDYKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLRRSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNS--PSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPV 531          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 407/523 (77.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  +RNTGIVCTLGPAS+S E ++ MI +GMN+ARLNFSHG++EYH ETI++VR+   SFG     YRPVAIALDTKGPEIRTGLIKGSGT EV L  GN I LT D+K+ ++CDENTL++DY NI KV +    IYVDDGLISL VK IG++ + C IENGG LGSKKG+N+PG NVDLPAVSEKD +DL F  EQ +DMVFASFIR  + +  +R +LGEKGK ++II+K+E+HEG+ +FDEIL + DGI+VARGDLGIEIPTEKVF+AQKMMI +CN++GKP+ICATQMLESMI KPRPTRAE+SDVANAVLDGADC+MLSGETAKG YP+E+V+T H I REAEA  FH +L ++L+    L  D T SVA+ AVEA+    A  II +T +GRSAQL+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y   KP  D W ED+D R+ FA+++ K R + + G+ +++VTGWR GSG TNT+RI+ +
Sbjct:    9 SGFIQTQQMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLDYKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELRRTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILY--TKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVV 529          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 407/523 (77.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  +RNTGIVCTLGPAS+S E ++ MI +GMN+ARLNFSHG++EYH ETI++VR+   SFG     YRPVAIALDTKGPEIRTGLIKGSGT EV L  GN I LT D+K+ ++CDENTL++DY NI KV +    IYVDDGLISL VK IG++ + C IENGG LGSKKG+N+PG NVDLPAVSEKD +DL F  EQ +DMVFASFIR  + +  +R +LGEKGK ++II+K+E+HEG+ +FDEIL + DGI+VARGDLGIEIPTEKVF+AQKMMI +CN++GKP+ICATQMLESMI KPRPTRAE+SDVANAVLDGADC+MLSGETAKG YP+E+V+T H I REAEA  FH +L ++L+    L  D T SVA+ AVEA+    A  II +T +GRSAQL+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y   KP  D W ED+D R+ FA+++ K R + + G+ +++VTGWR GSG TNT+RI+ +
Sbjct:    9 SGFIQTQQMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLDYKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELRRTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILY--TKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVV 529          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 325/524 (62.02%), Postives = 401/524 (76.53%), Query Frame = 2
Query:  107 ETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            ++S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E CDEN L+VDY N+ KV K   KIYVDDGLISL+VK  GA+     +ENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L+    L  D T + A+ AVE++    +G IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    5 KSSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 527          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 325/522 (62.26%), Postives = 399/522 (76.44%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E CDEN L+VDY N+ KV K   KIYVDDGLISL+VK  GA+     +ENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L+    L  D T + A+ AVE++    +G IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    9 SAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 529          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 325/522 (62.26%), Postives = 399/522 (76.44%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E CDEN L+VDY N+ KV K   KIYVDDGLISL+VK  GA+     +ENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L+    L  D T + A+ AVE++    +G IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    7 SAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 527          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 323/522 (61.88%), Postives = 396/522 (75.86%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E CDEN L+VDY N+ KV K   KIYVDDGLISL+VK  GA+     +ENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I  EAEA  FH +L ++L        D   ++A+ AVEA+   LA  +IV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    6 SAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSKDPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 526          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 323/522 (61.88%), Postives = 396/522 (75.86%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E CDEN L+VDY N+ KV K   KIYVDDGLISL+VK  GA+     +ENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I  EAEA  FH +L ++L        D   ++A+ AVEA+   LA  +IV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    9 SAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVDYKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSKDPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 529          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 318/531 (59.89%), Postives = 403/531 (75.89%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M   + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E++K MI +GMN+ARLNFSHG++EYH ETI+ VR+ T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  + + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH  L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+  A+D+ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRLLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 319/531 (60.08%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M   + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E++K MI +GMN+ARLNFSHG++EYH ETI+ VR+ T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  + + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  +H +L ++L+    +  D T + A+ AVEA+    +G IIV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+  A+D+ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 288/520 (55.38%), Postives = 375/520 (72.12%), Query Frame = 2
Query:  119 FVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            F Q+QQ+    A + LEH CLLD+ SEP  AR+T I+ T+GPAS+S + +K MI AGMNIARLNFSHGS+EYH E+I  +R+   SF      YRPVAIALDTKGPEIRTG+++G   +EV +  G+ + +T D K++   D  T++VDY NI +V  +  +IY+DDGLISLVV+ IG   +   +E+GG LG++KG+N+P   VDLP +SE+D  DL F  E  +D++FASF+R  S +  +R  LG +G+ +KII+KIE+HEG+ +FDEIL   DGI+VARGDLGIEIP EKVF+AQKMMIG+CN  GKPV+CATQMLESMI K RPTRAE SDVANAVLDGADC+MLSGETAKG +P+EAV   H I REAEA  +H +L ++L+    L  D T   AI AVEA+    A  IIV+T +GRSAQL+SR+RP+  ++ VTR     RQ HL RG+ PL Y  E P   W +D+D R++F ++  K RGF+R G+ V++VTGWR GSG TN +R++TI
Sbjct:   24 FFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVDYHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYR-EPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 542          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 288/520 (55.38%), Postives = 375/520 (72.12%), Query Frame = 2
Query:  119 FVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            F Q+QQ+    A + LEH CLLD+ SEP  AR+T I+ T+GPAS+S + +K MI AGMNIARLNFSHGS+EYH E+I  +R+   SF      YRPVAIALDTKGPEIRTG+++G   +EV +  G+ + +T D K++   D  T++VDY NI +V  +  +IY+DDGLISLVV+ IG   +   +E+GG LG++KG+N+P   VDLP +SE+D  DL F  E  +D++FASF+R  S +  +R  LG +G+ +KII+KIE+HEG+ +FDEIL   DGI+VARGDLGIEIP EKVF+AQKMMIG+CN  GKPV+CATQMLESMI K RPTRAE SDVANAVLDGADC+MLSGETAKG +P+EAV   H I REAEA  +H +L ++L+    L  D T   AI AVEA+    A  IIV+T +GRSAQL+SR+RP+  ++ VTR     RQ HL RG+ PL Y  E P   W +D+D R++F ++  K RGF+R G+ V++VTGWR GSG TN +R++TI
Sbjct:   55 FFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVDYHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYR-EPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 573          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 285.804 bits (730), Expect = 1.143e-92
Identity = 140/232 (60.34%), Postives = 173/232 (74.57%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFA 772
            M   + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E++K MI +GMN+ARLNFSHG++EYH ETI+ VR+ T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F 
Sbjct:    1 MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFG 232          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P14618|KPYM_HUMAN (Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 320/531 (60.26%), Postives = 404/531 (76.08%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  +H +L ++L+    +  D T + A+ AVEA+    +G IIV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|Q92122|KPYM_XENLA (Pyruvate kinase PKM OS=Xenopus laevis OX=8355 GN=pkm PE=2 SV=1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 327/522 (62.64%), Postives = 401/522 (76.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNV---YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH C LD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIARLNFSHG++EYH  TI+ VR+ T S  +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D+ ++E+CDEN L+VDY N+ KV K   KIYVDDGLISL+VK IG +     IENGG LGSKKG+N+PG  VDLPAVS KD QDL F  EQ++DMVFASFIR  + + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L+    L  D T + A+ AVEA+    +G IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P+ Y  E  H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:    6 SAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEMLKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESLASNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATMRITLDDAFQENCDENVLWVDYKNLTKVVKPGSKIYVDDGLISLLVKEIGPDFCVTEIENGGMLGSKKGVNLPGAAVDLPAVSSKDIQDLQFGVEQDVDMVFASFIRKAADVHEVREVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELRRVSPLTRDPTEATAVGAVEASFKCSSGAIIVLTKSGRSAHLLSRYRPRAPIISVTRNGQTARQAHLYRGIFPVLYR-EAVHEAWAEDVDSRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPV 526          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|Q5NVN0|KPYM_PONAB (Pyruvate kinase PKM OS=Pongo abelii OX=9601 GN=PKM PE=2 SV=3)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 318/531 (59.89%), Postives = 403/531 (75.89%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+  + +  + F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  KIYVDDGLISL VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE S VANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+ FA+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLLTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSGVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCK-DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11979|KPYM_FELCA (Pyruvate kinase PKM OS=Felis catus OX=9685 GN=PKM PE=1 SV=2)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 317/520 (60.96%), Postives = 399/520 (76.73%), Query Frame = 2
Query:  119 FVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E++K MI +GMN+ARLNFSHG++EYH ETI+ VR  T SF +    YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV ++  K+YVDDGLISL+VK  GA+ +   +ENGG+LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  S + E+R +LGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L  G +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+  A+++ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   12 FIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVEILKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPIRYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENVLWLDYKNICKVVEVGSKVYVDDGLISLLVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRGSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCK-DPVQEAWAEDVDLRVNLAMNVGKARGFFKHGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11974|KPYM_RABIT (Pyruvate kinase PKM OS=Oryctolagus cuniculus OX=9986 GN=PKM PE=1 SV=4)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 316/531 (59.51%), Postives = 401/531 (75.52%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            M+ S+ +  S F+Q QQ+    A + LEH C LD+ S P  ARNTGI+CT+GPAS+S E +K MI +GMN+AR+NFSHG++EYH ETI+ VR  T SF +   +YRPVA+ALDTKGPEIRTGLIKGSGTAEV LK G  + +T D  Y E CDEN L++DY NI KV  +  K+YVDDGLISL VK  G + +   +ENGG LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ++DMVFASFIR  + + E+R ILGEKGK++KII+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKM+IG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  FH +L ++L    +   D+  ++A+ +VEA+   LA  +IV+T SGRSA  ++R+RP+ PI+ VTR   T RQ HL+RG+ P+  + +     W ED+D R+  A+++ K RGF ++G+ V+++TGWR GSG TNT+R++ +
Sbjct:    1 MSKSHSEAGSAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCK-DPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 530          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267F274 (Pyruvate kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009984g1 PE=3 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 345/520 (66.35%), Postives = 416/520 (80.00%), Query Frame = 2
Query:  116 YFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIED 1675
            YF+Q+QQ+Q   ARS LEH C LD+  +PAY RNTGI+CT+GPA KS  V+  MI AGMNIAR+NFSHG++EYHKET+E VRQ   +F    RPVAIALDTKGPEIRTGLI GSGTAEV LK G+ I +TTD  + E+C  + L+VDY NI+KV +   +++VDDGLISL+VK +  N + C +ENGGNLGSKKG+N+PG  VDLPAVSEKDK DL FA E  LD+VFASFIR+  AI EI+ ILGE+GK++KIIAKIE+HEG+ RFDEI+ + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADCVMLSGETAKG YPLEAV TMHQ+CREAE+  F  +L +DLK  L  P D+TH+ AIAA EAA+   A  IIV+TT+GRSA L+SRHRP+CPIL V+R   TCRQ HL+RGLHPL+Y+A +    W EDMD+R+ FA+D  +KR F+  G+ VVIVTGW+AG+G TNTLRI+ + +
Sbjct:   15 YFIQKQQLQASNARSHLEHLCRLDIDLDPAYVRNTGIICTIGPACKSVAVLHKMIAAGMNIARMNFSHGTHEYHKETVELVRQAADTFKGWSRPVAIALDTKGPEIRTGLIGGSGTAEVELKRGSEIVVTTDPAHSENCSADMLWVDYPNIVKVVREGGRVFVDDGLISLLVKEVRDNSLLCEVENGGNLGSKKGVNLPGAPVDLPAVSEKDKSDLRFAVEMGLDIVFASFIRNAEAIREIKHILGEEGKNIKIIAKIENHEGVRRFDEIMEAADGIMVARGDLGIEIPPEKVFLAQKMMIGRCNRAGKPVICATQMLESMITKPRPTRAEISDVANAVLDGADCVMLSGETAKGSYPLEAVKTMHQVCREAESAMFSSQLFEDLKAELLEPTDITHTTAIAASEAANRCRAAAIIVITTTGRSASLISRHRPRCPILTVSRLAQTCRQAHLFRGLHPLFYDAPRCE-QWTEDMDKRIDFAIDYGRKREFINVGDFVVIVTGWKAGAGFTNTLRIVQVTE 533          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267EYV5 (Pyruvate kinase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019710g1 PE=3 SV=1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 337/520 (64.81%), Postives = 413/520 (79.42%), Query Frame = 2
Query:  116 YFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIED 1675
            YF+Q+QQ+Q   ARS LEH C LDV SEPAY RNTGI+CT+GPA KS  ++  MI  GMNIAR+NFSHG++EYH++T+E VRQ   +F    RPV IALDTKGPEIRTGLI GSGTAEV L  G  IT+T D  + E+C ++TL+VDY NI+KV     ++++DDGLISL+VK I    + C +ENGG LGSKKG+N+PG  VDLPAVSEKD++DL FA +  LDMVFASFIR+  AI EIR ILGE GK++KIIAKIE+HEG+ RFDEI+ + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE SDVANAVLDGADCVMLSGETAKG +PLEAV TMHQ+CREAE+  +  +L +DLK  L  P D+TH+ AIAA EAA+   A  IIV+TT+GRSAQL++RHRP+CPIL V+R   TCRQ HLWRGLHPL+++ E     W EDMD+R++FA+   ++RGF+  G+ VV+VTGW+AG+G TNTLR+I + +
Sbjct:   23 YFIQKQQLQASNARSHLEHLCHLDVDSEPAYVRNTGIICTIGPACKSVAILHKMIANGMNIARMNFSHGTHEYHRQTVELVRQAAETFKPWSRPVGIALDTKGPEIRTGLIGGSGTAEVELVRGEPITVTIDSAFAENCSKDTLWVDYPNIVKVINEGGRVFIDDGLISLLVKEIRDKSLLCEVENGGKLGSKKGVNLPGSPVDLPAVSEKDREDLKFAVDLGLDMVFASFIRNADAIREIRHILGEAGKNIKIIAKIENHEGVRRFDEIMEAADGIMVARGDLGIEIPPEKVFLAQKMMIGRCNRAGKPVICATQMLESMISKPRPTRAEISDVANAVLDGADCVMLSGETAKGDFPLEAVRTMHQVCREAESAMYTSQLFEDLKAELLEPTDITHTTAIAASEAANRCRAAAIIVITTTGRSAQLVARHRPRCPILTVSRLAQTCRQAHLWRGLHPLFFD-ETRSDQWTEDMDKRIEFAIAYGRQRGFINRGDFVVMVTGWKAGTGFTNTLRVIQVTE 541          
BLAST of Pyruvate kinase vs. TrEMBL
Match: Q5DAM7 (Pyruvate kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_008759 PE=2 SV=1)

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 341/539 (63.27%), Postives = 416/539 (77.18%), Query Frame = 2
Query:   83 IMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDC--MPTIM 1693
            + + S F E S +     + +   RS LEH   LD+  +P + RNTGI+CT+GPA ++ E+++NM+ AGMNIARLNFSHGS+EYH ETI+ VR+   +     RP+ IALDTKGPEIRTGLI GSGTAEV L+ G+ I +TTD  Y E C+E+TLYVDY NI+ V     KI+VDDGLISLVV S G N ++C +ENGG LGS+KG+N+PG +VDLPAVSEKDKQDL FA E  +DMVFASFIR+  A+ EIR +LGE G ++KIIAKIE+HEG+ RF+EIL   DGI+VARGDLGIEIP EKVFIAQKMMIG+CN+VGKPVICATQMLESM  KPRPTRAE+SDVANAVLDGADCVMLSGETAKGLYPLE V TMH+IC +AEA  FH +L +DLK  L  P ++ H+ AIAAVEAAS   A  IIV+TTSGRS QL+SRHRP+CPIL VTR ++  RQ HL+RG+HPL+Y  E   G+W EDMD R+++A+D  KKR F+  G  V+IVTGW+AGSG TNTLR++ +ED    P +M
Sbjct:   16 VSSVSRFGEASPYNPNAPISV-YPRSLLEHVVSLDIDHQPTFVRNTGIICTIGPACRTVEMLQNMMTAGMNIARLNFSHGSHEYHAETIKLVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVSLEVGHKIRVTTDSAYMEACNESTLYVDYPNIVHVLSNGSKIFVDDGLISLVVLSKGPNYLECEVENGGKLGSRKGVNLPGAHVDLPAVSEKDKQDLRFAVEHNVDMVFASFIRNAGAVHEIRQLLGENGAYIKIIAKIENHEGVQRFNEILEVVDGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLETVQTMHRICVQAEAAMFHGQLFEDLKSSLCGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEVIARQIHLYRGVHPLFY-GESRAGEWYEDMDRRIRYAIDYGKKRSFLTPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETKPIVM 552          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A095B084 (Pyruvate kinase OS=Schistosoma haematobium OX=6185 GN=MS3_08937 PE=3 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 338/539 (62.71%), Postives = 415/539 (76.99%), Query Frame = 2
Query:   83 IMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDC--MPTIM 1693
            + + S F E S + Q   + +   RS LEH   LD+  +PAY RNTGI+CT+GPA ++ E+++NM+ +GMNIARLNFSHGS+EYH +TIE VR+   +     RP+ IALDTKGPEIRTGLI GSGTAEV L+ G+ I +TTD  Y E C+E+ LY+DY NI+ V     KI+VDDGLISLVV   G + ++C +ENGG LGS+KG+N+PG +VDL AVSEKDKQDL FA E  +DMVFASFIR+  A+ +IR +LG+ G H+KIIAKIE+HEG+ RF+EIL + DGI+VARGDLGIEIP EKVFIAQKMMIG+CN+VGKPVICATQMLESM  KPRPTRAE+SDVANAVLDGADCVMLSGETAKGLYPLEAV TMH+IC +AEA  FH +L +DLK  L  P ++ H+ AIAAVEAAS   A  IIV+TTSGRS QL+SRHRP+CPIL VTR +   RQ HL+RG+HPLYY  E   G+W EDMD R+++A+D  +KR F   G  V+IVTGW+AGSG TNTLR++ +ED    P +M
Sbjct:   19 VSSVSRFGEASPYHQNPPLSV-YPRSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEILQNMMTSGMNIARLNFSHGSHEYHAKTIELVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVTLQVGHKIRVTTDCAYMEACNESILYMDYRNIVHVLSKGSKIFVDDGLISLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLDAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGSHIKIIAKIENHEGVQRFNEILDAADGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLEAVQTMHRICVQAEAAMFHGQLFEDLKSSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEYIARQIHLYRGVHPLYY-GEPRAGEWYEDMDRRIRYAIDYGRKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETKPIVM 555          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A430Q112 (Pyruvate kinase OS=Schistosoma bovis OX=6184 GN=DC041_0005495 PE=3 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 339/539 (62.89%), Postives = 415/539 (76.99%), Query Frame = 2
Query:   83 IMTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDC--MPTIM 1693
            + + S F E S + Q   + +   RS LEH   LD+  +PAY RNTGI+CT+GPA ++ E+++NM+ +GMNIARLNFSHGS+EYH +TIE VR+   +     RP+ IALDTKGPEIRTGLI GSGTAEV L+ G+ I +TTD  Y E C+E+ LYVDY NI+ V     KI+VDDGLISLVV   G + ++C +ENGG LGS+KG+N+PG +VDL AVSEKDKQDL FA E  +DMVFASFIR+  A+ +IR +LG+ G H+KIIAKIE+HEG+ RF+EIL + DGI+VARGDLGIEIP EKVFIAQKMMIG+CN+VGKPVICATQMLESM  KPRPTRAE+SDVANAVLDGADCVMLSGETAKGLYPLEAV TMH+IC +AEA  FH +L +DLK  L  P ++ H+ AIAAVEAAS   A  IIV+TTSGRS QL+SRHRP+CPIL VTR +   RQ HL+RG+HPLYY  E   G+W EDMD R+++A+D  +KR F   G  V+IVTGW+AGSG TNTLR++ +ED    P +M
Sbjct:   19 VSSVSRFGEASPYHQNPPLSV-YPRSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEILQNMMTSGMNIARLNFSHGSHEYHAKTIELVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVNLQVGHKIRVTTDCAYMEACNESILYVDYRNIVHVLSKGSKIFVDDGLISLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLDAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGSHIKIIAKIENHEGVQRFNEILDAADGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLEAVQTMHRICVQAEAAMFHGQLFEDLKSSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEYIARQIHLYRGVHPLYY-GEPRAGEWYEDMDRRIRYAIDYGRKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETKPIVM 555          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S +++K MI +GMNIARLNFSHGS+EYH ETI+ +R+ T SF  G++ YRP+ IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ Y E+CDE+ L++DY NI KV ++  K+Y+DDGLISL V+ IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DMVFASFIR    ++E+R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH +L ++L+    +  D + +VAI AVE++    A  IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P++Y   KP H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   34 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFY--NKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPV 554          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S +++K MI +GMNIARLNFSHGS+EYH ETI+ +R+ T SF  G++ YRP+ IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ Y E+CDE+ L++DY NI KV ++  K+Y+DDGLISL V+ IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DMVFASFIR    ++E+R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH +L ++L+    +  D + +VAI AVE++    A  IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P++Y   KP H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   36 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFY--NKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPV 556          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S +++K MI +GMNIARLNFSHGS+EYH ETI+ +R+ T SF  G++ YRP+ IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ Y E+CDE+ L++DY NI KV ++  K+Y+DDGLISL V+ IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DMVFASFIR    ++E+R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH +L ++L+    +  D + +VAI AVE++    A  IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P++Y   KP H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:   64 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFY--NKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPV 584          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 410/523 (78.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S +++K MI +GMNIARLNFSHGS+EYH ETI+ +R+ T SF  G++ YRP+ IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ Y E+CDE+ L++DY NI KV ++  K+Y+DDGLISL V+ IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DMVFASFIR    ++E+R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH +L ++L+    +  D + +VAI AVE++    A  IIV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P++Y   KP H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:  109 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTHDPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFY--NKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPV 629          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 326/523 (62.33%), Postives = 408/523 (78.01%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S +++K MI +GMNIARLNFSHGS+EYH ETI+ +R+ T SF  G++ YRP+ IALDTKGPEIRTGLIKGSGTAEV LK GN I +T D+ Y E+CDE+ L++DY NI KV ++  K+Y+DDGLISL V+ IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD +DL F  E  +DMVFASFIR    ++E+R +LGEKGK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH ++ +DL+       D   ++AI AVEA+   LA   IV+T SGRSA L+SR+RP+ PI+ VTR   T RQ HL+RG+ P++Y   KP H  W ED+D R+ FA+D+ K RGF + G+ V+++TGWR GSG TNT+R++ +
Sbjct:  109 SAFIQTQQLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLDYKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRCTPHSTDPAEAIAIGAVEASFKLLAPAFIVLTGSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFY--NKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPV 629          
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 318/532 (59.77%), Postives = 400/532 (75.19%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF-GN--VYRPVAIALDTKGPEIRTGLIKG-------SGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANE--IKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGD-WIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S FVQ QQ+    A + LEH CLLD+ SEP  ARNTGI+CT+GPAS+S + +K MI +GMNIAR+NFSHGS+EYH +TI+ VR+ T SF GN   YRPV +ALDTKGPEIRTGLIKG       SGTAEV LK G  + +T D+ Y++ CD+  +++DY NI KV     KI+VDDGLISL+VK IG  +  +   +ENGG LGS+KG+N+PG  VDLPAVS KD QDL F  +Q +DMVFASFIR  + ++E+RA+LGEKGK++KII+KIE+HEG+ RF+EIL + DGI+VARGDLGIEIP EKVFIAQKMMIG+CN+ GKPVICATQMLESMI KPRPTRAE+SDVANAVLDGADC+MLSGETAKG YPLEAV   H I REAEA  +H +L ++L+    +  D T + AI  VEA+    AG IIV+T SGRSA L+S++RP+ PI+ VTR   T RQ HL+RG+ P+     +P  D W ED+D R+  A+++ K RGF ++ + V++VTGWR GSG TN +R+I +
Sbjct:   10 SAFVQTQQLSASRADTFLEHMCLLDIDSEPITARNTGIICTIGPASRSLDTLKEMIKSGMNIARMNFSHGSHEYHSDTIKNVREATESFAGNPIYYRPVGVALDTKGPEIRTGLIKGAVVVAAQSGTAEVELKKGAELKVTLDDAYQDACDDTMVWLDYKNITKVVTPGSKIFVDDGLISLLVKEIGKGDDYVITEVENGGMLGSRKGVNLPGAAVDLPAVSAKDVQDLQFGVDQGVDMVFASFIRKAADVEEVRAVLGEKGKNIKIISKIENHEGVRRFEEILEASDGIMVARGDLGIEIPGEKVFIAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAMYHRQLFEELRRLSGITSDPTETTAIGTVEASFKCSAGAIIVLTKSGRSAHLLSKYRPRAPIIAVTRCGQTARQAHLYRGIFPVL--CREPVNDVWAEDVDLRVNLAMEVGKCRGFFKQDDVVIVVTGWRPGSGYTNMMRVIKV 539          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: CDC19 (Pyruvate kinase; functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration; regulated via allosteric activation by fructose bisphosphate; CDC19 has a paralog, PYK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000036])

HSP 1 Score: 461.84 bits (1187), Expect = 2.841e-158
Identity = 236/487 (48.46%), Postives = 324/487 (66.53%), Query Frame = 2
Query:  212 RNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISL-VVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            R T I+ T+GP + +PE +  +  AG+NI R+NFSHGSYEYHK  I+  R+    +    RP+AIALDTKGPEIRTG    +   +  +   + +  TTD+KY + CD+  +YVDY NI KV    + IYVDDG++S  V++ +    +K    N G + S KG+N+PG +VDLPA+SEKDK+DL F  +  + MVFASFIR+ + +  IR +LGE+GK +KII KIE+ +G+  FDEIL   DG++VARGDLGIEIP  +V   QK +I K N  GKPVICATQMLESM Y PRPTRAE SDV NA+LDGADCVMLSGETAKG YP+ AV TM +    AE    +     D++     P   T +VA +AV A     A  IIV++TSG + +L+S++RP CPI++VTR     R  HL+RG+ P  +E E P  DW +D++ R+ F ++ AK+ G +++G+  V + G++AG+G +NTL++ T+
Sbjct:   19 RRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPG--RPLAIALDTKGPEIRTGTT--TNDVDYPIPPNHEMIFTTDDKYAKACDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPIILVTRCPRAARFSHLYRGVFPFVFEKE-PVSDWTDDVEARINFGIEKAKEFGILKKGDTYVSIQGFKAGAGHSNTLQVSTV 500          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: PYK2 (Pyruvate kinase; appears to be modulated by phosphorylation; transcription repressed by glucose, and Pyk2p may be active under low glycolytic flux; PYK2 has a paralog, CDC19, that arose from the whole genome duplication [Source:SGD;Acc:S000005874])

HSP 1 Score: 435.647 bits (1119), Expect = 5.051e-148
Identity = 231/491 (47.05%), Postives = 312/491 (63.54%), Query Frame = 2
Query:  200 PAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISL-VVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            P   R T I+ T+GP + S E I  +  AG+NI RLNFSHGSYE+H+  IE   +    F    RP+AIALDTKGPEIRTG  +     ++ +   + +  TTD  +    ++  +Y+DYAN+ KV    + IYVDDG++S  V++ I  + ++    N G + S KG+N+P  +VDLP +S KD +DL F     + +VFASFIR+   +  IR  LG +G+ +KII+KIE+ +G+  FDEIL   DG+++ARGDLGIEI   +V   QK +I KCN  GKPVICATQML+SM + PRPTRAE SDV NAVLDGADCVMLSGETAKG YP+ AV  M      AE+   H  L  DL+     P   T +VA AA  A        I+V++T+G +A+L+S++RP CPI++VTR   T R  HL+RG+ P  YE ++   DW ED+  RLKF V+MA+  G V  G+ VV + G++ G G +NTLRI T+
Sbjct:   17 PQQLRRTSIIGTIGPKTNSCEAITALRKAGLNIIRLNFSHGSYEFHQSVIENAVKSEQQFPG--RPLAIALDTKGPEIRTG--RTLNDQDLYIPVDHQMIFTTDASFANTSNDKIMYIDYANLTKVIVPGRFIYVDDGILSFKVLQIIDESNLRVQAVNSGYIASHKGVNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEGQDIKIISKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICATQMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAESTIAHLALYDDLRDATPKPTSTTETVAAAATAAILEQDGKAIVVLSTTGNTARLLSKYRPSCPIILVTRHARTARIAHLYRGVFPFLYEPKR-LDDWGEDVHRRLKFGVEMARSFGMVDNGDTVVSIQGFKGGVGHSNTLRISTV 502          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: YAL037C-B_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching [Source:SGD;Acc:S000028592])

HSP 1 Score: 99.7525 bits (247), Expect = 1.770e-23
Identity = 54/175 (30.86%), Postives = 90/175 (51.43%), Query Frame = -1
Query:  710 FSLATYLMHCHYSFQRI*AFCRFT*QHDAISPI*YSIGNIACFSPSWSWLINH*FQHLCCTYHRFSNFIAFSYHHFLSNEYFFCWDFYSKITSCHQYSVTRGQYFIKSYYSFMTFYFRNNFHMFALFSENSTNLINSRPTSDEASKHHV*FLFRGKY*ILFVFFRNSGQIYILTW 1234
            FS  +   H       +     FT QH+ +S I  S+ +I  FS  WSW+++H FQHL  T +  ++ +  S    L ++ F+ WDF +++TS +  +V+  Q F++   + + F   N+  +  LF+++ ++  N    SDE S+ HV  +   +  I  V FR S QI I TW
Sbjct:  150 FSNDSGFSHSGNGVDWVVTLGGFTRQHNTVSTIQDSVTDIGNFSSGWSWVVSHGFQHLGSTDNWLTSQVRLSNQFLLDSQDFWGWDFNTQVTSGNHNTVSDLQDFVEVVNTLLVFNLDNDLDVLTLFTQDFSDGQNIVGGSDERSEDHVDTVLDTESQIFLVLFRQSWQIDIGTW 324          
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Match: EDO49963 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RER9])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 278/506 (54.94%), Postives = 360/506 (71.15%), Query Frame = 2
Query:  152 ARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            ARS LE    LD+   P   RN+G+VCT+GPAS+S E++  +I  GMNIARLNFSHG++EYH+ETI  +R+  L        V IALDTKGPEIRTGL+K     E+ L+ G  + ++TD+   +      ++VDY NI+KV ++   +YVDDGLISL V   G N +   + N   LGSKKG+N+P   VDLPAVSE+DK+D+ FA E E+DM+FASFIR    I EIR +L +  K++KI+AKIE+HEG+ RF+EIL   DGI+VARGDLGIEIP EKVF+AQKMMI +CN  G PVICATQMLESM+  PRPTRAE SDVANA+LDGADCVMLSGETAKGLYP++AV  MH+I REAEA  FH +   +L++ L    D   S AIAAV A+  + A  II +T +GR+A +++R RP+CPI+VVTR+    RQ HLWRG  P+ Y+ E P  + +E+ D+RL FA+ M KK GF+  G+  V V+GW++G+  TNTLRI+T+
Sbjct:   26 ARSNLEFRSELDIDKHPLTIRNSGVVCTIGPASRSVEIVAQLIENGMNIARLNFSHGTHEYHRETIMNIRRAALL--EWPHAVGIALDTKGPEIRTGLLKA---GEIKLEKGQKLKVSTDKAMYDQGHTECIFVDYENIVKVVQIGGTVYVDDGLISLKVLEKGDNFLITEVLNDALLGSKKGVNLPNCAVDLPAVSEQDKKDIAFAVEMEVDMIFASFIRKPEDIAEIRKLLEKHAKNIKIVAKIENHEGVRRFNEILEVADGIMVARGDLGIEIPAEKVFLAQKMMIARCNMKGVPVICATQMLESMVQNPRPTRAETSDVANAILDGADCVMLSGETAKGLYPVQAVAMMHRISREAEAAIFHKQSFDELRHNLEGYADTHISTAIAAVAASFTAGADAIICLTHTGRTAAVVARFRPRCPIVVVTRDPRVARQMHLWRGCFPIVYDQE-PLDNVLEEHDQRLDFALGMGKKMGFLTIGSTFVFVSGWKSGAAHTNTLRILTL 525          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 331/523 (63.29%), Postives = 407/523 (77.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A S LEH CLLD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRP+ IALDTKGPEIRTGLI+GSGTAEV LK GN I +T D+ Y+E+C E  L++DY NI KV ++  KIY+DDGLISL V  IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ +DMVFASFIR  + +  +R +LGE+GK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA  FH ++ +DL+       D   ++AI AVEA+  SLA  IIV+T SGRSA L+SR+RP+ PIL VTR   T RQ HL+RG+ P+ Y   KP H  W ED+D R+ FA++M K RGF +EG+ V+++TGWR GSG TNT+R+I +
Sbjct:   11 SAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLRRSTPHCSDPAEAIAIGAVEASFKSLASAIIVLTGSGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLY--TKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 531          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 328/523 (62.72%), Postives = 407/523 (77.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A S LEH CLLD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRP+ IALDTKGPEIRTGLI+GSGTAEV LK GN I +T D+ Y+E+C E  L++DY NI KV ++  KIY+DDGLISL V  IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ +DMVFASFIR  + +  +R +LGE+GK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA TFH +L ++L+    L  D + +VA+ AVE++    A  II +T +GRSA L+SR+RP+ PIL VTR   T RQ HL+RG+ P+ Y   KP H  W ED+D R+ FA++M K RGF +EG+ V+++TGWR GSG TNT+R+I +
Sbjct:   11 SAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTRDPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLY--TKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 531          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 328/523 (62.72%), Postives = 407/523 (77.82%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSF--GNV-YRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKP-HGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S F+Q QQ+    A S LEH CLLD+ SEP  ARNTGI+CT+GPAS+S E++K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   SF  G++ YRP+ IALDTKGPEIRTGLI+GSGTAEV LK GN I +T D+ Y+E+C E  L++DY NI KV ++  KIY+DDGLISL V  IG++ I C IENGG LGSKKG+N+PG  VDLPAVSEKD QDL F  EQ +DMVFASFIR  + +  +R +LGE+GK++KII+K+E+HEG+ RFDEI+ + DGI+VARGDLGIEIPTEKVF+AQKMMIG+CN+ GKP+ CATQMLESMI KPRPTRAE SDVANAVLDGADC+MLSGETAKG YPLEAV T H I REAEA TFH +L ++L+    L  D + +VA+ AVE++    A  II +T +GRSA L+SR+RP+ PIL VTR   T RQ HL+RG+ P+ Y   KP H  W ED+D R+ FA++M K RGF +EG+ V+++TGWR GSG TNT+R+I +
Sbjct:   29 SAFIQTQQLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLDYKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTRDPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLY--TKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILV 549          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkmb (pyruvate kinase PKM [Source:NCBI gene;Acc:101170426])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 328/522 (62.84%), Postives = 404/522 (77.39%), Query Frame = 2
Query:  113 SYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 1669
            S  +Q QQ+    A + +EH CLLD+ SEPA +RNTGIVCT+GPAS+S ++ K MI AGMNIAR+NFSHG++EYH ETI+ VR+ T SFG     YRPVAIALDTKGPEIRTGLIKGSGTAEV LK G  I LT D+KYK++CDEN L+VDY NI KV ++   +Y+DDGLISL VK +G + + C IENGG LGSKKG+N+PG  VDLPA+SEKD QDL F  EQ +DMVFASFIR  + +  +R +LGEKGK +KII+K+E+HEG+ RFDEIL + DGI+VARGDLGIEIPTEKVFIAQKMM GKCN++GKP+ICATQMLESM  KPRPTRAEASDVANAVLDG DC+MLSGETAKG YPLEAV+T H+I REAEA  FH ++ ++L+    L  D T SVAI AVEA+    A  IIV+T SGRSA ++SR+RP+ PIL VTR   T RQ HL+RG++P+ Y  +  +  W ED+D R+ FA++  K R F + G+  ++VTGWR GSG TNT+R++ +
Sbjct:    9 SSIMQTQQLHAAMADTYIEHMCLLDIDSEPAVSRNTGIVCTIGPASRSVDMAKEMIKAGMNIARMNFSHGTHEYHAETIKNVREATESFGPGTVEYRPVAIALDTKGPEIRTGLIKGSGTAEVELKKGQNIKLTLDDKYKDNCDENYLWVDYKNITKVLQVGNNVYIDDGLISLKVKEVGNDYLMCEIENGGLLGSKKGVNLPGAAVDLPALSEKDIQDLQFGLEQGVDMVFASFIRKAADVQAVRKVLGEKGKDVKIISKLENHEGVRRFDEILEASDGIMVARGDLGIEIPTEKVFIAQKMMTGKCNRIGKPIICATQMLESMTKKPRPTRAEASDVANAVLDGNDCIMLSGETAKGDYPLEAVLTQHRIAREAEAAMFHRQMFEELRRTSHLTRDPTESVAIGAVEASFKCCASAIIVLTKSGRSAYMLSRYRPRAPILAVTRCGQTARQAHLYRGVYPVLY-TKNANDVWAEDVDMRVNFAMEYGKYRKFFKSGDVAIVVTGWRPGSGYTNTMRVVLV 529          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pklr (pyruvate kinase PKM [Source:NCBI gene;Acc:101161188])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 284/519 (54.72%), Postives = 373/519 (71.87%), Query Frame = 2
Query:  119 FVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN---VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQN-VDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRII 1663
            F+QRQQ+    A + LEH CLLD+  EP  ARNT I+CT+GPAS+S + ++ M+ AGMNIARLNFSHG +EYH ETI+ +R+   +  +    YRPVAIALDTKGPEIRTGL+KG    EV L  G+++ + T E  ++  D   ++VDY ++ KV +  ++IY+DDGL++L V  IG++ +  ++E GG L S+KG+N+PG + + L AVSE+D+ DL F     +DMVFASFIRS   + ++R  LGE G H+K+I+K+ES +G+  F+EILA  DG++VARGDLGIEIP EKVFIAQKMMIG+CN  GKPVICATQMLESM+  PRPTRAE+SDVANAVLDGADCVMLS ETAKG +PLEAV  MH ICREAEA  FH +L ++L+    L  D T   AI AVE++    AG IIV+T+SGRS+ L+SR+RP+CPI+ VTR     RQ  L RG+ P  +    P   W +D+D R+KF +D+ K RGF + G+ V++VTGW  GSG TN +R +
Sbjct:   23 FIQRQQLDASMADTFLEHLCLLDIDQEPITARNTSIICTIGPASRSIQKLQEMVKAGMNIARLNFSHGCHEYHSETIKNIREAVETITSDPLYYRPVAIALDTKGPEIRTGLVKGKVDEEVQLVKGSHVRVVTAESERDKTDATMVWVDYPHLPKVLEKGRRIYIDDGLLALKVLEIGSDWVDTVVEAGGLLCSRKGVNLPGCDLIGLQAVSEQDEADLRFGVAHGVDMVFASFIRSAQDVKDVRRALGELGSHIKVISKVESRQGVQNFEEILAESDGVMVARGDLGIEIPAEKVFIAQKMMIGRCNSAGKPVICATQMLESMVSHPRPTRAESSDVANAVLDGADCVMLSAETAKGKFPLEAVAMMHSICREAEAAIFHHQLFEELRRLTPLSSDPTEVTAIGAVESSFKCCAGAIIVLTSSGRSSHLLSRYRPRCPIIAVTRSPQVARQSQLLRGVFPALFHP-LPAPVWADDVDSRVKFGMDIGKARGFFKSGDMVIVVTGWIPGSGHTNIMRAV 540          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000045839.1 (SMESG000045839.1)

HSP 1 Score: 1119.76 bits (2895), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 2
Query:   86 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDCMPTIMKIEN 1705
            MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDCMPTIMKIEN
Sbjct:    1 MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIEDCMPTIMKIEN 540          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000052083.1 (SMESG000052083.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 337/549 (61.38%), Postives = 416/549 (75.77%), Query Frame = 2
Query:   95 SNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIED------------CMPTIMKIEN 1705
            S+F+  +YF+Q Q V    +RS LE  C LD+ +EP   R++ I+CT+GPA ++   +K MI +GMNIAR+NFSHGS+EYH ETI+ VR+   +F   YRPVA+ALDTKGPEIRTGLI GSGT EV L  GN I L  DEKY + C+E  L+VDY NI+K+     +IYVDDGLISL+V   G + + C +ENGGNLGSKKG+N+PG  VDLPAVS+KD  DL F  EQ +DMVFASFIR G+A+DEIRAILGEKGKH+ II+KIE+HEG+ RFDEIL + DGI+VARGDLGIEIP EKVF+AQKMMIG+CN++GKP+ICATQMLESMI KPRPTRAE+SDVANA+LDGADCVMLSGETAKG YPLEAV  MH ICREAE+  F  +  +DLK  +    D THS AIAAVEAA    A  I+VVTT+GRSA L+SR+RP+CPIL VTR  +T RQ HLWRG+HPL Y+A++   +W  DMD R+ +A   A +RGFV+ G+ V++VTGW+AGSG TNT+R+I +ED             +P+I K E+
Sbjct:    6 SSFEINNYFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVDYKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGSTDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLD-EWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRVILLEDDANEKDGIMPILSIPSIAKFED 553          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017675.1 (SMESG000017675.1)

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 324/525 (61.71%), Postives = 401/525 (76.38%), Query Frame = 2
Query:  101 FQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIED 1675
            F+ T+YF+Q Q++     RS LEHT  L+   EP   RN+GI+CT+GPA KS  ++  MI+AGMN+ARLNFSHG+YEYH+ETI  VR+   +F   +RP+AIALDTKGPEIRTGL+ GS T EV L  G+ I +  D KY E C+ + L+VDY NII + +++  IY+DDGLISLVV   G++ + C +ENGG LGSKKG+N+PG  VDLPAVSEKDK+DL F  E  +DMVFASFIRSG+AI EI+ ILGEKGKH+ II+KIE+ EG+ +FDEIL   DGI+VARGDLGIEIP EKV +AQKMMIG+CN+ GKPVICATQMLESMI KP PT+AE SDVANAVLDGADCVMLSGETAKG YPLEAV  MH ICREAE V +  +  + +K+ ++ P D THS A+AAVEAA    A  IIV+TT+GRSA L++++RP CPIL VTR  IT RQ HLWRGLHP++Y  E    DW EDMDER+ +++    +RGF++  + V+IVTGW+AG G TNTLRII IE+
Sbjct:    9 FEPTNYFIQNQRITSNDYRSNLEHTSKLNYNDEPGVIRNSGIICTIGPACKSVTILHKMISAGMNVARLNFSHGTYEYHEETINLVREAVDTFKPYFRPIAIALDTKGPEIRTGLVNGSATGEVNLYKGSTIKIVVDNKYSEQCNSSQLWVDYVNIINILEVNSSIYIDDGLISLVVIKKGSDFLMCEVENGGLLGSKKGVNLPGAKVDLPAVSEKDKEDLRFGVEHNVDMVFASFIRSGNAIKEIKDILGEKGKHILIISKIENLEGVQKFDEILEISDGIMVARGDLGIEIPPEKVVLAQKMMIGRCNRAGKPVICATQMLESMINKPTPTKAEISDVANAVLDGADCVMLSGETAKGQYPLEAVQVMHSICREAENVLYQSKFFEAIKHTISGPTDQTHSTAVAAVEAAQRCHAAAIIVITTTGRSAHLIAKYRPTCPILTVTRHPITARQSHLWRGLHPIFYN-EPRMIDWTEDMDERIHYSLSYGFRRGFLQMNDFVIIVTGWKAGVGSTNTLRIIRIEE 532          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000006009.1 (SMESG000006009.1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 303/528 (57.39%), Postives = 397/528 (75.19%), Query Frame = 2
Query:   89 TTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            T S+  E S  + +++         L H C LD+ S+P   RNTGI+CT+GPA KS + +  M+++GMN+ARLNFSHG++EYH ETI+ VR+   +F    RP+AIALDTKGPEIRTGLI+GSGTAE+ L  G  I + TD+ + E CDE  L++DY NI  +  +  KIY+DDGLISL+V++ G + + C +ENGG LGSKKG+N+PG  VDLPAVSEKDKQDL F  EQ +D+VFASFIR+  AI EIR+ILGE+GKH+ IIAKIE+HEGI R DEI+   DGI+VARGD+GIEIP +KV +AQKMMI KCNK GKPVICATQMLESM+ KPRPTRAE SDVANAVLDG+DCVMLSGE+AKG +P++AV TMH++C+EAEA+ F ++  +++K       +   + AIAAVEAA +S A  IIV+TT+G S+ L+S++RP+CPIL VTR ++  RQCHLWRGLHPL  E  +   +W ED+D R+  ++    K G +++G++VVIVTGW+  SG TNT+RI+ ++
Sbjct:    3 TNSSSVEKSDSLTQKRFMKNKPDCVLSHLCDLDIDSDPGSVRNTGIICTIGPACKSIKTLHGMMSSGMNVARLNFSHGTHEYHAETIKLVREAIETFKPHRRPIAIALDTKGPEIRTGLIRGSGTAEINLVDGQQIRIVTDDIFAEKCDEKNLWLDYKNITNILDIGNKIYIDDGLISLIVQAKGKDYLDCKVENGGLLGSKKGVNLPGAQVDLPAVSEKDKQDLKFGVEQNVDIVFASFIRNADAIREIRSILGEEGKHILIIAKIENHEGIKRIDEIIEEADGIMVARGDMGIEIPAQKVVVAQKMMIAKCNKQGKPVICATQMLESMVSKPRPTRAEISDVANAVLDGSDCVMLSGESAKGSFPIQAVKTMHEVCKEAEAIFFQNKYLQEIKNVNRHFNNHVEASAIAAVEAAQLSKASAIIVLTTTGNSSHLISKYRPRCPILAVTRNEVVARQCHLWRGLHPLLVEFPRLD-NWSEDVDARIDCSIQYGYKSGILKKGDSVVIVTGWKPVSGSTNTIRIVNVD 529          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017671.1 (SMESG000017671.1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 302/525 (57.52%), Postives = 392/525 (74.67%), Query Frame = 2
Query:  101 FQETSYFVQ-RQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITIE 1672
            F++++YF Q R++V  + A + LE    L++ S+P   RNTGI+CTLGPA  S  ++  MI AGMN+ARLNFSHG++E H  +I+ +R+   +      P+AIALDTKGPEIRTGLI  + T EV L  GN I L   E+Y   CDEN ++VDY +I+K+ K+  +I++DDGLISL+V+   +  + C IENGG LGS+KG+N+PG NVDLPAVSEKDK+DL FA EQ +D+VFASFIR+  +++ IR ILGEKGKH+ II+KIE+ EG+I+FDEIL + DGI+VARGDLGIEIP EKV  AQKMMIGKCN  GK VICAT MLESMI K RPTRAE SDVANAV+DG+DCVMLSGE+AKG YP+EAV  MH ICREAE + F     + +K  + LP D THS AIAAVEAA    A  IIV+TTSG SA+L++++RP CPIL +TR  IT RQ HLWRGLHP+ + ++    +W +DMD R+ F+++ A +RGFV+  + ++IVTG +AGSG TNTL+++ +E
Sbjct:    8 FEQSNYFFQERRRVHKDYA-TNLELVADLNIDSDPGVIRNTGIICTLGPACASVAILHKMIAAGMNVARLNFSHGTHEDHARSIKLLREAIATLKPYRFPIAIALDTKGPEIRTGLINNNETGEVRLIKGNNIKLVVSEEYYRKCDENFIWVDYKSILKLLKVGNRIFIDDGLISLIVEEKDSEFLLCRIENGGMLGSRKGVNLPGVNVDLPAVSEKDKEDLKFAVEQNVDIVFASFIRNAESVNIIRKILGEKGKHILIISKIENQEGMIQFDEILEASDGIMVARGDLGIEIPPEKVICAQKMMIGKCNVAGKSVICATHMLESMITKSRPTRAEISDVANAVIDGSDCVMLSGESAKGRYPVEAVKMMHTICREAEHLFFQSNFFESIKETVNLPTDHTHSTAIAAVEAAQRCNAAVIIVLTTSGTSAKLIAKYRPSCPILTLTRNPITARQAHLWRGLHPILF-SDPRKDEWPKDMDLRINFSINYAYQRGFVKALDIIIIVTGSKAGSGSTNTLQVVKLE 530          
The following BLAST results are available for this feature:
BLAST of Pyruvate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKM0.000e+060.08pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+060.08pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+060.08pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+060.08pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM0.000e+060.26pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pyk-10.000e+055.37Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+055.37Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+055.37Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+054.97Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-10.000e+054.97Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PyK0.000e+059.49gene:FBgn0267385 transcript:FBtr0084214[more]
PyK0.000e+059.49gene:FBgn0267385 transcript:FBtr0084213[more]
CG29646.660e-15144.47gene:FBgn0031462 transcript:FBtr0077722[more]
CG70693.564e-14252.32gene:FBgn0038952 transcript:FBtr0084215[more]
CG73622.905e-7348.69gene:FBgn0038258 transcript:FBtr0331700[more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma0.000e+062.52pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma0.000e+062.33pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma0.000e+062.33pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkmb0.000e+062.33pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pkmb0.000e+062.33pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkm0.000e+062.02pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+062.26pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+062.26pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+061.88pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm0.000e+061.88pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkm0.000e+059.89pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pkm0.000e+060.08pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pklr0.000e+055.38pyruvate kinase liver and red blood cell [Source:M... [more]
Pklr0.000e+055.38pyruvate kinase liver and red blood cell [Source:M... [more]
Pkm1.143e-9260.34pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14618|KPYM_HUMAN0.000e+060.26Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM... [more]
sp|Q92122|KPYM_XENLA0.000e+062.64Pyruvate kinase PKM OS=Xenopus laevis OX=8355 GN=p... [more]
sp|Q5NVN0|KPYM_PONAB0.000e+059.89Pyruvate kinase PKM OS=Pongo abelii OX=9601 GN=PKM... [more]
sp|P11979|KPYM_FELCA0.000e+060.96Pyruvate kinase PKM OS=Felis catus OX=9685 GN=PKM ... [more]
sp|P11974|KPYM_RABIT0.000e+059.51Pyruvate kinase PKM OS=Oryctolagus cuniculus OX=99... [more]
back to top
BLAST of Pyruvate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F2740.000e+066.35Pyruvate kinase OS=Macrostomum lignano OX=282301 G... [more]
A0A267EYV50.000e+064.81Pyruvate kinase (Fragment) OS=Macrostomum lignano ... [more]
Q5DAM70.000e+063.27Pyruvate kinase OS=Schistosoma japonicum OX=6182 G... [more]
A0A095B0840.000e+062.71Pyruvate kinase OS=Schistosoma haematobium OX=6185... [more]
A0A430Q1120.000e+062.89Pyruvate kinase OS=Schistosoma bovis OX=6184 GN=DC... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma0.000e+062.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+062.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+062.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+062.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma0.000e+062.33pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pkma0.000e+059.77pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC192.841e-15848.46Pyruvate kinase; functions as a homotetramer in gl... [more]
PYK25.051e-14847.05Pyruvate kinase; appears to be modulated by phosph... [more]
YAL037C-B_mRNA1.770e-2330.86Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499630.000e+054.94Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RE... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma0.000e+063.29pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkma0.000e+062.72pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkma0.000e+062.72pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkmb0.000e+062.84pyruvate kinase PKM [Source:NCBI gene;Acc:10117042... [more]
pklr0.000e+054.72pyruvate kinase PKM [Source:NCBI gene;Acc:10116118... [more]
back to top
BLAST of Pyruvate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045839.10.000e+0100.00SMESG000045839.1[more]
SMESG000052083.10.000e+061.38SMESG000052083.1[more]
SMESG000017675.10.000e+061.71SMESG000017675.1[more]
SMESG000006009.10.000e+057.39SMESG000006009.1[more]
SMESG000017671.10.000e+057.52SMESG000017671.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018556 ID=SMED30018556|Name=Pyruvate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1825bp
TCAATTTTATTTAACTTTTAATTTTTAATTAATATATATTGATAAACTAA
TAAAATTTACTGATTTTTATTTTTAATAAAGAATTATGACTACTTCAAAT
TTCCAAGAAACAAGTTATTTTGTTCAACGACAACAAGTTCAGATTGAAGC
CGCCAGGTCGACATTGGAGCACACTTGCCTGCTAGATGTTTACAGTGAGC
CCGCCTATGCCAGAAATACGGGAATTGTATGTACATTAGGTCCTGCTTCA
AAGTCACCGGAAGTGATTAAAAACATGATCAATGCAGGAATGAACATTGC
CAGACTGAATTTCTCTCATGGAAGCTATGAATATCATAAAGAAACAATTG
AGACTGTTCGTCAGGTAACTTTATCTTTTGGGAATGTTTACCGTCCGGTT
GCCATCGCGTTAGACACCAAAGGTCCTGAGATTAGAACAGGTCTAATAAA
AGGAAGTGGTACAGCTGAAGTCATTTTAAAATCTGGAAATTACATAACAC
TGACAACAGATGAAAAATATAAAGAAGATTGCGATGAAAACACATTATAT
GTGGATTATGCTAACATTATAAAAGTAGCGAAAATGGATAAAAAGATTTA
CGTAGATGACGGACTAATTAGTTTAGTAGTGAAGAGCATAGGTGCAAATG
AAATAAAGTGTTTAATAGAAAATGGAGGAAATTTAGGTTCTAAAAAAGGC
ATAAATATGCCAGGTCAAAATGTAGATTTGCCCGCTGTTTCTGAAAAAGA
CAAACAAGATTTAATATTTGCCGCGGAACAAGAATTAGACATGGTGTTTG
CTAGCTTCATCAGAAGTGGGTCGGCTATTGATGAGATTCGTGCTATTCTC
GGAGAAAAGGGCAAACATATGAAAATTATTGCGAAAATAGAAAGTCATGA
AGGAATAATAAGATTTGATGAAATATTGGCCTCTTGTGACGGAATACTGG
TGGCACGAGGTGATCTTGGAATAGAAATCCCAACAGAAAAAGTATTCATT
GCTCAAAAAATGATGATAGGAAAATGCAATAAAGTTGGAAAACCTGTGAT
ATGTGCAACACAAATGTTGGAATCAATGATTTATAAGCCAAGACCAACTC
GGGCTGAAGCAAGCGATGTTGCCAATGCTGTATTAGATGGGGCTGATTGC
GTCATGTTGTCAGGTGAAACGGCAAAAGGCTTATATCCTTTGGAAGCTGT
AATGACAATGCATCAAATATGTCGCGAGGCTGAAGCTGTTACATTTCATG
ATGAATTGCAAAAAGATTTAAAATATGGTTTAACACTTCCGATTGATGTT
ACTCATTCTGTAGCCATTGCGGCTGTTGAAGCAGCCTCAATGAGTTTAGC
CGGTTGTATAATAGTCGTAACGACATCTGGCAGATCCGCTCAATTAATGT
CGAGACATCGTCCTAAGTGCCCTATTTTGGTTGTAACTAGAGAAAAAATA
ACTTGTAGACAATGCCATCTTTGGAGAGGTCTCCATCCTTTGTATTATGA
AGCTGAGAAACCTCATGGTGATTGGATTGAAGATATGGATGAGAGATTAA
AATTCGCAGTTGACATGGCTAAAAAAAGAGGATTTGTAAGAGAAGGCAAT
AATGTTGTAATAGTAACCGGATGGAGAGCCGGAAGTGGAAGAACCAACAC
ATTGCGAATAATCACTATAGAAGATTGTATGCCAACTATAATGAAAATAG
AAAATTAGAAGATTTAATTATATTAAAAACTGAGTGTTATTAAGTTTTAT
TAAAATGTTTGTAATGTTCAAAATGGATATAGAATGACTTTGTTAAAAAC
GAAATATAAAAGAAATATAATTAAC
back to top

protein sequence of SMED30018556-orf-1

>SMED30018556-orf-1 ID=SMED30018556-orf-1|Name=SMED30018556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MTTSNFQETSYFVQRQQVQIEAARSTLEHTCLLDVYSEPAYARNTGIVCT
LGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGN
VYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCD
ENTLYVDYANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNL
GSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDE
IRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPT
EKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVL
DGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKYGLT
LPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVV
TREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGF
VREGNNVVIVTGWRAGSGRTNTLRIITIEDCMPTIMKIEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001697Pyr_Knase
IPR015813Pyrv/PenolPyrv_Kinase-like_dom
IPR015793Pyrv_Knase_brl
IPR015794Pyrv_Knase_a/b
IPR015806Pyrv_Knase_insert_dom_sf
IPR015795Pyrv_Knase_C
IPR011037Pyrv_Knase-like_insert_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0030955potassium ion binding
GO:0000287magnesium ion binding
GO:0004743pyruvate kinase activity
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
GO:0016310phosphorylation