CEP78

Overview
NameCEP78 (AFB74717.1)
Smed IDSMED30018550
Length (bp)2885
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CEP78 (SMED30018550) t-SNE clustered cells

Violin plots show distribution of expression levels for CEP78 (SMED30018550) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CEP78 (SMED30018550) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CEP78 (SMED30018550) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018550

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018550SMESG000064712.1 dd_Smed_v6_9671_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30018550SMESG000064712.1 Contig50946uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018550SMESG000064712.1 Contig50946newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018550SMESG000064712.1 Contig30117uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018550SMESG000064712.1 Contig30117newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30018550SMESG000064712.1 dd_Smed_v4_9671_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CEP78 vs. Ensembl Human
Match: CEP78 (centrosomal protein 78 [Source:HGNC Symbol;Acc:HGNC:25740])

HSP 1 Score: 366.696 bits (940), Expect = 1.410e-113
Identity = 221/620 (35.65%), Postives = 348/620 (56.13%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G      H  +   +  G    K   S  + S   L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGS----GHKGKATIRIVGLATKKPVSSGRKHS---LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 555          
BLAST of CEP78 vs. Ensembl Human
Match: CEP78 (centrosomal protein 78 [Source:HGNC Symbol;Acc:HGNC:25740])

HSP 1 Score: 366.696 bits (940), Expect = 1.410e-113
Identity = 221/620 (35.65%), Postives = 348/620 (56.13%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G      H  +   +  G    K   S  + S   L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGS----GHKGKATIRIVGLATKKPVSSGRKHS---LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 555          
BLAST of CEP78 vs. Ensembl Human
Match: CEP78 (centrosomal protein 78 [Source:HGNC Symbol;Acc:HGNC:25740])

HSP 1 Score: 367.081 bits (941), Expect = 1.995e-113
Identity = 221/620 (35.65%), Postives = 348/620 (56.13%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G      H  +   +  G    K   S  + S   L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGS----GHKGKATIRIVGLATKKPVSSGRKHS---LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 555          
BLAST of CEP78 vs. Ensembl Human
Match: CEP78 (centrosomal protein 78 [Source:HGNC Symbol;Acc:HGNC:25740])

HSP 1 Score: 365.54 bits (937), Expect = 4.164e-113
Identity = 222/620 (35.81%), Postives = 349/620 (56.29%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G         R V      L +K   S  R+ +  L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGSGHKGKATIRIVIWRHRGLATKKPVSSGRKHS--LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 560          
BLAST of CEP78 vs. Ensembl Human
Match: CEP78 (centrosomal protein 78 [Source:HGNC Symbol;Acc:HGNC:25740])

HSP 1 Score: 365.155 bits (936), Expect = 7.093e-113
Identity = 222/620 (35.81%), Postives = 349/620 (56.29%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G         R V      L +K   S  R+ +  L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGSGHKGKATIRIVIWRHRGLATKKPVSSGRKHS--LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 560          
BLAST of CEP78 vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 55.0694 bits (131), Expect = 2.980e-7
Identity = 72/295 (24.41%), Postives = 136/295 (46.10%), Query Frame = 2
Query:  269 RIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV------IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKM--AGNISTL--------NLTACSLSPIGLRALGDLIKFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRV 1102
            +I  + W  IF SI+   SL+ +++R Y  LN +  +P    K+ R++         +   +M+     VL   L     L  L L    L+ +D + I Q +  NS+L+ L L +  IGDSG+  +C  ++   A   S+L        N+T  S+  +   AL +  K + ++  +N    E +        +   + R+ L +N GI  EGA+ILAE + D++ +  +D+++  +    +      +K N+++ +L+      ID   +K  +E+V    D  E  ++ ++ 
Sbjct:  214 QIDMRGWTTIFRSIRHAVSLQMLNLR-YTNLN-DRSIP-ALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKSSLSAMVLWNNNVTGASMDSLA-EALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGL-QNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLN------IDASCVKLSSEKVREYQDEFERYFREIQT 497          
BLAST of CEP78 vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 54.6842 bits (130), Expect = 3.240e-7
Identity = 72/295 (24.41%), Postives = 136/295 (46.10%), Query Frame = 2
Query:  269 RIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV------IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKM--AGNISTL--------NLTACSLSPIGLRALGDLIKFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRV 1102
            +I  + W  IF SI+   SL+ +++R Y  LN +  +P    K+ R++         +   +M+     VL   L     L  L L    L+ +D + I Q +  NS+L+ L L +  IGDSG+  +C  ++   A   S+L        N+T  S+  +   AL +  K + ++  +N    E +        +   + R+ L +N GI  EGA+ILAE + D++ +  +D+++  +    +      +K N+++ +L+      ID   +K  +E+V    D  E  ++ ++ 
Sbjct:  214 QIDMRGWTTIFRSIRHAVSLQMLNLR-YTNLN-DRSIP-ALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKSSLSAMVLWNNNVTGASMDSLA-EALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGL-QNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLN------IDASCVKLSSEKVREYQDEFERYFREIQT 497          
BLAST of CEP78 vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 53.5286 bits (127), Expect = 7.581e-7
Identity = 65/261 (24.90%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  269 RIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV------IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKM--AGNISTL--------NLTACSLSPIGLRALGDLIKFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDL 1000
            +I  + W  IF SI+   SL+ +++R Y  LN +  +P    K+ R++         +   +M+     VL   L     L  L L    L+ +D + I Q +  NS+L+ L L +  IGDSG+  +C  ++   A   S+L        N+T  S+  +   AL +  K + ++  +N    E +        +   + R+ L +N GI  EGA+ILAE + D++ +  +D+++  +    +      +K N+++ +L++
Sbjct:  214 QIDMRGWTTIFRSIRHAVSLQMLNLR-YTNLN-DRSIP-ALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKSSLSAMVLWNNNVTGASMDSLA-EALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGL-QNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNI 469          
BLAST of CEP78 vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 53.1434 bits (126), Expect = 1.037e-6
Identity = 65/261 (24.90%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  269 RIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV------IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKM--AGNISTL--------NLTACSLSPIGLRALGDLIKFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDL 1000
            +I  + W  IF SI+   SL+ +++R Y  LN +  +P    K+ R++         +   +M+     VL   L     L  L L    L+ +D + I Q +  NS+L+ L L +  IGDSG+  +C  ++   A   S+L        N+T  S+  +   AL +  K + ++  +N    E +        +   + R+ L +N GI  EGA+ILAE + D++ +  +D+++  +    +      +K N+++ +L++
Sbjct:  214 QIDMRGWTTIFRSIRHAVSLQMLNLR-YTNLN-DRSIP-ALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHREAVEKSSLSAMVLWNNNVTGASMDSLA-EALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGL-QNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNI 469          
BLAST of CEP78 vs. Ensembl Fly
Match: CG7886 (gene:FBgn0038248 transcript:FBtr0082976)

HSP 1 Score: 169.088 bits (427), Expect = 7.167e-43
Identity = 92/314 (29.30%), Postives = 171/314 (54.46%), Query Frame = 2
Query:  164 NFENYYDNLCALQDTCPIPAVKGHLNEG--IFDINGDRIRQQDWNPIFNSIKINKSLKFISIR---SYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQV-LVNGDGKETEY 1087
            +F   Y  LC  ++  P+P ++   N      ++ GD++   DW  +  ++  +  L+ + +R   +Y Q N++    EK+A++ R R PVI T+ +  +L + + +C+++ +NL+ L+L+G+ L++  +  I + L  N  L+ +S     IGD G  V+C+  K    I   +L+ C L+  G   + D++K Q ++R  E W++SLRYR  + +T+ G+R + L  N  IGD G   + E LK+D W+K ID++ C LT       L  L+ N+ +   ++R N  I + L +S+ +++  +  + +E EY
Sbjct:   40 SFHFRYLELCRAKNLTPVPEIRSKSNATTTFLELCGDKLAVSDWQLLTEALHYDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQR-PVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSIHDRLGCLPEEKQEPEY 352          
BLAST of CEP78 vs. Ensembl Zebrafish
Match: cep78 (centrosomal protein 78 [Source:ZFIN;Acc:ZDB-GENE-070905-1])

HSP 1 Score: 334.339 bits (856), Expect = 2.093e-102
Identity = 204/607 (33.61%), Postives = 323/607 (53.21%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTE-QYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            M+E  Q R+RGA +FE YYD+LCA Q + P+ AVK  L+ G+ + N D++   DW P+ +++ INK L  +SIRS   L+   G         + + P I +K ++  LCK ++ CL  + +L  L+L  + LRE D+T + +GL K+ +L+HLSL  C IGD GL V+C ++K +  I  ++ T+C+++  G   + ++IK QAM RH+ AW E+LRYR A F+ M G+RR+TLN N+ IGD G   LA  L +DLWVKA+DLQ C ++++  +   ++L+ NSTL VLD+RRNP+ID +++K+V ++VL+N    +++Y WL+      SAD++                            + R K+AG    R            +   +S  +  R     S+   PWRTAARA   +G                           S+   R  Q  +    SV    +    ++D +   V SPL   T  Q+  +      LK E+   R +L + +  +     +L E+  EN RLR         N  ++E    SS+L++E +LE+IE+SF +F++FLD+L+++GLG+  + AG++Q
Sbjct:    1 MLEPAQSRRRGAQDFEGYYDHLCAAQGSAPVRAVKACLSRGVLEFNPDQLSLADWTPVLSALAINKHLHQVSIRSCHLLS--TGAQNVYRPHNKKKTPAIHSKTVSLQLCKAVQKCLCESSSLRTLQLHALPLRERDLTALTKGLAKSVSLEHLSLAHCPIGDQGLEVICQSVKYSSTIKGVDFTSCNITWQGAEHMANIIKHQAMRRHSTAWVETLRYRRAEFEAMNGLRRITLNDNILIGDRGVSALARELTEDLWVKAVDLQRCGISNDGAQVLEQMLQSNSTLCVLDIRRNPLIDNNVVKAVLKKVLMNTKNLDSQYLWLKPPSPKDSADQSR---------------------------QFRRKNAGKATYRIG----------SRRSSSVISVFRPPRPGSTGYIPWRTAARADLQRG--------------------------ASRADGRTDQSFQ-NATSVQVTVETESESEDVEAKDVESPLEKITSYQFRRLQTENNRLKVELEECRLRLAEERNTRLKANSRLVELELENERLRT-------MNQSLSEAHISSSVLEDERVLESIESSFHKFHAFLDLLKDAGLGQFASMAGIEQ 534          
BLAST of CEP78 vs. Ensembl Zebrafish
Match: cep78 (centrosomal protein 78 [Source:ZFIN;Acc:ZDB-GENE-070905-1])

HSP 1 Score: 334.339 bits (856), Expect = 5.663e-102
Identity = 204/607 (33.61%), Postives = 323/607 (53.21%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTE-QYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            M+E  Q R+RGA +FE YYD+LCA Q + P+ AVK  L+ G+ + N D++   DW P+ +++ INK L  +SIRS   L+   G         + + P I +K ++  LCK ++ CL  + +L  L+L  + LRE D+T + +GL K+ +L+HLSL  C IGD GL V+C ++K +  I  ++ T+C+++  G   + ++IK QAM RH+ AW E+LRYR A F+ M G+RR+TLN N+ IGD G   LA  L +DLWVKA+DLQ C ++++  +   ++L+ NSTL VLD+RRNP+ID +++K+V ++VL+N    +++Y WL+      SAD++                            + R K+AG    R            +   +S  +  R     S+   PWRTAARA   +G                           S+   R  Q  +    SV    +    ++D +   V SPL   T  Q+  +      LK E+   R +L + +  +     +L E+  EN RLR         N  ++E    SS+L++E +LE+IE+SF +F++FLD+L+++GLG+  + AG++Q
Sbjct:    1 MLEPAQSRRRGAQDFEGYYDHLCAAQGSAPVRAVKACLSRGVLEFNPDQLSLADWTPVLSALAINKHLHQVSIRSCHLLS--TGAQNVYRPHNKKKTPAIHSKTVSLQLCKAVQKCLCESSSLRTLQLHALPLRERDLTALTKGLAKSVSLEHLSLAHCPIGDQGLEVICQSVKYSSTIKGVDFTSCNITWQGAEHMANIIKHQAMRRHSTAWVETLRYRRAEFEAMNGLRRITLNDNILIGDRGVSALARELTEDLWVKAVDLQRCGISNDGAQVLEQMLQSNSTLCVLDIRRNPLIDNNVVKAVLKKVLMNTKNLDSQYLWLKPPSPKDSADQSR---------------------------QFRRKNAGKATYRIG----------SRRSSSVISVFRPPRPGSTGYIPWRTAARADLQRG--------------------------ASRADGRTDQSFQ-NATSVQVTVETESESEDVEAKDVESPLEKITSYQFRRLQTENNRLKVELEECRLRLAEERNTRLKANSRLVELELENERLRT-------MNQSLSEAHISSSVLEDERVLESIESSFHKFHAFLDLLKDAGLGQFASMAGIEQ 534          
BLAST of CEP78 vs. Ensembl Zebrafish
Match: nlrc3 (NLR family, CARD domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-071119-1])

HSP 1 Score: 51.6026 bits (122), Expect = 4.533e-6
Identity = 56/275 (20.36%), Postives = 121/275 (44.00%), Query Frame = 2
Query:  248 IFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV--------IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQ-----AMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLL 1033
            +  +  + I  +   P+  ++ +N++L  + +R        N +  K AK L   + +        ++   +     + L + L +   L  L +Q   +    +  I +GL+KN TL+  ++ S  +GD G + L  A+ +   + TL+L + S+S  G++AL   ++          R N       +           +R + L  NL + DEG   +AE+++ +  + ++ LQ   + + + +   + L  N+ + +LDL+ N + D  ++
Sbjct:  346 MLSLADNSISSKGVKPLSRALLVNRTLTTLDLRG-------NNIGAKGAKTLCEALKLNQFLVSVNLQNNHIEDEGARSLSEVLQSNRKLTTLNVQKNGIGPEGMKKIAEGLIKNQTLQDFNVSSNHLGDLGTVALAQALMVNHVLHTLSLQSNSVSDRGIKALSHALQSNRGLCCLNLRENSIGVAGAKDIAKALKVNTCLRELDLTANL-LHDEGVTAIAEAMRVNRSISSLHLQWNFMKAGAAKALAESLSSNTCIQLLDLQENALGDNGVI 612          
BLAST of CEP78 vs. Ensembl Xenopus
Match: cep78 (centrosomal protein 78kDa [Source:NCBI gene;Acc:100037836])

HSP 1 Score: 321.242 bits (822), Expect = 2.476e-96
Identity = 148/323 (45.82%), Postives = 218/323 (67.49%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKW 1093
            MI++V+ R +G+ +F ++Y+ LCALQD+ PIPAVK ++  G    N DRI+  DW PI NS+KINKSL  +SI+S  Q  L     EK     + RIP IR+K+MT  +CK +  CL+ + +L  LEL G+ LRE D+ ++ +GL  +S+++ LSL  C  GD GL ++C ++K +  I T+N T C+L+  G   +  +IK QA  RH+EAW ESLRYR  + D M G+RR+TLN N  +GD GA+ LAE + +DLW+KA+DL++C +++   + FL   + N+TL++LD+RRNP+IDR LLK++ E+VL+N     +EYKW
Sbjct:    1 MIDSVRIRHQGSMDFLSHYEYLCALQDSVPIPAVKANIRHGSLSFNADRIKLSDWLPILNSLKINKSLLNVSIKSCHQPGLGEFGAEKYGIYFKRRIPPIRSKDMTFQVCKAITSCLSVSGSLKELELHGLPLRERDLRILAKGLAASSSVESLSLAYCSCGDEGLEIICQSVKNSPTIKTVNFTGCNLTWRGAEHIASIIKHQATRRHSEAWAESLRYRRPDLDCMAGLRRVTLNSNTLVGDRGAIALAEVIGEDLWLKALDLRQCGISNEGAQAFLNAFQTNTTLIILDIRRNPLIDRSLLKTIIERVLMNAHDTNSEYKW 323          

HSP 2 Score: 60.4622 bits (145), Expect = 1.457e-8
Identity = 28/68 (41.18%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 1739 ENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            EN RLR     +S +   +  R+  S IL++E +L++IE SF +F++FLD+L+++GLG++   AG+DQ
Sbjct:  465 ENTRLRQINHTLSES---LHSRTATSVILEDEGVLDSIEKSFSKFHAFLDLLKDAGLGQLANLAGIDQ 529          
BLAST of CEP78 vs. Ensembl Xenopus
Match: cep78 (centrosomal protein 78kDa [Source:NCBI gene;Acc:100037836])

HSP 1 Score: 277.33 bits (708), Expect = 1.166e-80
Identity = 176/531 (33.15%), Postives = 288/531 (54.24%), Query Frame = 2
Query:  383 EKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVD----RRSNDILHEENHNKTSMDNSRTNSARNL-----NNNSSKG-QPWRTAARAIRYKGYPPDHV-PGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            EK     + RIP IR+K+MT  +CK +  CL+ + +L  LEL G+ LRE D+ ++ +GL  +S+++ LSL  C  GD GL ++C ++K +  I T+N T C+L+  G   +  +IK QA  RH+EAW ESLRYR  + D M G+RR+TLN N  +GD GA+ LAE + +DLW+KA+DL++C +++   + FL   + N+TL++LD+RRNP+IDR LLK++ E+VL+N     +EYKW                     Y  P+   N          G++R K   S++    R+  +I+      K  M   R  S++ L         ++G  PWRTA RA R++    +   PGK        +  V  I +    S               + + D++++  DQ  +V      G+ +   + K+ K L+ E+   ++ L+  +K +   + ++ E+  EN RLR     +S +   +  R+  S IL++E +L++IE SF +F++FLD+L+++GLG++   AG+DQ
Sbjct:   17 EKYGIYFKRRIPPIRSKDMTFQVCKAITSCLSVSGSLKELELHGLPLRERDLRILAKGLAASSSVESLSLAYCSCGDEGLEIICQSVKNSPTIKTVNFTGCNLTWRGAEHIASIIKHQATRRHSEAWAESLRYRRPDLDCMAGLRRVTLNSNTLVGDRGAIALAEVIGEDLWLKALDLRQCGISNEGAQAFLNAFQTNTTLIILDIRRNPLIDRSLLKTIIERVLMNAHDTNSEYKW---------------------YTSPSSKDN----------GKVRQKWR-SINNWNGRKGKNIVRVGFSTKKPMVIGRKYSSKELYCPDPRPPGAEGFLPWRTAERAKRHRDVSGEWASPGK-------ADTAVKVIMDSETSS--------------ESEKSDNILSILDQEYAV-----PGSGEKTSV-KNYKCLQVELQICQKNLNDERKARLRADERIMELEFENTRLRQINHTLSES---LHSRTATSVILEDEGVLDSIEKSFSKFHAFLDLLKDAGLGQLANLAGIDQ 485          
BLAST of CEP78 vs. Ensembl Xenopus
Match: cep78 (centrosomal protein 78kDa [Source:NCBI gene;Acc:100037836])

HSP 1 Score: 239.58 bits (610), Expect = 2.713e-67
Identity = 107/237 (45.15%), Postives = 161/237 (67.93%), Query Frame = 2
Query:  383 EKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKW 1093
            EK     + RIP IR+K+MT  +CK +  CL+ + +L  LEL G+ LRE D+ ++ +GL  +S+++ LSL  C  GD GL ++C ++K +  I T+N T C+L+  G   +  +IK QA  RH+EAW ESLRYR  + D M G+RR+TLN N  +GD GA+ LAE + +DLW+KA+DL++C +++   + FL   + N+TL++LD+RRNP+IDR LLK++ E+VL+N     +EYKW
Sbjct:   17 EKYGIYFKRRIPPIRSKDMTFQVCKAITSCLSVSGSLKELELHGLPLRERDLRILAKGLAASSSVESLSLAYCSCGDEGLEIICQSVKNSPTIKTVNFTGCNLTWRGAEHIASIIKHQATRRHSEAWAESLRYRRPDLDCMAGLRRVTLNSNTLVGDRGAIALAEVIGEDLWLKALDLRQCGISNEGAQAFLNAFQTNTTLIILDIRRNPLIDRSLLKTIIERVLMNAHDTNSEYKW 253          

HSP 2 Score: 60.4622 bits (145), Expect = 1.346e-8
Identity = 28/68 (41.18%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 1739 ENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            EN RLR     +S +   +  R+  S IL++E +L++IE SF +F++FLD+L+++GLG++   AG+DQ
Sbjct:  395 ENTRLRQINHTLSES---LHSRTATSVILEDEGVLDSIEKSFSKFHAFLDLLKDAGLGQLANLAGIDQ 459          
BLAST of CEP78 vs. Ensembl Mouse
Match: Cep78 (centrosomal protein 78 [Source:MGI Symbol;Acc:MGI:1924386])

HSP 1 Score: 353.599 bits (906), Expect = 7.234e-110
Identity = 218/613 (35.56%), Postives = 344/613 (56.12%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNL-ENGLPEKKA---KILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARN-LNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKD--LKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQD+ P+PAV+  L +G+ D N DR+R  DW P+ +++++N+ L  ++I+S FQ  L E  L    A   +I R+R+P +R+K+++  LCK LR CL+ +  L  LEL G+ LRE D+T + +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD+GA   A+SL +DLW++A+DLQ+C LTS   +  L+ L+ N TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+                P S    P+K      + +      L S   G    R      + + N       +   A N L   +S   PWRTA RA R +                    +   + N+ KKS+  P    +E  S S        TD+ + SS        + Q  P   S+K+  L+ ++     QL + +  +   + ++ E+  EN +LRN     S + A+ A+ S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDCAADFFSHYEYLCALQDSVPLPAVRACLRDGVLDFNADRLRAVDWAPLLSTLRVNRDLPLVAIKSSFQPWLGETVLRSGGADTHRICRNRVPAVRSKDISFQLCKALRGCLSVSGVLRNLELNGLILRERDLTSLTKGLSKSTSLVHLSLANCPIGDGGLEIICQGIKNSVTLKTVNFTGCNLTWQGACHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDQGASAFADSLSEDLWLRALDLQQCGLTSEGAKALLEALETNRTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSADSEYQWV--------------TSPSS--KEPSKTAKQRKKTIV-----LGSSRKGKATIRIGLATKKPSSNGRKQGLGKDCYAPNPLPPGASGFLPWRTAERAKRSRS---------------SSLIKTRDLSNHLKKSD-FPVTVTVESPSSSE-------TDETEDSS-------ESVQEAPQKTSIKEETLQEKLEECLRQLKEERVIRLKADKRVSELEHENAQLRNI--NFSLSEALHAQ-SLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 559          
BLAST of CEP78 vs. Ensembl Mouse
Match: Cep78 (centrosomal protein 78 [Source:MGI Symbol;Acc:MGI:1924386])

HSP 1 Score: 355.525 bits (911), Expect = 1.273e-108
Identity = 218/613 (35.56%), Postives = 344/613 (56.12%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNL-ENGLPEKKA---KILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARN-LNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKD--LKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQD+ P+PAV+  L +G+ D N DR+R  DW P+ +++++N+ L  ++I+S FQ  L E  L    A   +I R+R+P +R+K+++  LCK LR CL+ +  L  LEL G+ LRE D+T + +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD+GA   A+SL +DLW++A+DLQ+C LTS   +  L+ L+ N TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+                P S    P+K      + +      L S   G    R      + + N       +   A N L   +S   PWRTA RA R +                    +   + N+ KKS+  P    +E  S S        TD+ + SS        + Q  P   S+K+  L+ ++     QL + +  +   + ++ E+  EN +LRN     S + A+ A+ S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDCAADFFSHYEYLCALQDSVPLPAVRACLRDGVLDFNADRLRAVDWAPLLSTLRVNRDLPLVAIKSSFQPWLGETVLRSGGADTHRICRNRVPAVRSKDISFQLCKALRGCLSVSGVLRNLELNGLILRERDLTSLTKGLSKSTSLVHLSLANCPIGDGGLEIICQGIKNSVTLKTVNFTGCNLTWQGACHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDQGASAFADSLSEDLWLRALDLQQCGLTSEGAKALLEALETNRTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSADSEYQWV--------------TSPSSKE--PSKTAKQRKKTIV-----LGSSRKGKATIRIGLATKKPSSNGRKQGLGKDCYAPNPLPPGASGFLPWRTAERAKRSRS---------------SSLIKTRDLSNHLKKSD-FPVTVTVESPSSSE-------TDETEDSSE-------SVQEAPQKTSIKEETLQEKLEECLRQLKEERVIRLKADKRVSELEHENAQLRNI--NFSLSEALHAQ-SLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 559          
BLAST of CEP78 vs. Ensembl Mouse
Match: Nlrp2 (NLR family, pyrin domain containing 2 [Source:MGI Symbol;Acc:MGI:3041206])

HSP 1 Score: 64.6994 bits (156), Expect = 6.268e-10
Identity = 67/260 (25.77%), Postives = 121/260 (46.54%), Query Frame = 2
Query:  281 QDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMA-GNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKD-DLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQV 1054
            Q W+  F  +K+N+SL F+ +        +N L +K AK+L                C + ++     + ++   L+   L E+    +   LM + TL HLSL + ++GD+G+  LC ++     N+ TL L +C+++  G   L  ++K     +H +                     + LNR   IG +GA  L E+LK+    +K++ L  CS+T  + + F + L+ N +L  LDL +N ++  D +K+  E +
Sbjct:  784 QKWDDFFPVLKVNQSLIFLDLT-------DNSLLDKSAKLL----------------CNIWKEPKCILQRVS---LENCQLTEACCKDLSSVLMVSRTLTHLSLANNKLGDNGVKNLCESISCTECNLQTLVLWSCNITNAGCHYLSKMLKQTLSLKHLD---------------------LGLNR---IGTKGAKFLCEALKNPKSKLKSLWLCGCSITPLNCQDFSETLRSNKSLNTLDLSQN-VLGTDAIKTFCEAL 992          
BLAST of CEP78 vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 56.225 bits (134), Expect = 1.125e-7
Identity = 75/293 (25.60%), Postives = 126/293 (43.00%), Query Frame = 2
Query:  251 FDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATL--CKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNE---------------------AWKES-----LRYRWANFDTMCGIR----RMTLNRNL--------GIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRN 1009
             D+  + I       + +++KIN++L  +S++S   +  +  +   +A +    I +++ ++    L   + + D L    +L  L      + +     + + L  N  L++L L+S  I D G+ VL  A+     +S+LNL   S+SP G +AL      QA+ R+N                      A  E+     L  +W NF      R     + LNR L         IGDEGA  +A +LK +  + A+ LQ  S+ S   +   + L  N TL +LDLR N
Sbjct:   31 LDLRSNSIGPPGAKALADALKINRTLTSLSLQSNV-IKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQAL-----TQALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQW-NFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGN 316          

HSP 2 Score: 50.447 bits (119), Expect = 7.744e-6
Identity = 52/188 (27.66%), Postives = 81/188 (43.09%), Query Frame = 2
Query:  452 CKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPM 1015
             K L   L    +L  L+L+   +       +   L  N TL  LSL+S  I D G++ +  A+     IS L L    +  IG + + D +K             SL+    + +T              IGD GA+ LAE+LK +  ++ +DLQ  S++   V   ++ L  N TL  L+LR N +
Sbjct:   15 AKALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALK----------QNRSLKALMFSSNT--------------IGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSI 178          
BLAST of CEP78 vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 56.225 bits (134), Expect = 1.985e-7
Identity = 75/293 (25.60%), Postives = 126/293 (43.00%), Query Frame = 2
Query:  251 FDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATL--CKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNE---------------------AWKES-----LRYRWANFDTMCGIR----RMTLNRNL--------GIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRN 1009
             D+  + I       + +++KIN++L  +S++S   +  +  +   +A +    I +++ ++    L   + + D L    +L  L      + +     + + L  N  L++L L+S  I D G+ VL  A+     +S+LNL   S+SP G +AL      QA+ R+N                      A  E+     L  +W NF      R     + LNR L         IGDEGA  +A +LK +  + A+ LQ  S+ S   +   + L  N TL +LDLR N
Sbjct:  736 LDLRSNSIGPPGAKALADALKINRTLTSLSLQSNV-IKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALT-----QALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQW-NFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGN 1021          
BLAST of CEP78 vs. UniProt/SwissProt
Match: sp|Q5JTW2|CEP78_HUMAN (Centrosomal protein of 78 kDa OS=Homo sapiens OX=9606 GN=CEP78 PE=1 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.134e-112
Identity = 221/620 (35.65%), Postives = 350/620 (56.45%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWL---RVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHV---------PG--KNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQ++ P+PAV+  L EG+ D N DR+R  DW P+ +++KINK L  +SI+S+FQ  L +   +   K  RSR+P IR K++T  LCK L+ CL+ +  L  LEL G+ LRE D+T++ +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD GA   A+SL +DLW++A+DLQ+C LT+   +  L+ L+ N+TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+    VK+  ++A +      R+   G      H  +   +    L +K   S  R+ +  L +E +           +   L    S   PWRTA RA R++G+P             PG       E    +EV ++++ S+    +P+K  IEQ ++    ++ L                            K LK E   +R ++DK          ++ E+  EN +LRN   I    +  +  +S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLSTLKINKDLPLVSIKSFFQPWLGDTGSDMN-KFCRSRVPAIRYKDVTFQLCKALKGCLSISSVLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKTVNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKR----RTIILGS----GHKGKATIRIG--LATKKPVSSGRKHS--LGKEYY-----------APAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQPGFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECL----------------------------KQLKEERV-IRLKVDK----------RVSELEHENAQLRN---INFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 554          
BLAST of CEP78 vs. UniProt/SwissProt
Match: sp|Q6IRU7|CEP78_MOUSE (Centrosomal protein of 78 kDa OS=Mus musculus OX=10090 GN=Cep78 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 8.902e-108
Identity = 218/613 (35.56%), Postives = 344/613 (56.12%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNL-ENGLPEKKA---KILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARN-LNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKD--LKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            MI++V+ R+  A +F ++Y+ LCALQD+ P+PAV+  L +G+ D N DR+R  DW P+ +++++N+ L  ++I+S FQ  L E  L    A   +I R+R+P +R+K+++  LCK LR CL+ +  L  LEL G+ LRE D+T + +GL K+++L HLSL +C IGD GL ++C  +K +  + T+N T C+L+  G   +  ++K+Q M RH E W ESLRYR  + D M G+RR+TLN N  IGD+GA   A+SL +DLW++A+DLQ+C LTS   +  L+ L+ N TLVVLD+R+NP+ID  ++K+V ++VL NG   ++EY+W+                P S    P+K      + +      L S   G    R      + + N       +   A N L   +S   PWRTA RA R +                    +   + N+ KKS+  P    +E  S S        TD+ + SS        + Q  P   S+K+  L+ ++     QL + +  +   + ++ E+  EN +LRN     S + A+ A+ S  + IL +E +L +IENSF++F++FLD+L+++GLG++ T AG+DQ
Sbjct:    1 MIDSVKLRRDCAADFFSHYEYLCALQDSVPLPAVRACLRDGVLDFNADRLRAVDWAPLLSTLRVNRDLPLVAIKSSFQPWLGETVLRSGGADTHRICRNRVPAVRSKDISFQLCKALRGCLSVSGVLRNLELNGLILRERDLTSLTKGLSKSTSLVHLSLANCPIGDGGLEIICQGIKNSVTLKTVNFTGCNLTWQGACHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLIGDQGASAFADSLSEDLWLRALDLQQCGLTSEGAKALLEALETNRTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSADSEYQWV--------------TSPSSKE--PSKTAKQRKKTIV-----LGSSRKGKATIRIGLATKKPSSNGRKQGLGKDCYAPNPLPPGASGFLPWRTAERAKRSRS---------------SSLIKTRDLSNHLKKSD-FPVTVTVESPSSSE-------TDETEDSSE-------SVQEAPQKTSIKEETLQEKLEECLRQLKEERVIRLKADKRVSELEHENAQLRNI--NFSLSEALHAQ-SLTNMILDDEGVLGSIENSFQKFHAFLDLLKDAGLGQLATMAGIDQ 559          
BLAST of CEP78 vs. UniProt/SwissProt
Match: sp|A2RRS8|CEP78_XENTR (Centrosomal protein of 78 kDa OS=Xenopus tropicalis OX=8364 GN=cep78 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.409e-95
Identity = 148/323 (45.82%), Postives = 218/323 (67.49%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKW 1093
            MI++V+ R +G+ +F ++Y+ LCALQD+ PIPAVK ++  G    N DRI+  DW PI NS+KINKSL  +SI+S  Q  L     EK     + RIP IR+K+MT  +CK +  CL+ + +L  LEL G+ LRE D+ ++ +GL  +S+++ LSL  C  GD GL ++C ++K +  I T+N T C+L+  G   +  +IK QA  RH+EAW ESLRYR  + D M G+RR+TLN N  +GD GA+ LAE + +DLW+KA+DL++C +++   + FL   + N+TL++LD+RRNP+IDR LLK++ E+VL+N     +EYKW
Sbjct:    1 MIDSVRIRHQGSMDFLSHYEYLCALQDSVPIPAVKANIRHGSLSFNADRIKLSDWLPILNSLKINKSLLNVSIKSCHQPGLGEFGAEKYGIYFKRRIPPIRSKDMTFQVCKAITSCLSVSGSLKELELHGLPLRERDLRILAKGLAASSSVESLSLAYCSCGDEGLEIICQSVKNSPTIKTVNFTGCNLTWRGAEHIASIIKHQATRRHSEAWAESLRYRRPDLDCMAGLRRVTLNSNTLVGDRGAIALAEVIGEDLWLKALDLRQCGISNEGAQAFLNAFQTNTTLIILDIRRNPLIDRSLLKTIIERVLMNAHDTNSEYKW 323          

HSP 2 Score: 60.4622 bits (145), Expect = 7.525e-8
Identity = 28/68 (41.18%), Postives = 47/68 (69.12%), Query Frame = 2
Query: 1739 ENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            EN RLR     +S +   +  R+  S IL++E +L++IE SF +F++FLD+L+++GLG++   AG+DQ
Sbjct:  465 ENTRLRQINHTLSES---LHSRTATSVILEDEGVLDSIEKSFSKFHAFLDLLKDAGLGQLANLAGIDQ 529          
BLAST of CEP78 vs. UniProt/SwissProt
Match: sp|Q9VFH6|CEP78_DROME (Protein Cep78 homolog OS=Drosophila melanogaster OX=7227 GN=CG7886 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 7.184e-42
Identity = 92/314 (29.30%), Postives = 171/314 (54.46%), Query Frame = 2
Query:  164 NFENYYDNLCALQDTCPIPAVKGHLNEG--IFDINGDRIRQQDWNPIFNSIKINKSLKFISIR---SYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQV-LVNGDGKETEY 1087
            +F   Y  LC  ++  P+P ++   N      ++ GD++   DW  +  ++  +  L+ + +R   +Y Q N++    EK+A++ R R PVI T+ +  +L + + +C+++ +NL+ L+L+G+ L++  +  I + L  N  L+ +S     IGD G  V+C+  K    I   +L+ C L+  G   + D++K Q ++R  E W++SLRYR  + +T+ G+R + L  N  IGD G   + E LK+D W+K ID++ C LT       L  L+ N+ +   ++R N  I + L +S+ +++  +  + +E EY
Sbjct:   40 SFHFRYLELCRAKNLTPVPEIRSKSNATTTFLELCGDKLAVSDWQLLTEALHYDLVLQQLVVRLRRTYPQTNIDPIDTEKRARLFRQR-PVIYTRFIFNSLVQAIANCVSSNKNLSVLKLEGLPLQDGYIETIAKALADNECLESVSFRKSNIGDKGCEVVCNTAKYLNRIEVFDLSECGLTSKGAEHVADMLKMQKITRFTEGWEKSLRYRSVDVNTIGGLRTVLLADNPEIGDVGIRWITEVLKEDAWIKKIDMEGCGLTDIGANLILDCLELNTAITEFNVRNNEGISKFLQRSIHDRLGCLPEEKQEPEY 352          
BLAST of CEP78 vs. UniProt/SwissProt
Match: sp|Q5DU56|NLRC3_MOUSE (Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 1.537e-6
Identity = 75/293 (25.60%), Postives = 126/293 (43.00%), Query Frame = 2
Query:  251 FDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATL--CKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNE---------------------AWKES-----LRYRWANFDTMCGIR----RMTLNRNL--------GIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRN 1009
             D+  + I       + +++KIN++L  +S++S   +  +  +   +A +    I +++ ++    L   + + D L    +L  L      + +     + + L  N  L++L L+S  I D G+ VL  A+     +S+LNL   S+SP G +AL      QA+ R+N                      A  E+     L  +W NF      R     + LNR L         IGDEGA  +A +LK +  + A+ LQ  S+ S   +   + L  N TL +LDLR N
Sbjct:  698 LDLRSNSIGPPGAKALADALKINRTLTSLSLQSNV-IKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALT-----QALCRNNTLKHLDLTANLLHDRGAQAIAVAVGENHSLTHLHLQW-NFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGN 983          
BLAST of CEP78 vs. TrEMBL
Match: H6WA35 (CEP78 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1210.67 bits (3131), Expect = 0.000e+0
Identity = 585/586 (99.83%), Postives = 585/586 (99.83%), Query Frame = 2
Query:  182 DNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMD 1939
            DNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSL TDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMD
Sbjct:    1 DNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLTTDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMD 586          
BLAST of CEP78 vs. TrEMBL
Match: A0A210PZ08 (Centrosomal protein of 78 kDa OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22859 PE=4 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.225e-166
Identity = 267/638 (41.85%), Postives = 403/638 (63.17%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLN-----HVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSAR--NLNNNSSK-GQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ----FSTTQEFLQNISHSQRHKPK 2002
            MIE+VQ RQRGAY+FE +YDNLCA+QD+CP+PAVK HL +G+ D+NGDR+R  DW P+ N+++INK+L+FI+ RSY+Q   E+   EKKA I + ++P +R+KE+T  LCK L++CL  T  L+CLELQG+ LRE D+T + +GL+KN+TL HLSLE CRIGD+GL ++C  +K +  I+++N T CSL+  G  +L  +IK QAM RHNEAW++SLRYR  + D M GIRR+T+N N  +GD+G  +LAE+LKDDLW+KA+DLQ C +++   +  L VLKYN+T+VVLD+RRNP+IDRD++ S+ EQ+++N +G++TEYKW++  D L        +  R      TK LN       +  +     R R+KSAG+V                         AR   LNN+ +K G PWRTAARA RY+G+PP+H+PGK ++   +E +EV+   +    +  +     +E    +    + ++ DD    S +S  IN          S K+L+ E+  ++ QL + +  ++  + K+ E+  ENRRL++    + R++      +   +IL +++ LE+IE +FKQF+ FLD+L+++GLG+++T AG+D     F +  +       S   +PK
Sbjct:    1 MIESVQARQRGAYDFEGHYDNLCAMQDSCPLPAVKAHLGQGVLDLNGDRVRANDWQPVLNTLRINKNLEFIAFRSYYQPPSEDN--EKKAMIEKRKMPAVRSKEITYRLCKALKECLVNTPTLSCLELQGLPLRERDLTTLMKGLVKNTTLNHLSLEYCRIGDTGLEIVCKGIKNSTTINSVNFTGCSLTGRGSESLAKVIKHQAMKRHNEAWRDSLRYRRPDLDRMPGIRRITINNNPMLGDQGTSLLAEALKDDLWLKALDLQGCGISTTGAKALLDVLKYNTTVVVLDVRRNPLIDRDVVHSIMEQLMINCNGQDTEYKWIKADDPLEGGKFKSSKKRR------TKTLNSSFGRKATIRISAGVARRRTKSAGAV-----------------------GVARRLQLNNDGAKSGMPWRTAARANRYRGFPPEHIPGKASL---FENSEVSPNTSPDHSASLLITHDDLEDED-TLRELEKVVLDD----SALSTGIN----------SAKELQIELIQMKRQLQQERLARAKCDKKIIELSIENRRLQDDYDRLRRSH--FGGGAPGGNILDDDSTLESIEGAFKQFHHFLDLLKDAGLGELITMAGLDHKESPFVSASQLPVTKGQSYSQQPK 587          
BLAST of CEP78 vs. TrEMBL
Match: A0A1I8HZX1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 2.180e-156
Identity = 263/622 (42.28%), Postives = 383/622 (61.58%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSAD-----ENYD------RHPRSYYNGPTKPLNHVSRPVFKPAG--RLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFST 1951
            +I++V  RQ+ A +F  YYDNLCALQ + P+P+VK HL EG+ DIN DRIR  DW P+ +++++N+SL+F++ RS +    +        K      P + +KE++  LC  LRDCL+ T+ L CLEL+GI LRE D   +G+G+  NSTLK LSLES +IGD G+  LC A++ AGN++ LNL+   L+   +  LG LI FQA SRHNEAW++SLRYR  NFD+M G+RR+ LN N  I D+GA +LA++LKDDLWVKAIDLQ C + +   +  L VLK N+TLVVLDLRRN +ID+DLL ++TEQV+VNGDGK++E+KW +++ +  SA       ++D      RH     +   +P     RP F+PAG  RLRS+SA    R              + D  R   A   ++    G PWRTA RA RYKGYP +H PGK+++EE  + + +      +   E +  + +I     +    D   + D++ ++VVSPL+   E+ PP P ++K LK E+ + R +L +    +   + +   +  EN  L+  ++   R     A R   +S+LQ+E +LE+IE SF++F+ FLD+LR++GLG++VTAAGMD   +
Sbjct:    4 VIQSVVRRQQAAVDFSGYYDNLCALQSSAPLPSVKAHLAEGVIDINADRIRHADWAPVLSALRLNRSLEFVAFRSQYHHQQQQQQQRASRKQ-----PAVCSKEISYRLCLSLRDCLSGTQALGCLELEGIRLRERDAAALGRGIAANSTLKSLSLESAKIGDVGVEHLCRALRHAGNVAFLNLSGNGLTWRAVDELGRLIGFQATSRHNEAWRDSLRYRRPNFDSMHGLRRIALNNNPLIDDQGAQVLADALKDDLWVKAIDLQGCGIGNAGAKSLLAVLKLNTTLVVLDLRRNHLIDKDLLHALTEQVIVNGDGKDSEFKWQKLEPVESSAQNGASAASFDLQGRRRRHQMPQTSRSVRP----GRPAFRPAGVSRLRSRSAEP--RGGEGYYGGSEAFWPTADGHRGGGA---SSGRRVGIPWRTAQRASRYKGYPSNHTPGKSHLEE--KTSPMATPRTAADLDEPLRPRQQIVDEDDNFVDIDDEQSGDEEDATVVSPLVKEMEEAPPAPSAIKALKIELANQRRRLRRESACRQRADEEARRLRAENSALKRQLEQRIRE----AGRGGGASLLQDEELLESIETSFRRFHKFLDILRDAGLGRVVTAAGMDNLPS 605          
BLAST of CEP78 vs. TrEMBL
Match: A0A267EZG0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017861g1 PE=4 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 2.487e-156
Identity = 263/622 (42.28%), Postives = 383/622 (61.58%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSAD-----ENYD------RHPRSYYNGPTKPLNHVSRPVFKPAG--RLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFST 1951
            +I++V  RQ+ A +F  YYDNLCALQ + P+P+VK HL EG+ DIN DRIR  DW P+ +++++N+SL+F++ RS +    +        K      P + +KE++  LC  LRDCL+ T+ L CLEL+GI LRE D   +G+G+  NSTLK LSLES +IGD G+  LC A++ AGN++ LNL+   L+   +  LG LI FQA SRHNEAW++SLRYR  NFD+M G+RR+ LN N  I D+GA +LA++LKDDLWVKAIDLQ C + +   +  L VLK N+TLVVLDLRRN +ID+DLL ++TEQV+VNGDGK++E+KW +++ +  SA       ++D      RH     +   +P     RP F+PAG  RLRS+SA    R              + D  R   A   ++    G PWRTA RA RYKGYP +H PGK+++EE  + + +      +   E +  + +I     +    D   + D++ ++VVSPL+   E+ PP P ++K LK E+ + R +L +    +   + +   +  EN  L+  ++   R     A R   +S+LQ+E +LE+IE SF++F+ FLD+LR++GLG++VTAAGMD   +
Sbjct:    5 VIQSVVRRQQAAVDFSGYYDNLCALQSSAPLPSVKAHLAEGVIDINADRIRHADWAPVLSALRLNRSLEFVAFRSQYHHQQQQQQQRASRKQ-----PAVCSKEISYRLCLSLRDCLSGTQALGCLELEGIRLRERDAAALGRGIAANSTLKSLSLESAKIGDVGVEHLCRALRHAGNVAFLNLSGNGLTWRAVDELGRLIGFQATSRHNEAWRDSLRYRRPNFDSMHGLRRIALNNNPLIDDQGAQVLADALKDDLWVKAIDLQGCGIGNAGAKSLLAVLKLNTTLVVLDLRRNHLIDKDLLHALTEQVIVNGDGKDSEFKWQKLEPVESSAQNGASAASFDLQGRRRRHQMPQTSRSVRP----GRPAFRPAGVSRLRSRSAEP--RGGEGYYGGSEAFWPTADGHRGGGA---SSGRRVGIPWRTAQRASRYKGYPSNHTPGKSHLEE--KTSPMATPRTAADLDEPLRPRQQIVDEDDNFVDIDDEQSGDEEDATVVSPLVKEMEEAPPAPSAIKALKIELANQRRRLRRESACRQRADEEARRLRAENSALKRQLEQRIRE----AGRGGGASLLQDEELLESIETSFRRFHKFLDILRDAGLGRVVTAAGMDNLPS 606          
BLAST of CEP78 vs. TrEMBL
Match: A0A1I8GE57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017861g3 PE=4 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 3.960e-156
Identity = 263/622 (42.28%), Postives = 383/622 (61.58%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSAD-----ENYD------RHPRSYYNGPTKPLNHVSRPVFKPAG--RLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFST 1951
            +I++V  RQ+ A +F  YYDNLCALQ + P+P+VK HL EG+ DIN DRIR  DW P+ +++++N+SL+F++ RS +    +        K      P + +KE++  LC  LRDCL+ T+ L CLEL+GI LRE D   +G+G+  NSTLK LSLES +IGD G+  LC A++ AGN++ LNL+   L+   +  LG LI FQA SRHNEAW++SLRYR  NFD+M G+RR+ LN N  I D+GA +LA++LKDDLWVKAIDLQ C + +   +  L VLK N+TLVVLDLRRN +ID+DLL ++TEQV+VNGDGK++E+KW +++ +  SA       ++D      RH     +   +P     RP F+PAG  RLRS+SA    R              + D  R   A   ++    G PWRTA RA RYKGYP +H PGK+++EE  + + +      +   E +  + +I     +    D   + D++ ++VVSPL+   E+ PP P ++K LK E+ + R +L +    +   + +   +  EN  L+  ++   R     A R   +S+LQ+E +LE+IE SF++F+ FLD+LR++GLG++VTAAGMD   +
Sbjct:    4 VIQSVVRRQQAAVDFSGYYDNLCALQSSAPLPSVKAHLAEGVIDINADRIRHADWAPVLSALRLNRSLEFVAFRSQYHHQQQQQQQRASRKQ-----PAVCSKEISYRLCLSLRDCLSGTQALGCLELEGIRLRERDAAALGRGIAANSTLKSLSLESAKIGDIGVEHLCRALRHAGNVAFLNLSGNGLTWRAVDELGRLIGFQATSRHNEAWRDSLRYRRPNFDSMHGLRRIALNNNPLIDDQGAQVLADALKDDLWVKAIDLQGCGIGNAGAKSLLAVLKLNTTLVVLDLRRNHLIDKDLLHALTEQVIVNGDGKDSEFKWQKLEPVESSAQNGASAASFDLQGRRRRHQMPQTSRSVRP----GRPAFRPAGVSRLRSRSAEP--RGGEGYYGGSEAFWPTADGHRGGGA---SSGRRVGIPWRTAQRASRYKGYPSNHTPGKSHLEE--KTSPMATPRTAADLDEPLRPRQQIVDEDDNFVDIDDEQSGDEEDATVVSPLVKEMEEAPPAPSAIKALKIELANQRRRLRRESACRQRADEEARRLRAENSALKRQLEQRIRE----AGRGGGASLLQDEELLESIETSFRRFHKFLDILRDAGLGRVVTAAGMDNLPS 605          
BLAST of CEP78 vs. Ensembl Cavefish
Match: cep78 (centrosomal protein 78 [Source:NCBI gene;Acc:103044487])

HSP 1 Score: 358.607 bits (919), Expect = 1.116e-110
Identity = 209/609 (34.32%), Postives = 334/609 (54.84%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLING---TEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQ 1942
            M+ + Q R+RGA +F   YD+ CA Q + P+PAVK  L++G+ D NGD I   DW PI +S+ INK L  ++IRS +   L +     KA   R + P I +K MT  LCK ++ CL  + +L  L+L G+ LRE D+ ++ +GL K+++L+HLSL  C I D GL V+C ++K +  I T++ T+C+++  G   + ++IK QA+ RH  AW ESLRYR A F+ M G+RR+TLN N+ IGD G   +AE L +DLWVKA+DLQ C +++   +   K+L+ NSTL VLD+RRNP++D+ L+K+V ++VL+N  G++ +Y WL+            D H            NH  + + +  GR  S  AGS  RR++ +               T   R     S+   PWRTAARA   +G P  H  G    ++ ++     ++                   ++ +  +      DD   SV +    G   + Q+  +    K L+ E+   + +L + +        +L E+  EN RLR+        N  ++E     S+L++E +L++IE+SF++F++FLD+L+++GLG++ + AG++Q
Sbjct:    1 MLGSAQSRRRGAQDFAACYDSACAAQGSAPVPAVKSSLSQGVLDFNGDVISLSDWTPILSSLVINKHLHTVTIRSSYLSTLGSQASSSKATS-RKKTPEIHSKSMTLQLCKAVQRCLCASPSLKTLQLHGLPLREKDLNILTKGLSKSASLEHLSLARCPIADDGLEVICQSVKYSSTIRTVDFTSCNITWQGAAHMANIIKHQAVRRHGTAWAESLRYRKAEFEAMSGLRRITLNDNILIGDRGVAAIAEELAEDLWVKAVDLQRCGISNEGAKVLEKMLQSNSTLCVLDIRRNPLVDKGLVKAVIKKVLMNTKGQDAQYLWLK--------PPAKDAH------------NHSGQMIRRNTGRA-SFRAGS--RRTSSV---------------TYGWRQPRPGSTGYIPWRTAARATLQRGVP--H--GAITADQSFQNASTIRV-------------------TLESESESESEERDDVLPSVCAQSPQGNITSRQFRHLQAEFKRLEVELQECKLRLAEERNTILKANSRLVELELENSRLRSL-------NQSLSEAHISHSVLEDEHVLDSIESSFQKFHAFLDLLKDAGLGQLASMAGIEQ 540          
BLAST of CEP78 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 53.1434 bits (126), Expect = 1.312e-6
Identity = 64/262 (24.43%), Postives = 121/262 (46.18%), Query Frame = 2
Query:  248 IFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV----IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRH-----NEAWKESLRYRWANFDTMCGIRRMTLNRN-LGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLR 1003
            I D++G+ I  +    +  ++++N+ +  I+++S    ++E+      A++L+S   +    ++   +     K + + L   + L  L +   HL +     + Q L+ N TL  LSL+S  + D G+  L  A++    ++TLNL   S+   G +A+   ++  +  R      N    E +     +      +R + L  N + IG   A  LA+SL  +  ++ +DLQE +L    V      LK NS+L VL L+
Sbjct:  515 ILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSN---SIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKA--LAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQ 771          
BLAST of CEP78 vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 53.1434 bits (126), Expect = 1.635e-6
Identity = 59/265 (22.26%), Postives = 115/265 (43.40%), Query Frame = 2
Query:  272 IRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATL-----------CKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLL 1033
            I  +   P+  ++ +N++L  + +         N +  K AK L      +R  ++  ++            + L + L +   L  L +Q   +    V  I + L KN  L+ L++ S  +GD G + L  A+ +   + TL+L + S+S  G++AL   +      R N                  G+  + L  N  IG EGA  +A +L+++  ++ +DLQ   +   + +   + L  NS++ +LDL+ N + D  ++
Sbjct:  495 ISSKGIKPLSRALLVNRTLTILDLHG-------NNIGTKGAKTLAE---ALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLAL------RSNR-----------------GLTTLNLREN-SIGVEGAKAIARALQENSTLRELDLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVV 725          

HSP 2 Score: 52.7582 bits (125), Expect = 1.677e-6
Identity = 64/256 (25.00%), Postives = 118/256 (46.09%), Query Frame = 2
Query:  248 IFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPV----IRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLR 1003
            I D++G+ I  +    +  ++++N+ +  I+++S    ++E+      A++L+S   +    ++   +     K + + L   + L  L +   HL +     + Q L+ N TL  LSL+S  + D G+  L  A++    ++TLNL   S+   G +A+   ++       N   +E L  +W NF              + IG   A  LA+SL  +  ++ +DLQE +L    V      LK NS+L VL L+
Sbjct:  515 ILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSN---SIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQ------ENSTLRE-LDLQW-NF--------------MKIGAAKA--LAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQ 743          
BLAST of CEP78 vs. Ensembl Nematostella
Match: EDO48167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJY4])

HSP 1 Score: 186.422 bits (472), Expect = 2.517e-54
Identity = 88/178 (49.44%), Postives = 130/178 (73.03%), Query Frame = 2
Query:  533 DVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNG 1066
            D TL  QG+ KNST++HLSLE C+IGD GL +L +A+K + +I+++N T C+L+  G   +  +I+FQA  RH+ AW++SLRYR  + D M G+RR++L +N  + D G   LAE+LKDDLWVKA+DLQ+C +++     F  VLK+N+T+ VLDLR NP+IDRD+L ++ EQ+++N 
Sbjct:    7 DKTLPFQGITKNSTIQHLSLEFCQIGDHGLEILSNAIKGSQSITSINFTGCNLTWRGAEEIAKIIRFQATRRHSVAWQDSLRYRRPDMDRMTGLRRISLCKNPLVSDRGMSYLAEALKDDLWVKALDLQQCGVSTEGAMEFQPVLKFNTTITVLDLRLNPLIDRDVLTAIMEQIMMNA 184          
BLAST of CEP78 vs. Ensembl Nematostella
Match: EDO43196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ93])

HSP 1 Score: 60.8474 bits (146), Expect = 1.298e-9
Identity = 54/190 (28.42%), Postives = 84/190 (44.21%), Query Frame = 2
Query:  470 CLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRH-----NEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDR 1024
             L T   L  L+L+G  + +     I + LM NSTLK L LE  +IGD G I +  A+     +  L+L    +   G  A+   +   +  +      N+   E          T   ++++ L  N  IGDEGA+ +A++L  +  +K +DL+   +         K L  NSTL  LDL  N + D 
Sbjct:  169 ALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGN-KIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDE 357          

HSP 2 Score: 59.3066 bits (142), Expect = 3.922e-9
Identity = 53/190 (27.89%), Postives = 84/190 (44.21%), Query Frame = 2
Query:  470 CLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRH-----NEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDR 1024
             L T   L  L+L+G  + +     I + LM NSTL+ L LE  +IGD G I +  A+     +  L+L    +   G  A+   +   +  +      N+   E          T   ++++ L  N  IGDEGA+ +A++L  +  +K +DL+   +         K L  NSTL  LDL  N + D 
Sbjct:  113 ALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGN-KIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDE 301          

HSP 3 Score: 54.299 bits (129), Expect = 1.533e-7
Identity = 52/187 (27.81%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  470 CLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRA--LGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDR 1024
             L T   L  L+L+G  + +     I + LM NSTL+ L LE  +IGD G I +  A+          +T  +L  + L    +GD          +E      +    N      + ++ L  N  IGDEGA+ +A++L  +  ++ +DL+   +         K L  NSTL  LDL  N + D 
Sbjct:   27 ALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKAL----------MTNSTLEKLDLEGNKIGD---------EDEGAIAIAKALMTN----STLEKLDLEGN-KIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDE 189          

HSP 4 Score: 50.8322 bits (120), Expect = 1.970e-6
Identity = 47/175 (26.86%), Postives = 76/175 (43.43%), Query Frame = 2
Query:  470 CLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRH-----NEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNS 979
             L T   L  L+L+G  + +     I + LM NSTLK L LE  +IGD G I +  A+     +  L+L    +   G  A+   +   +  +      N+   E          T   ++++ L  N  IGDEGA+ +A++L  +  +K +DL+   +         K L  NS
Sbjct:  225 ALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGN-KIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNS 398          
BLAST of CEP78 vs. Ensembl Nematostella
Match: EDO35563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL71])

HSP 1 Score: 50.0618 bits (118), Expect = 4.802e-7
Identity = 28/91 (30.77%), Postives = 42/91 (46.15%), Query Frame = 2
Query:  461 LRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKF 733
            + + L T   L  L+L   ++       I   LM NSTLK L L    IGD G I + +A+     +  LN   C +  +G  AL D++ +
Sbjct:   69 IANALKTNSTLKILDLTKNNIGNEGAKAIANALMTNSTLKKLHLCENNIGDEGAIAIANALMTNSTLKKLNFNTCGIRAVGAAALADMLYY 159          
BLAST of CEP78 vs. Ensembl Nematostella
Match: EDO35561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL68])

HSP 1 Score: 48.9062 bits (115), Expect = 5.096e-6
Identity = 28/92 (30.43%), Postives = 46/92 (50.00%), Query Frame = 2
Query:  458 VLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKF 733
             + + L T   L  L+L+G ++ +     I + LM NSTLK L L    IGD G I + +A+     +  L+L    +  +G  AL D++ +
Sbjct:  197 AIANALMTNSTLKKLDLEGNYIGDEGAKAIAEALMTNSTLKELHLYESNIGDEGAIAIANALMTNSTLKKLHLHTYGIRAVGAAALADMLYY 288          

HSP 2 Score: 48.521 bits (114), Expect = 6.961e-6
Identity = 53/201 (26.37%), Postives = 83/201 (41.29%), Query Frame = 2
Query:  458 VLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALG------------DLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDR 1024
             + + L T   L  L+L   ++       I + LM NSTLK   L    IGD G I + +A+     +  L L    +  +G+ AL             DL   Q  S+   A  E L       + +    R+ L +   IGDEGA+ +A +L  +  +K +DL+   +     +   + L  NSTL  L L  + + D 
Sbjct:   57 AIANALKTNSTLKILDLTKNNIGNEGAKAIAEALMTNSTLKEFDLCDTNIGDEGAIAIANALMTNSTLKKLYLHDYGIRAVGIAALARTQLHKPSLIGLDLSSNQISSKGAIAIAEMLSK-----NQLLETFRLCLYQ---IGDEGAIAIANALMTNSTLKKLDLEGNYIGDEGAKAIAEALMTNSTLKELHLYESNIGDE 249          
BLAST of CEP78 vs. Ensembl Medaka
Match: ENSORLT00000004198.2 (centrosomal protein 78 [Source:NCBI gene;Acc:101159198])

HSP 1 Score: 338.576 bits (867), Expect = 1.503e-102
Identity = 223/609 (36.62%), Postives = 334/609 (54.84%), Query Frame = 2
Query:  137 VQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENG---LPEKKAK-ILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKP--LNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISR--TNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMD 1939
             Q RQ+GA +F  YYD  CA Q+T P+PAVK +L++G+ + N DR++  DW PI  +I INK L  I+I S +Q +  +G   L  ++ K   + +IP IR+KEMT  LCK L DCL  + NL  L+L G+ LRE D+  + +GL K+++LK+LSL +C I D GL V+C ++K +  I T++ T CSL+  G   L ++IK+Q M RH  AW ESLRYR    + M G+RR+TLN N  IGD GA  LA  L +DLW+KA+DLQ C L++   R  L+ LK NS L VLD+R NP++D+ L+K+V E+V +N DG+  EY W++      +A E+      S  +   +      V+     P GR   +S                  +T + NSR+ S            PWR AARA R +G PP    G    +  ++     KI   +   E   + +  EQ  V+         + DQ +S      N   Q+       + L+ E+   R +L + ++ +   E +L E   E+ RLR+  + ++   T A  A      S  ++EA+L++IENSF +F++FLD+L+++GLG+I + AG+D
Sbjct:    6 AQIRQQGAQDFMAYYDFACAKQETFPVPAVKVNLDKGMLNFNADRLKLSDWPPILQAISINKHLHHIAISSTYQASNTSGDTVLKRRQHKSTFKRKIPAIRSKEMTFKLCKALGDCLTVSSNLKTLQLHGLLLRERDLIALTKGLAKSASLKNLSLANCPISDEGLEVICQSVKYSTTIKTIDFTGCSLTWRGAEHLANIIKYQGMQRHGTAWAESLRYRHPQLEGMSGLRRITLNCNTLIGDRGAAALARELAEDLWIKALDLQRCGLSNEGARRLLEALKTNSFLCVLDIRSNPLVDKALMKTVIEKVEMNADGQPLEYHWIKP-----AATESQRVSSLSKLHSVREKTLFKKVTAKGTSPGGRCSGES------------------RTRIKNSRSCSI-----------PWRAAARAGRQRGLPP----GVTVTDHSFQAAATVKITVEADSEE---EGNDDEQEEVAA--------EPDQRTSFYFRDRNTERQF-------ERLQMELKEYRLRLAEERRARLKAESRLLEFELESARLRDANRSLTEALTAARSASAPSAFSAFEDEAVLQSIENSFTKFHAFLDLLKDAGLGQIASMAGID 558          
BLAST of CEP78 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 56.6102 bits (135), Expect = 1.454e-7
Identity = 55/191 (28.80%), Postives = 90/191 (47.12%), Query Frame = 2
Query:  458 VLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKF-QAMSRHNEAW---KESLRYRWAN-FDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPM 1015
             L + L   + L  L+LQ   +    +T + + L  N  L  L+L    IG  G   +  A+K   ++  L+LTA  L   G++A+   IKF Q ++  +  W   K +     AN   +   I+ + L  N  IG+EG + LAE+LK +  ++ + LQ  S  ++      + L  N +L  LDLR N +
Sbjct:  865 ALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQEN-AIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSI 1054          

HSP 2 Score: 53.5286 bits (127), Expect = 1.332e-6
Identity = 43/162 (26.54%), Postives = 84/162 (51.85%), Query Frame = 2
Query:  545 IGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLI----KFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPM 1015
            + + L+ N TL +L+L +  IG  G   L  A+KM   ++++N    S+   G +AL +++    K  +++ R N+   +  +           + ++ L  N  +GD+G + LAE+LK +  + ++ LQ  S+++  +    K L++N  LV L+LR N +
Sbjct:  754 LSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSN-QLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSI 914          
BLAST of CEP78 vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 56.6102 bits (135), Expect = 1.454e-7
Identity = 55/191 (28.80%), Postives = 90/191 (47.12%), Query Frame = 2
Query:  458 VLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKF-QAMSRHNEAW---KESLRYRWAN-FDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPM 1015
             L + L   + L  L+LQ   +    +T + + L  N  L  L+L    IG  G   +  A+K   ++  L+LTA  L   G++A+   IKF Q ++  +  W   K +     AN   +   I+ + L  N  IG+EG + LAE+LK +  ++ + LQ  S  ++      + L  N +L  LDLR N +
Sbjct:  865 ALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQEN-AIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSI 1054          

HSP 2 Score: 53.5286 bits (127), Expect = 1.332e-6
Identity = 43/162 (26.54%), Postives = 84/162 (51.85%), Query Frame = 2
Query:  545 IGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLI----KFQAMS-RHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPM 1015
            + + L+ N TL +L+L +  IG  G   L  A+KM   ++++N    S+   G +AL +++    K  +++ R N+   +  +           + ++ L  N  +GD+G + LAE+LK +  + ++ LQ  S+++  +    K L++N  LV L+LR N +
Sbjct:  754 LSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSN-QLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSI 914          
BLAST of CEP78 vs. Planmine SMEST
Match: SMESG000064712.1 (SMESG000064712.1)

HSP 1 Score: 1743.01 bits (4513), Expect = 0.000e+0
Identity = 860/863 (99.65%), Postives = 862/863 (99.88%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKDEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMPNSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIEXXXXXXXXXXXXXXXXQLSFDTVQDISFDHSNLDMF 2713
            MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSL TDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNK+EILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMP+SPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF
Sbjct:    1 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLTTDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKNEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMPSSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF 863          
BLAST of CEP78 vs. Planmine SMEST
Match: SMESG000064712.1 (SMESG000064712.1)

HSP 1 Score: 1736.85 bits (4497), Expect = 0.000e+0
Identity = 859/863 (99.54%), Postives = 861/863 (99.77%), Query Frame = 2
Query:  125 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKDEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMPNSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIEXXXXXXXXXXXXXXXXQLSFDTVQDISFDHSNLDMF 2713
            MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSL TDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNK+EILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKN DNDAMNDPAEMP+SPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF
Sbjct:    1 MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRIRQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVIRTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLTTDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKNEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKN-DNDAMNDPAEMPSSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF 862          
BLAST of CEP78 vs. Planmine SMEST
Match: SMESG000064712.1 (SMESG000064712.1)

HSP 1 Score: 1313.52 bits (3398), Expect = 0.000e+0
Identity = 655/658 (99.54%), Postives = 657/658 (99.85%), Query Frame = 2
Query:  740 MSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKDEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMPNSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIEXXXXXXXXXXXXXXXXQLSFDTVQDISFDHSNLDMF 2713
            MSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSL TDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNK+EILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMP+SPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF
Sbjct:    1 MSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTKPLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSARNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIENYSKKSERIPQKHKIEQRSVSTNRKDSLTTDDDQTSSVVSPLINGTEQYPPMPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKIISRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVTAAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIVEKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHEQANTDGKHYNKNEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNELEKNSDNDAMNDPAEMPSSPVKANNELSNDEQWNNEYFENFTSSTSSIATYSKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTVQDISFDHSNLDMF 658          
BLAST of CEP78 vs. Planmine SMEST
Match: SMESG000010694.1 (SMESG000010694.1)

HSP 1 Score: 56.6102 bits (135), Expect = 7.400e-8
Identity = 50/185 (27.03%), Postives = 80/185 (43.24%), Query Frame = 2
Query:  485 ENLACLE---LQGIHLRESDVTLIGQGLMKNSTLKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDLIKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILAESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDRDL 1030
            E+  C +   +   +L   D   + QGL  +S LK L + +  I D GL  + S  +M  +I TLNLT CSL+PIG+    D++       H                    +  ++ N    + +   LIL +       +  I+LQ  S      +   + LK N +L  LD+ RN +++RDL
Sbjct:  297 EDFQCCQEIIISSCNLNAEDTYNLIQGLKSSSVLKVLDVSTNPISDQGLKHIQSLFQMKNSIETLNLTCCSLTPIGVEEFLDVLIQNTFKFH------------------LQLLNLSHNELDNMTENSVLILTK-------LPLINLQLQSTNFKYQKSLYESLKLNYSLKRLDMSRNKLLNRDL 456          
The following BLAST results are available for this feature:
BLAST of CEP78 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP781.410e-11335.65centrosomal protein 78 [Source:HGNC Symbol;Acc:HGN... [more]
CEP781.410e-11335.65centrosomal protein 78 [Source:HGNC Symbol;Acc:HGN... [more]
CEP781.995e-11335.65centrosomal protein 78 [Source:HGNC Symbol;Acc:HGN... [more]
CEP784.164e-11335.81centrosomal protein 78 [Source:HGNC Symbol;Acc:HGN... [more]
CEP787.093e-11335.81centrosomal protein 78 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of CEP78 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F28C1.32.980e-724.41Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.33.240e-724.41Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.37.581e-724.90Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.31.037e-624.90Protein phosphatase 1 regulatory subunit 37 homolo... [more]
back to top
BLAST of CEP78 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG78867.167e-4329.30gene:FBgn0038248 transcript:FBtr0082976[more]
back to top
BLAST of CEP78 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep782.093e-10233.61centrosomal protein 78 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cep785.663e-10233.61centrosomal protein 78 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
nlrc34.533e-620.36NLR family, CARD domain containing 3 [Source:ZFIN;... [more]
back to top
BLAST of CEP78 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep782.476e-9645.82centrosomal protein 78kDa [Source:NCBI gene;Acc:10... [more]
cep781.166e-8033.15centrosomal protein 78kDa [Source:NCBI gene;Acc:10... [more]
cep782.713e-6745.15centrosomal protein 78kDa [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of CEP78 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep787.234e-11035.56centrosomal protein 78 [Source:MGI Symbol;Acc:MGI:... [more]
Cep781.273e-10835.56centrosomal protein 78 [Source:MGI Symbol;Acc:MGI:... [more]
Nlrp26.268e-1025.77NLR family, pyrin domain containing 2 [Source:MGI ... [more]
Nlrc31.125e-725.60NLR family, CARD domain containing 3 [Source:MGI S... [more]
Nlrc31.985e-725.60NLR family, CARD domain containing 3 [Source:MGI S... [more]
back to top
BLAST of CEP78 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5JTW2|CEP78_HUMAN6.134e-11235.65Centrosomal protein of 78 kDa OS=Homo sapiens OX=9... [more]
sp|Q6IRU7|CEP78_MOUSE8.902e-10835.56Centrosomal protein of 78 kDa OS=Mus musculus OX=1... [more]
sp|A2RRS8|CEP78_XENTR1.409e-9545.82Centrosomal protein of 78 kDa OS=Xenopus tropicali... [more]
sp|Q9VFH6|CEP78_DROME7.184e-4229.30Protein Cep78 homolog OS=Drosophila melanogaster O... [more]
sp|Q5DU56|NLRC3_MOUSE1.537e-625.60Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE... [more]
back to top
BLAST of CEP78 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA350.000e+099.83CEP78 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A210PZ081.225e-16641.85Centrosomal protein of 78 kDa OS=Mizuhopecten yess... [more]
A0A1I8HZX12.180e-15642.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EZG02.487e-15642.28Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GE573.960e-15642.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of CEP78 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep781.116e-11034.32centrosomal protein 78 [Source:NCBI gene;Acc:10304... [more]
nlrc31.312e-624.43NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc31.635e-622.26NLR family CARD domain containing 3 [Source:NCBI g... [more]
back to top
BLAST of CEP78 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP78 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP78 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO481672.517e-5449.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431961.298e-928.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355634.802e-730.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355615.096e-630.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CEP78 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000004198.21.503e-10236.62centrosomal protein 78 [Source:NCBI gene;Acc:10115... [more]
nlrc31.454e-728.80NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc31.454e-728.80NLR family CARD domain containing 3 [Source:NCBI g... [more]
back to top
BLAST of CEP78 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000064712.10.000e+099.65SMESG000064712.1[more]
SMESG000064712.10.000e+099.54SMESG000064712.1[more]
SMESG000064712.10.000e+099.54SMESG000064712.1[more]
SMESG000010694.17.400e-827.03SMESG000010694.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018550
GenBankAFB74717.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018550 ID=SMED30018550|Name=CEP78|organism=Schmidtea mediterranea sexual|type=transcript|length=2885bp
ATTTAAACAACTATTTGTAGTATTTCAAAAGTTTAGTGACATTAGCAACA
GGATTTTTTTTCAAATTTTACTACTGTTAATATTCTAATATTATTTTTTG
AACCACCTTTGGAAGATTTAAAGGATGATTGAAACTGTTCAAGAAAGACA
AAGAGGAGCATATAATTTTGAAAATTATTATGATAATTTATGTGCTCTTC
AAGACACATGTCCTATACCAGCAGTTAAGGGACACTTGAACGAAGGGATT
TTTGATATTAACGGAGATAGAATTCGACAGCAAGATTGGAATCCTATTTT
CAATAGTATTAAAATTAATAAAAGTTTAAAATTCATATCAATAAGAAGCT
ATTTTCAACTGAACTTGGAAAATGGATTACCAGAGAAAAAAGCCAAAATA
TTAAGATCCAGAATTCCTGTAATTAGAACGAAAGAAATGACTGCAACTTT
ATGTAAAGTTCTTCGAGATTGTTTAGCGACAACGGAAAATTTAGCATGTC
TTGAGTTACAAGGAATTCACTTACGAGAGTCAGATGTTACTCTAATAGGA
CAGGGACTGATGAAAAACTCAACACTGAAACACTTATCTTTAGAATCCTG
TAGAATAGGAGATTCCGGATTAATCGTTTTGTGTTCTGCAATGAAAATGG
CCGGGAATATTAGTACATTGAATTTAACAGCATGCAGCTTGAGTCCGATA
GGACTGCGAGCTTTAGGGGATTTGATCAAGTTCCAAGCGATGAGTCGACA
CAATGAAGCATGGAAGGAATCATTGAGATATAGATGGGCTAATTTCGATA
CAATGTGTGGAATCAGACGAATGACTTTAAATCGAAACCTAGGAATCGGA
GATGAAGGTGCTTTAATACTGGCGGAATCTCTTAAAGATGATTTGTGGGT
TAAAGCAATTGATTTACAAGAGTGCAGTTTAACAAGTAATTCTGTGCGTG
GTTTTCTCAAAGTTTTAAAATATAACTCAACACTTGTTGTTTTGGATTTA
AGAAGAAACCCCATGATTGATAGAGATTTATTGAAATCTGTGACAGAGCA
AGTTCTCGTTAATGGAGATGGAAAAGAAACTGAGTACAAATGGTTGCGAG
TTAAAGATCTACTGAGAAGTGCAGATGAAAATTATGATAGGCATCCAAGA
TCCTATTATAATGGTCCTACGAAACCCCTTAATCACGTTTCTAGACCAGT
ATTTAAGCCTGCTGGTAGGTTGAGAAGTAAAAGTGCCGGTTCCGTTGATC
GACGTTCCAATGACATTTTACATGAAGAAAATCATAATAAAACATCAATG
GATAATTCTAGAACCAACAGTGCACGAAATCTTAATAACAATTCATCCAA
AGGACAACCTTGGAGAACCGCAGCAAGAGCTATAAGATATAAAGGATATC
CACCCGATCATGTTCCTGGAAAAAATAATATAGAAGAACATTATGAAGAA
AATGAAGTTAACAAAATTGAAAATTACAGTAAAAAGTCAGAAAGAATACC
TCAAAAACATAAAATAGAACAGAGATCAGTGTCAACAAACAGAAAAGATT
CATTAATAACTGATGACGACCAAACAAGCTCTGTCGTATCTCCATTAATA
AATGGAACTGAACAATATCCACCGATGCCAAAATCTGTCAAAGATTTAAA
AACAGAAATTTTTCATTTACGAGAACAGCTAGACAAATATCAAAAAGACA
AATCCGATATTGAACTGAAACTAGATGAAATATATACAGAAAATAGGCGA
TTAAGAAATACAATAAAAATAATTTCCAGAACTAATGCTGTGATTGCAGA
AAGATCAGAGAAATCATCCATTTTACAAAATGAAGCTATTTTAGAAACGA
TAGAGAATTCATTCAAACAATTTAATTCATTTTTAGATATGCTTCGAGAA
TCCGGTTTGGGAAAAATTGTCACTGCTGCTGGAATGGATCAATTTTCAAC
AACTCAAGAATTTTTGCAGAATATTTCTCATTCGCAACGTCATAAACCGA
AACGTCCAGTGACAGCTGACTTTGATAATAGAAAAGTTTTCAATAATGAA
ATTATTTGCGATTCAACAATTGTTGAAAAAGATCAAAAGAAAATTGCAAC
GATAGATGAAAATGTCAAAATTGACGGTCTTTTGGTACAAAGTAGTAGTA
AATCAAATTCGGAGGAAATTCGACAATCTGTACGCAATTCCTTGTCCCAA
GATTTATGTTCACAGTCTCATGAGCAGGCAAATACAGATGGCAAACATTA
TAATAAAGATGAAATATTGGAATCGGTTGGATGGAAAAATTATCCAAATA
AACTAGTTCATAATTCGAATGAATACTTAATTCCACAGTCAACAGGTGCA
TCGGGAGATAATTTCAATGAGTTAGAAAAAAACAGTGATAATGACGCAAT
GAACGATCCCGCTGAAATGCCGAACAGTCCAGTGAAGGCAAATAACGAGT
TATCTAACGATGAGCAGTGGAATAATGAATATTTTGAAAATTTCACAAGT
TCCACCTCGAGCATTGCAACATATTCCAAACGAACAAGAGCTACAAACGA
AGCACCACCAAATTATGGCGTCGAAGATTCCACAATCGTTACGGAGAGTA
TTGAGAATGGAATGGACAATGAGATGAACATGAATAATAACCCTTTCACC
AATCAATTGAGCTTCGATACTGTCCAAGATATCAGTTTTGATCACAGCAA
TCTCGACATGTTTTAGTACATCTTTAAGAATCTATTTATACGCGCCCTTT
CACCATTGCAAATGAGTTTTATCTATTATCTATCAAATTAATTATCTATG
ATTGCATTTGGATGATAATGATTGGTTATCATTTTTTAAATCAAATTAAT
TGCAATTTGAATTCAACCAAGCCTCGAGATCGGAA
back to top

protein sequence of SMED30018550-orf-1

>SMED30018550-orf-1 ID=SMED30018550-orf-1|Name=SMED30018550-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=864bp
MIETVQERQRGAYNFENYYDNLCALQDTCPIPAVKGHLNEGIFDINGDRI
RQQDWNPIFNSIKINKSLKFISIRSYFQLNLENGLPEKKAKILRSRIPVI
RTKEMTATLCKVLRDCLATTENLACLELQGIHLRESDVTLIGQGLMKNST
LKHLSLESCRIGDSGLIVLCSAMKMAGNISTLNLTACSLSPIGLRALGDL
IKFQAMSRHNEAWKESLRYRWANFDTMCGIRRMTLNRNLGIGDEGALILA
ESLKDDLWVKAIDLQECSLTSNSVRGFLKVLKYNSTLVVLDLRRNPMIDR
DLLKSVTEQVLVNGDGKETEYKWLRVKDLLRSADENYDRHPRSYYNGPTK
PLNHVSRPVFKPAGRLRSKSAGSVDRRSNDILHEENHNKTSMDNSRTNSA
RNLNNNSSKGQPWRTAARAIRYKGYPPDHVPGKNNIEEHYEENEVNKIEN
YSKKSERIPQKHKIEQRSVSTNRKDSLITDDDQTSSVVSPLINGTEQYPP
MPKSVKDLKTEIFHLREQLDKYQKDKSDIELKLDEIYTENRRLRNTIKII
SRTNAVIAERSEKSSILQNEAILETIENSFKQFNSFLDMLRESGLGKIVT
AAGMDQFSTTQEFLQNISHSQRHKPKRPVTADFDNRKVFNNEIICDSTIV
EKDQKKIATIDENVKIDGLLVQSSSKSNSEEIRQSVRNSLSQDLCSQSHE
QANTDGKHYNKDEILESVGWKNYPNKLVHNSNEYLIPQSTGASGDNFNEL
EKNSDNDAMNDPAEMPNSPVKANNELSNDEQWNNEYFENFTSSTSSIATY
SKRTRATNEAPPNYGVEDSTIVTESIENGMDNEMNMNNNPFTNQLSFDTV
QDISFDHSNLDMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026212Cep78
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 505..539
NoneNo IPR availableSMARTSM00368LRR_RI_2coord: 176..203
e-value: 64.0
score: 4.4
coord: 148..175
e-value: 0.0097
score: 25.1
coord: 227..255
e-value: 1.7
score: 15.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 447..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 340..414
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 447..485
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 370..391
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 676..703
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 676..708
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 392..413
NoneNo IPR availablePANTHERPTHR24110CENTROSOMAL PROTEIN OF 78 KDAcoord: 1..746
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 42..314
IPR026212Centrosomal protein of 78kDaPRINTSPR02062CENTROSOME78coord: 189..204
score: 32.95
coord: 166..187
score: 29.34
coord: 251..270
score: 54.32
coord: 213..231
score: 49.28
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 221..323
e-value: 7.7E-11
score: 43.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 15..219
e-value: 3.8E-21
score: 77.0
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 147..170
e-value: 1.7E-4
score: 21.4