Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30018527
Length (bp)3664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30018527) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30018527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30018527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30018527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018527SMESG000010241.1 SmedASXL_015882SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018527SMESG000010241.1 Contig48972uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018527SMESG000010241.1 Contig48972newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30018527SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 303/516 (58.72%), Postives = 389/516 (75.39%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            Q+F KTA YKGN+VA+K + +++RI++ R++L ++K ++D+ N+H+ RF+GAC +     ++ +YCP+GSL+D+L  E ITLDW+F+YSL  DI +GM++LHN  G I   G LKSSNC+VD RFVLKITD+GL S R     L  E  +  +   LWTAPELLRM++PP+ G+  GDVYSF I+ QEI  R GVF ++  D  S +EI+E V     P PFRPSL A+    E+  LL+++ W EDP  RP F  I+  +RKFN+E +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LHA E+ARMA+A L A+  F I HRP ++L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S  T  +L+ FG F +  RG +E+KGKG  +TYWL GE 
Sbjct:  551 QVFAKTAYYKGNLVAVKRV-NRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHN--GAICSHGNLKSSNCVVDGRFVLKITDYGLESFRD----LDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLD-LSPKEIIERVTRGEQP-PFRPSL-ALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGER 1055          

HSP 2 Score: 220.705 bits (561), Expect = 3.641e-58
Identity = 146/508 (28.74%), Postives = 242/508 (47.64%), Query Frame = 3
Query:  270 LMLPKNFSMFPWPLTI--PAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYC----HALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSS------GNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNL 1748
            ++LP   + +PW      PA+++AL +VK+ P + P   +   L + E    +C +T   L   V       P V  GP C Y  AP+ R  A W +P+L+ GA   GF    K E+   TR G  +  L  G  +    ++  W     + +  AY      +C      L   +     ITVD+    ++ E   +  T        L+  +  K  V  +C  P +   ++L A +      +YVF ++ +F        G   + PW        ++  A++A+++   +T K P+N ++  F  Q+K +A  ++N+  E  L+NT  ++F+DG+LLY  A+ +TLA GG +++G  I + MWN +F+G+ G + IDSSGDR  DFS+ DMDP+ G F+ V ++ GT    + V    ++W       P   P+CG+DN        +L+   + A V     L      +F+YR ++L+ EL +  W + WE +E S   R+L
Sbjct:   39 VVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLA-AVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAGAPALGFGV--KDEYALTTRAGPSYAKL--GDFVAALHRRLGWERQALMLY--AYRPGDEEHCFFLVEGLFMRVRDRLNITVDHL---EFAEDDLSHYTR-------LLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPW---ERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHL 524          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 293/515 (56.89%), Postives = 379/515 (73.59%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSF I+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T   L   G F +  RG +E+KGKG  +TYWL GE +
Sbjct:  535 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERK 1041          

HSP 2 Score: 185.267 bits (469), Expect = 5.934e-47
Identity = 140/502 (27.89%), Postives = 230/502 (45.82%), Query Frame = 3
Query:  261 LAMLMLPKNFS-MFPWPLTIPAIKIALEKV-KSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY-LTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKR-AYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPK-PDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            LA+++   N S  + WP   PA+ +A+E + +++P     V S      ++  C E   A    V   +   PD+L GP C Y  A +AR  + W +P+L+ GAV  GF   +   ++TL R G     L  G+ +      + WT    + +  A T+  P Y    G +   Q   ++V +           A            I A G    +  +C     +H ILL+A + N  NG+YVF  + +F           T  PW    +   E ++A R A++++L +T + P N +++ F +++   A  ++       L+N     FYDG+LLYA  LN+T+ +GG   +G  I++ M    + G+ G V +D + DR  DF +  M D  +G+F+P AH+ G +          + W  V    PS  P C +  D+  C K P   L I A+  G+   +F +S    + ++R + L+ EL +M W I WE L+
Sbjct:   27 LAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSS-----ELEGACSEY-LAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGF-SAKNDHYRTLVRTGPSAPKL--GEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH--------QVYAREPGGPEQATHFIRANGR---IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPW--QDNRTREQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWT-GRPIPW--VKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVS---SFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 432.565 bits (1111), Expect = 1.257e-131
Identity = 230/485 (47.42%), Postives = 317/485 (65.36%), Query Frame = 3
Query: 2127 VKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTE-RGHIEVKGKGSTQTYWLHGENELIVDPIP 3578
            +KDL +++I   +G   + G   +V ++C +GSLED+L  + + LDW+FK SL+ D+ +GM YLH+     G LKS NC+VD RFVLK+TD+G   +    + L   +     + LLWTAPELLR       G+F GDVYSFAI+ QE++ R   F +    D  AQEI+  +K           +        + + L+KQ W E    RP F+ I    + FNK G   NI+D++L  +EQY++NLED+++ERTE+   EK+K E LL  MLP SVA  L K   V  E +DLVT++FSDIVGFT +SA S P++++DLLN LYT FD+II ++DVYKVETIGDAYMV SGLP+ NG+ HA EIA M++  LS++  F + H P+  +++RIG+HSGPV +GVVGL MPRYCLFGDTVNT+SRMES GLP++IH+S ST+ +L+        E RG  E+KGKG+ +T+WL G+   +  P+P
Sbjct:  598 MKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDIL---EMLRLSEEESSMEELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMM---DLPAQEIINRLKKPPPVYR---PVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNK-GKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFM-KPLP 1071          

HSP 2 Score: 55.0694 bits (131), Expect = 1.081e-6
Identity = 42/187 (22.46%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  885 GNKYAVAVLCVDPASV-----HRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEF 1430
             ++  + ++C+  A +       +L  A  L   +G YVF+           K+  Y    N   N + + AY ++L++T++  E   ++ F++     A  E     E D ++      Y+ +   A A+N  + + G     SL+ ++  N  F G    +  DS+G+ I+++ ILD + K  E 
Sbjct:  239 ADRIRIIIMCMHSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRN---NPKLREAYDAVLTITVESQEKTFYQAFTEAA---ARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLV-QHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWEL 418          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 429.483 bits (1103), Expect = 1.603e-130
Identity = 239/529 (45.18%), Postives = 339/529 (64.08%), Query Frame = 3
Query: 2034 ALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIG----------ACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLD--GTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTE-RGHIEVKGKGSTQTYWLHGENELIVDPIPK 3581
             +Y+G+ V LK     + I I         K+++L ++++  ++G          A L  G   +V ++C +GSL+D+LA+ +I LDW+FK SL+ D+ +G+ YLH+     G LKS NC+VD RFVLKITD G   L  +++ L E       ++ LWTAPELLR  +P L+  GT  GDV+S AI+ QE+V R   +++    + + +E+V+ V+   SP P    L ++     + +LL+KQ W E P LRP  +      +  NK G   NI+D++L  +EQY++NLED+++ERTE+   EK+K + LL  MLP SVA  L    PV  E ++ VT++FSDIVGFT +SA S P++++DLLN LYT FD+II ++DVYKVETIGDAYMV SGLPQ NG  HA EIA M++  LSA+  F + H P+  +++RIG+HSGP  +GVVGL MPRYCLFGDTVNT+SRMES GLP++IH++ ST+ +L+   +    E RG  E+KGKG+  T+WL G       PIPK
Sbjct:  553 GVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRA---EDQLWTAPELLR--DPALERRGTLAGDVFSLAIIMQEVVCRSAPYAML---ELTPEEVVQRVR---SPPPLCRPLVSMDQAPVECILLMKQCWAEQPELRPSMDHTFDLFKNINK-GRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGF-NKPIPK 1068          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 391.349 bits (1004), Expect = 7.727e-117
Identity = 223/492 (45.33%), Postives = 306/492 (62.20%), Query Frame = 3
Query: 2112 IQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAK-----EQITLDWVFKYSLIQDICRGMVYLHNNLGPI-GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSL---TAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRK-FNKEGDSGN--ILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLK-TFGTFLMTERGHIEVKGKGSTQTYWLHG 3548
            I++ K+  ++  ++ +F G        + V +YC +GSL +VL       +   +DW FK S++ DI +GM YLH++   + G LKS+NC+VDSR V+KITDFG  S+   K+ L             WTAPE LR +N     + KGDVYS+ I+ QEI+ RK  F   S  D    E +  V+  N   PFRP L   TA     E + LL+K  W EDP  RPDF  I+  + K F    D  N   +D L+ R++ Y+ NLE +V+ERT+ Y  E+ +A+ L + +LP+ V   L +   V  E Y+ VTI+FSDIVGFT +   STPM+++D+LN +Y +FD I++++DVYKVETIGDAYMV SGLP+ NGN HA +IA+MA+  LS +  F + H P   + +RIG+HSGP  +GVVG+KMPRYCLFGDTVNT+SRMES GLP +IH+S ST+ +LK T   FL   RG   +KG+G+  TYWL G
Sbjct:  531 IELNKLLQIDYYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDL-------------WTAPEHLRQANI----SQKGDVYSYGIIAQEIILRKETFYTLSCRD--RNEKIFRVENSNGMKPFRPDLFLETAEEKELEVY-LLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTG 1002          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 295/582 (50.69%), Postives = 405/582 (69.59%), Query Frame = 3
Query: 1878 VEKPSSKLSRNNSKNFGNP---IYKDLDL------ISCASLETIAGINLDKI--QNAQLFTKTALYKGNVVALKPI----LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEE-DSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPN--PFRPSLTAIHGCTEDFVL------LIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHG 3548
            V  PSS+ +R  + N  +P     K L L          S ++ +G +++ I   N Q++TKTA++KG VVA+K +        R+D++R  L+++KK+KDL +DHI RF GAC++  +  +V +YCPKGSLED+L  E+I LD + KYSL+ D+ +G+ +LHN+ +   G LKSSNC+VDSRFVLK+TDFGL  L   ++  LEE   + Y+K +LWTAPELLR SN P  GT KGD+YSFAI+  E+++RKGVF+L++ED  S  EIV+ V+   S +  P RP ++       D  L      L+   W+EDP  RP+ ++++  +R  N++ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + HA +IA+M+++ L  +  FVI HRP ++LKLRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLP KIH+SQ T  +L     F +  RG +E+KGKG   TYWL G
Sbjct:  645 VSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENED-LSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1224          

HSP 2 Score: 230.335 bits (586), Expect = 2.731e-61
Identity = 153/445 (34.38%), Postives = 227/445 (51.01%), Query Frame = 3
Query:  444 GVQTFVTQMPDVLFGPICGYVLAPIARLLAFWN--IPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWP-IRQYKEXXXXXXXXXXXXEQF--LIDAIGNKYAVAVLCVDPASVHRILLKADQLNF-NNGEYVFINIGLFSSGNETKYPW-YLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNY------HYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVY--RNIKLQAELNAMNWIIPWESLETSE 1733
             V+  + +  D + G   GY LAP+AR+  +W   IPI++   +      +R  E++ +TRI S +   V+   +   F  YKW   I+++H     +V    C  L   L       ++       + E   A ++      QF   + A  N   V +LC  P +V  I+L A  L    +GEYVFINI + S+G+  + PW     +N  EN +AK AYR+L +++L+  + ++++NF  +VKE A ++YNY       YE   +N F+S FYD VLLYA ALN+T+  G    NG  I   MW  TF GI G V+ID +GDR +D+S+LD+DP    F  VA++ G  +    V  +   W  V    P+  P CGYD S CP+    L++  +    MG   LI    G F++  R  KL+ EL AM+W I WE L+  E
Sbjct:  110 AVEQLLRKQIDCIIGYAYGYALAPVARMSPYWKNGIPIITPIGLTMSLDDKR--EYQLMTRINSPYK--VVSSAVSTLFNTYKWKRHIFMFHHAKAPSVAVGECFLLMASLQHPLRKVMEMQHNFFTFNEDHGANISKAERHNQFRNYLRASSNMANVIILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYE---MNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQLH--W--VGGKPPTDLPICGYDKSKCPQ-GYPLHVYLL----MGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEE 537          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 295/582 (50.69%), Postives = 405/582 (69.59%), Query Frame = 3
Query: 1878 VEKPSSKLSRNNSKNFGNP---IYKDLDL------ISCASLETIAGINLDKI--QNAQLFTKTALYKGNVVALKPI----LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEE-DSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPN--PFRPSLTAIHGCTEDFVL------LIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHG 3548
            V  PSS+ +R  + N  +P     K L L          S ++ +G +++ I   N Q++TKTA++KG VVA+K +        R+D++R  L+++KK+KDL +DHI RF GAC++  +  +V +YCPKGSLED+L  E+I LD + KYSL+ D+ +G+ +LHN+ +   G LKSSNC+VDSRFVLK+TDFGL  L   ++  LEE   + Y+K +LWTAPELLR SN P  GT KGD+YSFAI+  E+++RKGVF+L++ED  S  EIV+ V+   S +  P RP ++       D  L      L+   W+EDP  RP+ ++++  +R  N++ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + HA +IA+M+++ L  +  FVI HRP ++LKLRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLP KIH+SQ T  +L     F +  RG +E+KGKG   TYWL G
Sbjct:  624 VSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENED-LSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1203          

HSP 2 Score: 214.157 bits (544), Expect = 3.199e-56
Identity = 144/445 (32.36%), Postives = 226/445 (50.79%), Query Frame = 3
Query:  447 VQTFVTQMPDVLFGPICGYVLAPIARLLAFWN--IPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYT---NVIPLYCH-ALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNF-NNGEYVFINIGLFSSGNETKYPW-YLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNY------HYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVY--RNIKLQAELNAMNWIIPWESLETSE 1733
            ++ +  +  D + G    Y LAP+AR+  FW   +P+ +T A+        ++EF  LTR+   +  L  G+++ +  ++++W H  ++++        N     C+ +L              W ++ + E     L       + L+        + +LC  P +V  I+L A  L    +GEYVFINI + S+G+  + PW     +N  EN +AK AYR+L +++L+  + ++++NF  +VKE A ++YNY       YE   +N F+S FYD VLLYA ALN+T+  G    NG  I   MW  TF GI G V+ID +GDR +D+S+LD+DP    F  VA++ G  +    V  +   W  V    P+  P CGYD S CP+    L++  +    MG   LI    G F++  R  KL+ EL AM+W I WE L+  E
Sbjct:   94 IEHYCNKTVDAIMGLPYVYALAPVARISKFWGQGVPVFTTTALVDELGD--RNEFPLLTRMMGSYKSL--GKLVTRIAERFEWQHYFFMFNDEVARGPRNKGRSECYFSLSAIKNLIMNNKTSTWNVKMFSEFEADRLQY-----RALLSEASVMSNLIILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYE---MNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQLH--W--VGGKPPTDLPICGYDKSKCPQ-GYPLHVYLL----MGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEE 516          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 566.614 bits (1459), Expect = 1.418e-180
Identity = 295/582 (50.69%), Postives = 405/582 (69.59%), Query Frame = 3
Query: 1878 VEKPSSKLSRNNSKNFGNP---IYKDLDL------ISCASLETIAGINLDKI--QNAQLFTKTALYKGNVVALKPI----LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEE-DSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPN--PFRPSLTAIHGCTEDFVL------LIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHG 3548
            V  PSS+ +R  + N  +P     K L L          S ++ +G +++ I   N Q++TKTA++KG VVA+K +        R+D++R  L+++KK+KDL +DHI RF GAC++  +  +V +YCPKGSLED+L  E+I LD + KYSL+ D+ +G+ +LHN+ +   G LKSSNC+VDSRFVLK+TDFGL  L   ++  LEE   + Y+K +LWTAPELLR SN P  GT KGD+YSFAI+  E+++RKGVF+L++ED  S  EIV+ V+   S +  P RP ++       D  L      L+   W+EDP  RP+ ++++  +R  N++ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + HA +IA+M+++ L  +  FVI HRP ++LKLRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGLP KIH+SQ T  +L     F +  RG +E+KGKG   TYWL G
Sbjct:  683 VSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENED-LSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1262          

HSP 2 Score: 203.371 bits (516), Expect = 8.402e-53
Identity = 164/537 (30.54%), Postives = 253/537 (47.11%), Query Frame = 3
Query:  267 MLMLPK------NFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEP--VDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWN--IPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQ-----------KTFKKYKWTHGIYIYH-------------KTAYTNVIPLYCH----ALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNF-NNGEYVFINIGLFSSGNETKYPW-YLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNY------HYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVY--RNIKLQAELNAMNWIIPWESLETSE 1733
            +++LPK      NF M      +P I IA+++V     + P   +L   +    + I +   +A    +Q +     D + G    Y LA + ++ A  N  IPIL+T  +        K E+  LTR+  G   L+   M Q           K+     + + I+ YH             ++  T     +C+    A+  Y T++ +     W +   +      L  +    +  +  I  +  V +LC  P +V  I+L A  L    +GEYVFINI + S+G+  + PW     +N  EN +AK AYR+L +++L+  + ++++NF  +VKE A ++YNY       YE   +N F+S FYD VLLYA ALN+T+  G    NG  I   MW  TF GI G V+ID +GDR +D+S+LD+DP    F  VA++ G  +    V  +   W  V    P+  P CGYD S CP    ++ +      +MG   LI    G F++  R  KL+ EL AM+W I WE L+  E
Sbjct:   44 IVILPKRESTYDNFGM-TLQKAMPVIDIAVQEVIKAKKLPPGWINLTYWDSRLYEDILLAERHATVGVIQAYCEHRLDAILGFADNYGLATVTKVTAGLNGGIPILTTSGMPSLLNS--KKEYPFLTRM-QGSYRLLADSMYQLIAYHDEDSVSKSNSSLNYLNLIFFYHDKRRAVNRVIAQDESQETGATSSHCYFSLYAIKRYFTEKSKTFKREWALNTPQFPFDEDLVIERETFKQWLREISLQSNVIILCASPDTVREIMLAAHDLGMATSGEYVFINIDV-STGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFELRVKERADQKYNYTNITGKDYE---MNNFISAFYDAVLLYAIALNETIQSGLDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTVGQLH--W--VGGKPPTDLPICGYDKSKCPGYPLHVYL------LMGSFLLILVLVGLFIFFWRRYKLEQELAAMSWKIRWEELDGEE 562          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 529.635 bits (1363), Expect = 2.551e-174
Identity = 284/577 (49.22%), Postives = 393/577 (68.11%), Query Frame = 3
Query: 1878 VEKPSSKLSRNNSKNFGNP---IYKDLDL------ISCASLETIAGINLDKI--QNAQLFTKTALYKGNVVALKPI----LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEE-DSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPN--PFRPSLTAIHGCTEDFVL------LIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGT-----FLMTERGHIEVKGK 3518
            V  PSS+ +R  + N  +P     K L L          S ++ +G +++ I   N Q++TKTA++KG VVA+K +        R+D++R  L+++KK+KDL +DHI RF GAC++  +  +V +YCPKGSLED+L  E+I LD + KYSL+ D+ +G+ +LHN+ +   G LKSSNC+VDSRFVLK+TDFGL  L   ++  LEE   + Y+K +LWTAPELLR SN P  GT KGD+YSFAI+  E+++RKGVF+L++ED  S  EIV+ V+   S +  P RP ++       D  L      L+   W+EDP  RP+ ++++  +R  N++ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQ++ LLN LY  FD +++N+ VYKVETIGDAYMV SGLP+   + HA +IA+M+++ L  +  FVI HRP ++LKLRIG+HSG V +GVVG KMPRYCLFGDTVNTSSRMESNGL    + S   +   K F       FL  E+  IE +GK
Sbjct:   56 VSSPSSEATRKKNSNEEDPENGAKKSLSLKNRKLSFGMVSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENED-LSPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDD-HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLRMFWNFSLYKIYKFKVFKNKIELDFLKNEKESIEFEGK 630          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-7 (Receptor-type guanylate cyclase gcy-7 [Source:UniProtKB/Swiss-Prot;Acc:H2L002])

HSP 1 Score: 457.603 bits (1176), Expect = 2.394e-141
Identity = 332/1059 (31.35%), Postives = 535/1059 (50.52%), Query Frame = 3
Query:  474 DVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDA---IGNKYAVAVLCV-DPASVHR-ILLKADQLNFNNGEYVFINIGLFSSG-------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASR--EYNYHYEKD-------LINTFVSNFYDGVLLYAHALNKTLADG--GAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFL--VVPNVSVDWGSV-SNVIPSTKPRCGYDNSMCPKP--DKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQ-AELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRS-QNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLL--IKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            DV+ GP           +  ++N PI++ G V    + +    F     + +G   L  G  I+   K+Y+W+  +Y Y     T       + L   ++   +I + Y            ++         +I+A   I ++  + V C+ D   + R  LL A++      EYV++   + S G          +  W L+  +   ++RA +A++  + +   + +     N++   +E+ +R  E  Y   KD       +  T+    +D V  Y  AL+K L  G      N +  ++  +  +F G+ G VTI+  G R     +L +D      +    ++   S+    +  +  V W S  +N  P   P CG+  ++CPK   D+ L I  I A V+  LFL   +A   +Y +I+ +  E+  +N +                      +Q   IH     +HQ  S Q  KG        H +  ++  +S LS   + +F                         + +N   F+         V  K    + R+D ++   +  + +++L+ D++ RFIG CL+      V+ +C +GS+ DV+ K  I +D  F YSLI+D+  G+V+LH ++ G  G L S  CL+D R+ +KI+++GL  LR  + Y  E+      K+LLW+APELLR  +  + G+ +GDVYS  I+C E++ RKGVF+++   +   +EI+  +K     +P RP L   H    +  LL  ++  + E P  RP   T++  +R  N   +  N++D++ + +E YA++LE+ V ERT++ +EEKKK++ LLY MLPK+VA +L   Q V  E+++ VTIFFSD+V FT L+++ TP+Q+++LLN LYT FD IIE +DVYKVETIGD Y+  SGLP  NGN H R+IA M++AFLS++  F +PH P + + LRIG++ G V +GVVGL MPR+CLFGD VNT+SRMESNG P KIH+S    ++L   G F    RG + +KGKG  +T+WL G+
Sbjct:  107 DVIIGPTMNQPTLAAFIVSNYFNRPIIAWGLVNAA-QLDDFERFPNAGILSAGQRSL--GVAIRAVLKRYEWSQFVYAYFTEEDTEKCVTMRNDLQQVVSYFGDIILAY------------SIQVADISNDGMIEALKKIQSRGRIIVTCMKDGIGLRRKWLLAAEEAGMIGDEYVYVFSDIKSKGYVVPLLGGGERPSWILSTGSDENDTRALKAFKQSIFICDMMGQGSIATNYTIFGQEIIARMKEAPYFCTKDCEGENFTVAATYAGQLHDAVYAYGVALDKMLKAGQIAQYRNATAFMR-YFPQSFIGMSGNVTINEKGTRNPTLFLLALDENNNNTRMATIYVENMSATFNALYSDEGVMWASRKNNARPVDVPLCGFTGNLCPKSFVDEYL-IWVIVAIVV--LFLAITAAACGIYFSIQARRQEIERLNRL----------------------WQIPFIH-----LHQINSKQKGKGE-------HSVRSLQSGTSTLSSRTTVSFKT-----------------------ESRNFLFFSLQRESDYEPVVAKKHAYRPRLDDDKCTFM--RSLRNLDQDNLNRFIGLCLDGPQMLSVWRFCSRGSIADVILKATIQMDNFFIYSLIKDMVHGLVFLHGSMVGYHGMLTSKCCLIDDRWQVKISNYGLQDLRSPEMY--EK------KDLLWSAPELLRAED--IKGSKEGDVYSLGIICAELITRKGVFNMEDRKE-DPEEIIYLLKKGGLKSP-RPDLEYDHTIEINPALLHLVRDCFTERPSERPSIETVRSQLRGMNSSRND-NLMDHVFNMLESYASSLEEEVSERTKELVEEKKKSDVLLYRMLPKTVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHDVYKVETIGDGYLCVSGLPHRNGNEHVRQIALMSLAFLSSLQFFRVPHLPSERINLRIGMNCGSVVAGVVGLTMPRFCLFGDAVNTASRMESNGKPGKIHVSAEANRMLHLVGGFDTESRGEVIIKGKGVMETFWLTGQ 1074          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 465/1106 (42.04%), Postives = 668/1106 (60.40%), Query Frame = 3
Query:  306 PLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDV--LFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHK---TAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNF-NNGEYVFINIGLFSSGNE-TKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHY-EKDLINTFVSNFYDGVLLYAHALNKTLADGGAI----SNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHN-NLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEED-----SNMYFKNLLWTAPELLRMS-NPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDS-EDDFSAQEIVESVKAENS---PNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            P  +P +++A+  V+ M ++      ++ +   D+ C  + Y    G     TQ P+V  +FG  C YVLAPI+R    W +P+L+TG     F K+ +S + TLTR+    ++  LG +++     + WT    IY         N +   C A      +E  +    +    + +               ++  +  +  + ++C DP S+ +I+L A++LN  ++GEYVFINI LFS     T  PWY        N RA++AY ++L+VT K P + ++   S+++K +A+ +YNY + + + I+ FV++F+DGVLLYA+ALN+++ +   +     NG+ +++ MWN +F GI G VTID++GDR++ +S+LDM+P TG F+ VAHF+  +  F    N  + W       P  +P CGYD ++CP  D +L   AI + V+G + ++     +F YR+   +AE+N+M+W +  E                            V    +  + L+G+          H + K SS+L+                L+S    E +  IN D+    Q+F    +++ + VA+KP+ +   +  + R L++++K++KDL +DH+ +F GACL+    +++ +YCPKGSL+D+L  EQ  LDW+F+ SL+ DI RGM +LH+ ++   G LKSSNC+VDSRFVLKITDFGL +LR ++ + LE D     S+ Y+  LLWTAPELLR+  N P +GT KGDVY+F I+  EI  R+G F L     + S QEI+E VK  N      PFRP L        D   +I++ W EDP  RPDFNT+K  +R+FNK+ ++GNI+DNLL RME YANNLE++V+ERT+ Y EEKKK E LLY +LP+SVA QLI  QPV AE++D VTI+FSDIVGFTA+SAESTPMQ++  LN LYT FDSI+EN+DVYKVETIGDAYMV SGLP  NGN HAREIAR+A+A L A+  F I HRP+  LKLRIG+H+G   +GVVGLKMPRYCLFGDTVNT+SRMESNG   KIHIS++T + L  FGTF+ T RG + +KGKG   TYWL GE
Sbjct:  106 PKVLPVLELAIRHVQRMGFVGGSHFDIQLIS-RDTFC-SSKYGPI-GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNKKSES-YSTLTRLKGAQVN-NLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITR----------MLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFEA--NKEIHWAGDREEAPPDRPICGYDGALCP--DNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLED---------------------------VMFRDAAERGLRGS---------FHSLVKQSSQLT----------------LMS----EDMVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTR-FDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 465/1106 (42.04%), Postives = 668/1106 (60.40%), Query Frame = 3
Query:  306 PLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDV--LFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHK---TAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNF-NNGEYVFINIGLFSSGNE-TKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHY-EKDLINTFVSNFYDGVLLYAHALNKTLADGGAI----SNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHN-NLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEED-----SNMYFKNLLWTAPELLRMS-NPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDS-EDDFSAQEIVESVKAENS---PNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            P  +P +++A+  V+ M ++      ++ +   D+ C  + Y    G     TQ P+V  +FG  C YVLAPI+R    W +P+L+TG     F K+ +S + TLTR+    ++  LG +++     + WT    IY         N +   C A      +E  +    +    + +               ++  +  +  + ++C DP S+ +I+L A++LN  ++GEYVFINI LFS     T  PWY        N RA++AY ++L+VT K P + ++   S+++K +A+ +YNY + + + I+ FV++F+DGVLLYA+ALN+++ +   +     NG+ +++ MWN +F GI G VTID++GDR++ +S+LDM+P TG F+ VAHF+  +  F    N  + W       P  +P CGYD ++CP  D +L   AI + V+G + ++     +F YR+   +AE+N+M+W +  E                            V    +  + L+G+          H + K SS+L+                L+S    E +  IN D+    Q+F    +++ + VA+KP+ +   +  + R L++++K++KDL +DH+ +F GACL+    +++ +YCPKGSL+D+L  EQ  LDW+F+ SL+ DI RGM +LH+ ++   G LKSSNC+VDSRFVLKITDFGL +LR ++ + LE D     S+ Y+  LLWTAPELLR+  N P +GT KGDVY+F I+  EI  R+G F L     + S QEI+E VK  N      PFRP L        D   +I++ W EDP  RPDFNT+K  +R+FNK+ ++GNI+DNLL RME YANNLE++V+ERT+ Y EEKKK E LLY +LP+SVA QLI  QPV AE++D VTI+FSDIVGFTA+SAESTPMQ++  LN LYT FDSI+EN+DVYKVETIGDAYMV SGLP  NGN HAREIAR+A+A L A+  F I HRP+  LKLRIG+H+G   +GVVGLKMPRYCLFGDTVNT+SRMESNG   KIHIS++T + L  FGTF+ T RG + +KGKG   TYWL GE
Sbjct:  106 PKVLPVLELAIRHVQRMGFVGGSHFDIQLIS-RDTFC-SSKYGPI-GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAKEFNKKSES-YSTLTRLKGAQVN-NLGNVVRAILNSFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITR----------MLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEYTRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFEA--NKEIHWAGDREEAPPDRPICGYDGALCP--DNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLED---------------------------VMFRDAAERGLRGS---------FHSLVKQSSQLT----------------LMS----EDMVSINGDR----QIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTR-FDLESDGGNCNSHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302487)

HSP 1 Score: 547.74 bits (1410), Expect = 1.073e-173
Identity = 331/810 (40.86%), Postives = 461/810 (56.91%), Query Frame = 3
Query: 1206 INTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFE-GIGGTVTIDSSGDRIADFSILDMDP-KTGE------FKPVAHFIGTKSSF----LVVPNVS----VDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKN-----LLWTAPELLRMSNPPL-DGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESV-KAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            I+   +  YD V LYA AL + L  GG   NGS I+  +  + +   +G  V ID +GD   ++++L     + G        +PV  FI   SS       +PN+     +DW  V    P+  PRCG+    C         G ISA + G   L+       +YRN + + EL+++ W I +  ++  E  R                           Q+ K TR      HLL+        L R       +P      LI  + +   +  + D  +   +FT   LYKG + A+K +  ++ +DI R++  ++K ++D  +D+IC FIGAC +     ++ +YC +GSL+D+L  E + LD +F  S++ DI RG++YLH++  PI   G L +SNCLVDSR+V+K+TDFGL +    KQ + +  ++M   +     LL+ APELLR     L  GT +GD YSF I+  E+  R+G F    E   +  + ++ V + ++  NP+RPSL  +    +     +++ W E P  RPDF TI+  +R   K G   NI DN+++ ME+YANNLE +V +RT+Q  EEKKK + LL+ MLP+ VA QL K   V+ E Y+ V+I+FSDIVGFTA+SAE TP+Q++D LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LHA EIA M++  LSA+  F I HRP   L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+P KIH S    QLL   G +   ERG I +KGKG  +TYWL GE+E
Sbjct:  353 ISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN-----YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENERE-------------------------QQSQKQTR------HLLNH-------LPRRLPPQSTHP------LIRTSQVSLSSNPDAD-FRYTTIFTPIGLYKGQLYAIKKV-RKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAF---KQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFG---ETGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRK-GMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1100          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0302488)

HSP 1 Score: 545.043 bits (1403), Expect = 1.088e-172
Identity = 329/812 (40.52%), Postives = 458/812 (56.40%), Query Frame = 3
Query: 1206 INTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFE-GIGGTVTIDSSGDRIADFSILDMDP-KTGE------FKPVAHFIGTKSSFLVVPNV----------SVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKN-----LLWTAPELLRMSNPPL-DGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESV-KAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            I+   +  YD V LYA AL + L  GG   NGS I+  +  + +   +G  V ID +GD   ++++L     + G        +PV  FI   SS   +              +DW  V    P+  PRCG+    C         G ISA + G   L+       +YRN + + EL+++ W I +  ++  E  R                           Q+ K TR      HLL+        L R       +P      LI  + +   +  + D  +   +FT   LYKG + A+K +  ++ +DI R++  ++K ++D  +D+IC FIGAC +     ++ +YC +GSL+D+L  E + LD +F  S++ DI RG++YLH++  PI   G L +SNCLVDSR+V+K+TDFGL +    KQ + +  ++M   +     LL+ APELLR     L  GT +GD YSF I+  E+  R+G F    E   +  + ++ V + ++  NP+RPSL  +    +     +++ W E P  RPDF TI+  +R   K G   NI DN+++ ME+YANNLE +V +RT+Q  EEKKK + LL+ MLP+ VA QL K   V+ E Y+ V+I+FSDIVGFTA+SAE TP+Q++D LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LHA EIA M++  LSA+  F I HRP   L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+P KIH S    QLL   G +   ERG I +KGKG  +TYWL GE+E
Sbjct:  353 ISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPHQNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN-----YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENERE-------------------------QQSQKQTR------HLLNH-------LPRRLPPQSTHP------LIRTSQVSLSSNPDAD-FRYTTIFTPIGLYKGQLYAIKKV-RKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAF---KQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFG---ETGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRK-GMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1102          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 543.502 bits (1399), Expect = 2.884e-172
Identity = 329/810 (40.62%), Postives = 456/810 (56.30%), Query Frame = 3
Query: 1206 INTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFE-GIGGTVTIDSSGDRIADFSILDMDP-KTGE------FKPVAHFIGTKSSFL----VVPNVS----VDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKN-----LLWTAPELLRMSNPPL-DGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESV-KAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            I+   +  YD V LYA AL + L  GG   NGS I+  +  + +   +G  V ID +GD   ++++L     + G        +PV  FI   SS       +PN+     +DW  V    P+  PRCG+    C         G ISA + G   L+       +YRN + + EL+++ W I +  ++  E  R                           Q+ K TR+     H L    + S  LS N   +F                           +   +FT   LYKG + A+K +  ++ +DI R++  ++K ++D  +D+IC FIGAC +     ++ +YC +GSL+D+L  E + LD +F  S++ DI RG++YLH++  PI   G L +SNCLVDSR+V+K+TDFGL +    KQ + +  ++M   +     LL+ APELLR     L  GT +GD YSF I+  E+  R+G F    E   +  + ++ V + ++  NP+RPSL  +    +     +++ W E P  RPDF TI+  +R   K G   NI DN+++ ME+YANNLE +V +RT+Q  EEKKK + LL+ MLP+ VA QL K   V+ E Y+ V+I+FSDIVGFTA+SAE TP+Q++D LN LYT FDSII +YDVYKVETIGDAYMV SGLP  NG+LHA EIA M++  LSA+  F I HRP   L LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES+G+P KIH S    QLL   G +   ERG I +KGKG  +TYWL GE+E
Sbjct:  353 ISAEAAYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFSPIDW--VGGTRPAAAPRCGFGGEKCVN-----YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLLWKIDFREVQIHENERE-------------------------QQSQKQTRST----HPLIRTSQVS--LSSNPDADF---------------------------RYTTIFTPIGLYKGQLYAIKKV-RKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDS--PIRFHGALCTSNCLVDSRWVVKLTDFGLFAF---KQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFG---ETGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRK-GMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1087          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 451/1138 (39.63%), Postives = 656/1138 (57.64%), Query Frame = 3
Query:  174 ISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPW--PLTIPAIKIALEKVKSMP-----YMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLT-QEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLF--SSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            +SF V   E    ++ Q  +     +   LA++ LP + + +PW  P   PA+  ALEKV S P     Y   +V    + E  + +C ++   L   V    +  P    GP C Y  +P+AR    W +P++++GA   GF     + + ++T IG  H  L  G+ + +  + + W     +       +  P Y    G Y   +E  IT D     + +E               L+  I +K  V  +C    +  +++++  +  F   EY F  I LF  S  +    PW   A   ++++ AK A++S+  +T + P+N ++++F  ++K  A   +N++ E  L+N    +F+DGV+LY+HALN T+   G+   G ++ K MWN T+ G+ G V +D +GDR  DF++ DM D KTG+++ V+ + G++   ++ P + V W  +    P   P CG+ N       K + +  + + V+  +F+I  +   F+YR +KL+ EL A  W + WE ++ S     ++   C          SK+ +      +L+G+                          N+G             SL T+ G       N Q++ KT  YKGN+ A+K  ++++RI++ R++L ++K ++D+ N+H+ RFIGAC++     ++ +YCP+GSL+D++  E ITLDW+F+YSLI DI +GM +LHN+ +   G LKSSNC+VDSRFVLKITD+GL S          +D + ++   LWTAPELLR  NPP  GT KGDVYSF I+ QE+   KGVF L+     S +EI+E V     P   RP L      +E+   L+ + W+ED   RPDF+ IK  +RK N  G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIARM++A L A+  F I HRP+ +L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S++T  +L+ F  F +  RG +E+KGKG  +TYWL GE
Sbjct:   20 VSFGVVELEPVPENQPQSPSAHASQKNITLAVI-LPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLV--FNSSENKEGLCSDSVAPLV-AVDLKFSYNPWAFIGPGCDYSSSPVARFTTHWEVPMITSGARALGF-----NLYSSITNIGPTHKKL--GEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCYFAVEGPYTQMREDNITADDLVFNEDEEPLRYDE---------LLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPW---ARGDADDNAAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHW--LKGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMS-NTEKVLRRAC----------SKLTI------SLRGS--------------------------NYG-------------SLLTMDG-------NFQIYAKTGYYKGNITAIK-YVNKKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKDSNL---DDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLEGPC-LSPKEIIERVVEGRWPY-LRP-LLCPQSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGE 1061          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 451/1138 (39.63%), Postives = 656/1138 (57.64%), Query Frame = 3
Query:  174 ISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPW--PLTIPAIKIALEKVKSMP-----YMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLT-QEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLF--SSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            +SF V   E    ++ Q  +     +   LA++ LP + + +PW  P   PA+  ALEKV S P     Y   +V    + E  + +C ++   L   V    +  P    GP C Y  +P+AR    W +P++++GA   GF     + + ++T IG  H  L  G+ + +  + + W     +       +  P Y    G Y   +E  IT D     + +E               L+  I +K  V  +C    +  +++++  +  F   EY F  I LF  S  +    PW   A   ++++ AK A++S+  +T + P+N ++++F  ++K  A   +N++ E  L+N    +F+DGV+LY+HALN T+   G+   G ++ K MWN T+ G+ G V +D +GDR  DF++ DM D KTG+++ V+ + G++   ++ P + V W  +    P   P CG+ N       K + +  + + V+  +F+I  +   F+YR +KL+ EL A  W + WE ++ S     ++   C          SK+ +      +L+G+                          N+G             SL T+ G       N Q++ KT  YKGN+ A+K  ++++RI++ R++L ++K ++D+ N+H+ RFIGAC++     ++ +YCP+GSL+D++  E ITLDW+F+YSLI DI +GM +LHN+ +   G LKSSNC+VDSRFVLKITD+GL S          +D + ++   LWTAPELLR  NPP  GT KGDVYSF I+ QE+   KGVF L+     S +EI+E V     P   RP L      +E+   L+ + W+ED   RPDF+ IK  +RK N  G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIARM++A L A+  F I HRP+ +L+LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S++T  +L+ F  F +  RG +E+KGKG  +TYWL GE
Sbjct:   20 VSFGVVELEPVPENQPQSPSAHASQKNITLAVI-LPLHNTEYPWAWPRVGPALYWALEKVNSDPNLLAGYHLQLV--FNSSENKEGLCSDSVAPLV-AVDLKFSYNPWAFIGPGCDYSSSPVARFTTHWEVPMITSGARALGF-----NLYSSITNIGPTHKKL--GEFVLRMHRHFGWDKHAMLMFNDNKNDDRPCYFAVEGPYTQMREDNITADDLVFNEDEEPLRYDE---------LLRDISHKARVVYVCCKWETFRKLMVEFWRQGFPQEEYAFFFIDLFGRSLQSHPARPW---ARGDADDNAAKEAFKSVKILTYREPQNPEYKDFVSKLKTEAMDMFNFNVEDSLMNLISGSFHDGVMLYSHALNDTMDRSGSRPPGDVVNKRMWNRTYHGVTGLVQLDENGDREIDFALWDMTDTKTGDYQIVSVYNGSQKQMILEPGMKVHW--LKGRPPPDIPECGFKNDNPACLAKTVTMHQMISIVVCFIFIIIVTVTVFIYRKLKLENELTAQLWRVHWEDIQMS-NTEKVLRRAC----------SKLTI------SLRGS--------------------------NYG-------------SLLTMDG-------NFQIYAKTGYYKGNITAIK-YVNKKRIELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICILTEYCPRGSLQDLMESEGITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDSRFVLKITDYGLESFHKDSNL---DDVHAFYARQLWTAPELLRADNPPACGTQKGDVYSFGIILQELALLKGVFYLEGPC-LSPKEIIERVVEGRWPY-LRP-LLCPQSHSEEMGQLMLRCWSEDVNERPDFSQIKVLLRK-NNCGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGE 1061          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 432/1105 (39.10%), Postives = 629/1105 (56.92%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWT-HGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETK--YPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRN-NSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            ++LP++ + +PW  P   PA+  A+ +V + P + P   +       E  D IC E+   L   V       P    GP C Y  +P+    A W +P+++ GA    F +     + ++T  G  H  L  G+     ++ + W  H + ++  T        +  AL G  T+  E  +    +  ++E       ++      L+  I     V  +C  P    ++++   +      EYVF  I +F     ++   PW   A   S++  AK A++S+  +T   P+N+++++F   +K  A R +N+  +  L+N     FYDG++LY HALN++L+D     +G  + K MWN T+ G+ G V ID +GDR  DF++ DM D  TG+F+ VA + GT+    ++P +++ W      +P   P CG+ N       + + +  + + V+  + +I F+   F+YR +KL+ EL A  W I W+ ++ S                                            HL   +    SKL+ +    N+G             SL T  G       N Q+F KT  +KGN+VA+K I ++RR+++ R++L ++K ++D+ N+H+ RFIGAC++     +V +YCP+GSL+++L  + ITLDW+FKYSLI DI +GM +LHN+ +   G LKSSNC+VD+RFVLKITD+GL S+R        ED++ Y+   LW APEL RM   P  GT KGDVYSF I+ QE+  R+GVF L+  D  S +EIV+ V     P   RPSL      +E+   L+++ W E+P  RP+F+ I   +RK N+     +I+      + QYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRPD++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG P KIH+S +T  +L+ F  F +  RG +E+KGKG  +TYWL GE
Sbjct:   52 VILPQHNTSYPWAWPRVGPALDRAIARVNANPNLLPRHRVRHVFANSEDRDGICSESMAPLM-AVDLKFEHNPWAFIGPGCDYTSSPVGLFTAHWGLPMITAGAPAVAFLQ--MEIYTSITNTGPTHKKL--GEYALHLYRHFGWNQHSLLMFSDTKMGERACYF--ALEGLYTEMHEENITTMDL-VFEENKGPVNYSE------LLHKIQGDGRVVFVCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPW---ARGDSDDVFAKEAFQSVKILTYLEPQNQEYKDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNESLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWPG--GKVPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDIQMS--------------------------------------------HLEKALRSTGSKLTLSLRGSNYG-------------SLLTTDG-------NFQVFAKTGYFKGNIVAIKYI-NRRRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRTESD---TEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEG-DLLSPKEIVDRVALGEWPY-LRPSLNP-QAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNRSVPHYSIV------LSQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 1060          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 397/886 (44.81%), Postives = 552/886 (62.30%), Query Frame = 3
Query:  909 LCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETK--YPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRN-NSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            +C  P    ++++   +      EYVF  I +F     ++   PW   A   S++  AK A++S+  +T   P+N+++++F   +K  A R +N+  +  L+N     FYDG++LY HALN++L+D     +G  + K MWN T+ G+ G V ID +GDR  DF++ DM D  TG+F+ VA + GT+    ++P +++ W      +P   P CG+ N       + + +  + + V+  + +I F+   F+YR +KL+ EL A  W I W+ ++ S                                            HL   +    SKL+ +    N+G             SL T  G       N Q+F KT  +KGN+VA+K I ++RR+++ R++L ++K ++D+ N+H+ RFIGAC++     +V +YCP+GSL+++L  + ITLDW+FKYSLI DI +GM +LHN+ +   G LKSSNC+VD+RFVLKITD+GL S+R        ED++ Y+   LW APEL RM   P  GT KGDVYSF I+ QE+  R+GVF L+  D  S +EIV+ V     P   RPSL      +E+   L+++ W E+P  RP+F+ I   +RK N+E  S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRPD++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG P KIH+S +T  +L+ F  F +  RG +E+KGKG  +TYWL GE
Sbjct:    4 VCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPW---ARGDSDDVFAKEAFQSVKILTYLEPQNQEYKDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNESLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWPG--GKVPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDIQMS--------------------------------------------HLEKALRSTGSKLTLSLRGSNYG-------------SLLTTDG-------NFQVFAKTGYFKGNIVAIKYI-NRRRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRTESD---TEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEG-DLLSPKEIVDRVALGEWPY-LRPSLNP-QAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNREHRS-NILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 812          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 406/1034 (39.26%), Postives = 580/1034 (56.09%), Query Frame = 3
Query:  477 VLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIG------LFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHY-EKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
               GP C  V A  A+L AFWNI ++S       F    K  + TLTR+      L  G    +  K++ W H I I +    T  IP+       Y  +   ITV      +Y+++ ++     T+    +++ +     + V+      V  +L++A +    NG++VF          LF S     + W       S +S AK+AY++L  ++L  P +++++ FS+ V   +  ++ Y Y + + ++   +  +D V LYAHALN+TLA+ G   +G  + + MWN T +GI G VTID+SGDR  ++ +  +     + + VA++ GT   +  V  V + W       P   P CG+   +C   ++      I+ G++  L      A   +YR  KL  E + M W I               N N V       H+S V     RS+ L+                                           ASLE+I    +  +Q+     +TA+YKG + ++   ++ R   +N +LL ++K+ +DL + ++C+FIGA LE    +++ +YCPKGSL+D+L  E I LDW FK+SL+ DI +GM YLH++ L   G L SS+C+VDSRFVLK+TDFGL S+R  +    +   +  +  LLW APELLR S P  +GT KGDVYSFAI+ QE+VYR+G F + +   FS +EIVE V+A    +P RP +     C E+   L+   W E P  RPDF+ I+  ++K +  G S NILD+LLSRMEQYA NLE+IV ERT +  EEKK+AE LL  MLP+SVA QLI  + V AE+YD VTI+FSDI GFTA+SA  TPMQ++++LN LYT FD+II+ ++VYKVETIGDAYMV SGLP  NG+ HA+EIARM++A +  +  F  PH P+++L++RIG+HSGP  +GVVGLKMPRYCLFGDTVNT+SRMES GLP KIH+S ST  LL TF  F    RG I +KGKG  +T+WL GE+
Sbjct:   92 AFIGPSCSNVCAVTAKLAAFWNIAVISPVCADQQFLD--KKAYPTLTRVFGPFTKL--GAFFVEICKQFGWQH-IGIIYDGKPTWAIPVEGIK---YQAEHNNITV-----AKYQDIHSSLSQGSTSNWSRVLNEMAQVARIIVISAHGKVVRSLLIEAHKKGLTNGDFVFFCFEPYKQKVLFGS-----FDW---EQGDSYDSMAKQAYQALFFLSLYKPSDKRYQAFSENVISRSKIDFGYTYAQTEKVSVLAAIAHDTVWLYAHALNETLAENGNPYDGLAVTRRMWNRTIKGIQGDVTIDASGDRELNYMMKQIRGSNNQCQVVANYFGT---YKAVKGVQILWPGGLTSPPKDSPDCGFRGELCINLERKF---LIALGIIAGLMAAGTLAICVLYRKYKLPEEASKMLWTI---------------NANDVIMMEH--HSSTVPEKSHRSKPLQ-------------------------------------------ASLESI----ICSMQDKPSAHRTAVYKGTICSVS-FVNLRSTHLNSELLAELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTDFGLNSVR--RLDTEQSPGSDPWTALLWRAPELLRQSIPA-NGTQKGDVYSFAIIAQEVVYRRGPFYIPNSH-FSPREIVERVRAGGC-SPSRPYIDRAE-CVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLLGED 1027          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 378/502 (75.30%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGK 3518
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RF+GAC++     +V +YCP+GSL+D+L  E I LDW+F+ SLI DI +GM +LH ++ G  G LKSSNC+VDSRFVLKITD+GL S R S +    +D+   +   LWTAPELLRM+ PP  GT KGDVYSF I+ QEI  R G F +   D  S +EIV+ V+    P  FRP++  I   +E+  +L+ + W E+P+ RPDFN IK ++ KFNKEG S +ILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IHIS +T ++L  F  F +  RG IE+K K
Sbjct:  184 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPY-FRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 677          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 378/502 (75.30%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGK 3518
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RF+GAC++     +V +YCP+GSL+D+L  E I LDW+F+ SLI DI +GM +LH ++ G  G LKSSNC+VDSRFVLKITD+GL S R S +    +D+   +   LWTAPELLRM+ PP  GT KGDVYSF I+ QEI  R G F +   D  S +EIV+ V+    P  FRP++  I   +E+  +L+ + W E+P+ RPDFN IK ++ KFNKEG S +ILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IHIS +T ++L  F  F +  RG IE+K K
Sbjct:   54 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPY-FRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 547          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 378/502 (75.30%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGK 3518
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RF+GAC++     +V +YCP+GSL+D+L  E I LDW+F+ SLI DI +GM +LH ++ G  G LKSSNC+VDSRFVLKITD+GL S R S +    +D+   +   LWTAPELLRM+ PP  GT KGDVYSF I+ QEI  R G F +   D  S +EIV+ V+    P  FRP++  I   +E+  +L+ + W E+P+ RPDFN IK ++ KFNKEG S +ILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IHIS +T ++L  F  F +  RG IE+K K
Sbjct:  212 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPY-FRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 705          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 378/502 (75.30%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGK 3518
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RF+GAC++     +V +YCP+GSL+D+L  E I LDW+F+ SLI DI +GM +LH ++ G  G LKSSNC+VDSRFVLKITD+GL S R S +    +D+   +   LWTAPELLRM+ PP  GT KGDVYSF I+ QEI  R G F +   D  S +EIV+ V+    P  FRP++  I   +E+  +L+ + W E+P+ RPDFN IK ++ KFNKEG S +ILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IHIS +T ++L  F  F +  RG IE+K K
Sbjct:  139 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPY-FRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 632          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 378/502 (75.30%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGK 3518
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RF+GAC++     +V +YCP+GSL+D+L  E I LDW+F+ SLI DI +GM +LH ++ G  G LKSSNC+VDSRFVLKITD+GL S R S +    +D+   +   LWTAPELLRM+ PP  GT KGDVYSF I+ QEI  R G F +   D  S +EIV+ V+    P  FRP++  I   +E+  +L+ + W E+P+ RPDFN IK ++ KFNKEG S +ILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH REIARM++A L A+  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IHIS +T ++L  F  F +  RG IE+K K
Sbjct:  107 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---ADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPY-FRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNKEG-STSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 600          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 386/514 (75.10%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            Q+F KTA YKGN+VA+K + +++RI++ R++L ++K ++D+ N+H+ RF+GAC +     ++ +YCP+GSL+D+L  E ITLDW+F+YSL  DI +GM++LHN  +G  G LKSSNC+VD RFVLKITD+GL S R  +     E  +  F   LWTAPELLRM++PP  G+  GDVYSF I+ QEI  R GVF ++  D  S +EI+E V     P PFRPS+  +    E+   L+++ W EDP  RP F  I+  +RKFNKE +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LHARE+ARMA+A L A+  F I HRP ++L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IH+S  T  +L+ F  F +  RG +E+KGKG  +TYWL GE 
Sbjct:  547 QVFAKTAYYKGNLVAVKRV-NRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPE----PEQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLD-LSPKEIIERVTRGEQP-PFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGER 1051          

HSP 2 Score: 229.95 bits (585), Expect = 2.880e-61
Identity = 147/507 (28.99%), Postives = 249/507 (49.11%), Query Frame = 3
Query:  270 LMLPKNFSMFPWPLTI--PAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLT--QEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLF------SSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISF-SAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNL 1748
            ++LP   + +PW      PA+++AL +VK+ P + P   +   L + E    +C +T   L   V       P V  GP C Y  AP+ R  A W +P+L+ GA   G     K E+   TR G  H+ L  G  +    ++  W H   + +     +  P +    G Y+   +   ITV++   +++ E      T        L+  +  K  V  +C  P +   ++L A        +YVF ++ +F      + G   + PW     +  ++ RA++A+++   +T K P+N ++  F  Q+K +A +++N+  E  L N   ++F+DG+LLY  A+ +TLA GG +++G  I + MWN +F+G+ G + ID +GDR  DFS+ DMDP+TG F+ V +F GT    + V    + W       P   P+CG+DN        + +   + A ++G L L+SF    +F+YR ++L+ EL +  W + WE L+ S   R+L
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGV--KDEYALTTRTGPSHVKL--GDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNH---QEFVEGDPDHYTK-------LLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPW---ERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLA-LVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHL 520          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 380/515 (73.79%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSFAI+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T   L   G F +  RG +E+KGKG  +TYWL GE +
Sbjct:  101 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQK 607          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 380/515 (73.79%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSFAI+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T   L   G F +  RG +E+KGKG  +TYWL GE +
Sbjct:  535 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQK 1041          

HSP 2 Score: 188.734 bits (478), Expect = 3.287e-48
Identity = 140/501 (27.94%), Postives = 227/501 (45.31%), Query Frame = 3
Query:  261 LAMLMLPKNFS-MFPWPLTIPAIKIALEKV-KSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY-LTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPK-PDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            LA+++   N S  + WP   PA+ +A+E + +++P     V S      +D  C E   A  R V   +   PD+L GP C Y  A +AR  + W +P+L+ GAV  GF   +   ++TL R G     L  G+ +      + WT    + +  A T+  P Y    G +   Q   ++V +           A            I A G    +  +C     +H ILL+A + N  NG+YVF  + +F           T  PW      Q +    + A++++L +T + P N +++ F +++   A  ++       L+N     FYDG+LLYA  LN+T+ +GG   +G  I++ M    + G+ G V +D + DR  DF +  M D  +G+F+P AH+ G +          + W  V    P   P C +  D+  C K P   L I A+  GV   +F +S    + ++R + L+ EL +M W I WE L+
Sbjct:   27 LAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSS-----ELDGACSEY-LAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGF-AAKNEHYRTLVRTGPSAPKL--GEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH--------QVYAREPGGPEQATHFIRANGR---IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQ-DNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWT-GRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVS---SFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 483.411 bits (1243), Expect = 1.606e-151
Identity = 244/437 (55.84%), Postives = 321/437 (73.46%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSG 3323
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSFAI+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+G
Sbjct:  535 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG 963          

HSP 2 Score: 188.734 bits (478), Expect = 3.301e-48
Identity = 140/501 (27.94%), Postives = 227/501 (45.31%), Query Frame = 3
Query:  261 LAMLMLPKNFS-MFPWPLTIPAIKIALEKV-KSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY-LTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPK-PDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            LA+++   N S  + WP   PA+ +A+E + +++P     V S      +D  C E   A  R V   +   PD+L GP C Y  A +AR  + W +P+L+ GAV  GF   +   ++TL R G     L  G+ +      + WT    + +  A T+  P Y    G +   Q   ++V +           A            I A G    +  +C     +H ILL+A + N  NG+YVF  + +F           T  PW      Q +    + A++++L +T + P N +++ F +++   A  ++       L+N     FYDG+LLYA  LN+T+ +GG   +G  I++ M    + G+ G V +D + DR  DF +  M D  +G+F+P AH+ G +          + W  V    P   P C +  D+  C K P   L I A+  GV   +F +S    + ++R + L+ EL +M W I WE L+
Sbjct:   27 LAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSS-----ELDGACSEY-LAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGF-AAKNEHYRTLVRTGPSAPKL--GEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH--------QVYAREPGGPEQATHFIRANGR---IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQ-DNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWT-GRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVS---SFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2g (guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:106025])

HSP 1 Score: 463.766 bits (1192), Expect = 1.516e-143
Identity = 349/1075 (32.47%), Postives = 526/1075 (48.93%), Query Frame = 3
Query:  477 VLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTH-GIY--IYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVA---VLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYH------YEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNM--WNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGE--FKPVAHFIGTKSSFLVVPNVSVDWGSVSNV------IPSTKPRCGYDNSMC---PKPDKNLNIGAISAGVMGCLFLISFSA----GYFVYR-NIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLF-TKTALYKGNVVALKPILSQ-----RRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRK--GVFSLDSED-DFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPK 3581
             LFGP C      I  L + WNIP+      + G     K  F   T +        +  +++++ +   W H G++      +++  V  ++     G L   F IT       +Y   +             L + + N   VA   +L        RIL  A  L  + GE+VFI   L     ++ +   LT   + +  R  + Y S   V L  P         D  ++  S+E            +D ++ + +  +D +LLYA  + +         +G  +I  +     T +GI G V +DS G R  D+S+  +        F P  H+     SF     V   W + SN       +P  KP CG+ N +C   P     + +  ++A +    FL+  SA    G  ++R   K+Q+      W I ++S+        L+  + + ++  P+    V    S +  +K + +                                      C SL       + + Q+ +LF     LY+GN VAL  I  +     ++  + R++ +      +L +++I  F G C E     +V  YC KGSL+DV+      +DW+FK S   DI  G+++LH + L   G LK SNCLVDS   LK++ FGL   +    +            L WTAPELLR+   P  GT +GDVYSFAI+ +++++++  G F    ED + + +EI+  +K   +P P RPSL    G     V L+++ W+E P LRP F +IK  +R+ +  G   +ILD+++ ++E YAN+LE++V+ERT + + EK+K E LL +MLP  V  QLI  + V  E ++ VTIFFSDIVGFT L + S+P+Q++ LLN LY+ FD  I+++DVYKVETIGDAYMV SGLP  NG  HA EIA MA+  LS    F I H P++ LKLRIG+H+GPV +GVVG+ MPRYCLFGDTVN +SRMES+ LP +IH+SQST   L   G + + +RG I VKGKG   T+WL G++   V P+P+
Sbjct:  117 ALFGPACPEAAEVIGLLASEWNIPLFD----FVGQMAALKDHFWCDTCVTLVPPKQEISAVLRESLRYLGWEHIGVFGGSSADSSWEQVDEMWGAVEDG-LQFHFNITASM----RYNSSS----------SDLLQEGLRNMSYVARVIILICSSEDARRILQAAVDLGLDTGEFVFI---LLQQLEDSFWKEVLT---KDKVIRFPKVYES---VFLIAPSAYGGGIGDDGFRKQVSQELRRPPFQSSITSEDQVSPYSAYLHDALLLYAQTVEEMRKAEKDFRDGRQLISTLRAGQVTLQGITGPVLLDSQGKRHVDYSVYALQESGNRSLFLPFLHY----DSF---QKVIRPWRNDSNTSWPHGSLPEYKPGCGFHNDLCKTKPPTVAGMTV-TVTAVIPTVTFLVLASAAAITGLMLWRLRGKVQSHPGDTWWQIRYDSI-------TLLPQHKLSHRGTPVSRRNV----SDTSTVKASAD--------------------------------------CGSL-------VKRHQDEELFFAPVGLYQGNQVALCYIGDEAEAWVKKPTVRREVCLMC----ELKHENIVPFFGVCTEPPNICIVTQYCKKGSLQDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFKHGSTWRSYNQEATDHSELYWTAPELLRLRESPCSGTPQGDVYSFAILLRDLIHQQAHGPF----EDLEAAPEEIISRIKDPRAPVPLRPSLLEDKG-DGRIVALVRECWDESPELRPIFPSIKKTLREASPRGHV-SILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWLKGKDGFPV-PLPE 1088          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 303/516 (58.72%), Postives = 389/516 (75.39%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            Q+F KTA YKGN+VA+K + +++RI++ R++L ++K ++D+ N+H+ RF+GAC +     ++ +YCP+GSL+D+L  E ITLDW+F+YSL  DI +GM++LHN  G I   G LKSSNC+VD RFVLKITD+GL S R     L  E  +  +   LWTAPELLRM++PP+ G+  GDVYSF I+ QEI  R GVF ++  D  S +EI+E V     P PFRPSL A+    E+  LL+++ W EDP  RP F  I+  +RKFN+E +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LHA E+ARMA+A L A+  F I HRP ++L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S  T  +L+ FG F +  RG +E+KGKG  +TYWL GE 
Sbjct:  551 QVFAKTAYYKGNLVAVKRV-NRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHN--GAICSHGNLKSSNCVVDGRFVLKITDYGLESFRD----LDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLD-LSPKEIIERVTRGEQP-PFRPSL-ALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGER 1055          

HSP 2 Score: 220.705 bits (561), Expect = 1.748e-57
Identity = 146/508 (28.74%), Postives = 242/508 (47.64%), Query Frame = 3
Query:  270 LMLPKNFSMFPWPLTI--PAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYC----HALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSS------GNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNL 1748
            ++LP   + +PW      PA+++AL +VK+ P + P   +   L + E    +C +T   L   V       P V  GP C Y  AP+ R  A W +P+L+ GA   GF    K E+   TR G  +  L  G  +    ++  W     + +  AY      +C      L   +     ITVD+    ++ E   +  T        L+  +  K  V  +C  P +   ++L A +      +YVF ++ +F        G   + PW        ++  A++A+++   +T K P+N ++  F  Q+K +A  ++N+  E  L+NT  ++F+DG+LLY  A+ +TLA GG +++G  I + MWN +F+G+ G + IDSSGDR  DFS+ DMDP+ G F+ V ++ GT    + V    ++W       P   P+CG+DN        +L+   + A V     L      +F+YR ++L+ EL +  W + WE +E S   R+L
Sbjct:   39 VVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLA-AVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAGAPALGFGV--KDEYALTTRAGPSYAKL--GDFVAALHRRLGWERQALMLY--AYRPGDEEHCFFLVEGLFMRVRDRLNITVDHL---EFAEDDLSHYTR-------LLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPW---ERGDGQDVSARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHL 524          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 386/514 (75.10%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            Q+F KTA YKGN+VA+K + +++RI++ R++L ++K ++D+ N+H+ RF+GAC +     ++ +YCP+GSL+D+L  E ITLDW+F+YSL  DI +GM++LHN  +G  G LKSSNC+VD RFVLKITD+GL S R  +     E  +  F   LWTAPELLRM++PP  G+  GDVYSF I+ QEI  R GVF ++  D  S +EI+E V     P PFRPS+  +    E+   L+++ W EDP  RP F  I+  +RKFNKE +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LHARE+ARMA+A L A+  F I HRP ++L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   +IH+S  T  +L+ F  F +  RG +E+KGKG  +TYWL GE 
Sbjct:  547 QVFAKTAYYKGNLVAVKRV-NRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPE----PEQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLD-LSPKEIIERVTRGEQP-PFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGER 1051          

HSP 2 Score: 229.95 bits (585), Expect = 2.015e-60
Identity = 147/507 (28.99%), Postives = 249/507 (49.11%), Query Frame = 3
Query:  270 LMLPKNFSMFPWPLTI--PAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLT--QEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLF------SSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISF-SAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNL 1748
            ++LP   + +PW      PA+++AL +VK+ P + P   +   L + E    +C +T   L   V       P V  GP C Y  AP+ R  A W +P+L+ GA   G     K E+   TR G  H+ L  G  +    ++  W H   + +     +  P +    G Y+   +   ITV++   +++ E      T        L+  +  K  V  +C  P +   ++L A        +YVF ++ +F      + G   + PW     +  ++ RA++A+++   +T K P+N ++  F  Q+K +A +++N+  E  L N   ++F+DG+LLY  A+ +TLA GG +++G  I + MWN +F+G+ G + ID +GDR  DFS+ DMDP+TG F+ V +F GT    + V    + W       P   P+CG+DN        + +   + A ++G L L+SF    +F+YR ++L+ EL +  W + WE L+ S   R+L
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGV--KDEYALTTRTGPSHVKL--GDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNH---QEFVEGDPDHYTK-------LLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPW---ERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLA-LVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHL 520          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 301/516 (58.33%), Postives = 386/516 (74.81%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            Q+F KTA YKGN+VA+K + +++RI++ R++L ++K ++D+ N+H+ RF+GAC +     ++ +YCP+GSL+D+L  E ITLDW+F+YSL  DI +GM++LHN  G I   G LKSSNC+VD RFVLKITD+GL S R  +     E  +  F   LWTAPELLRM++PP  G+  GDVYSF I+ QEI  R GVF ++  D  S +EI+E V     P PFRPS+  +    E+   L+++ W EDP  RP F  I+  +RKFNKE +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LHARE+ARMA+A L A+  F I HRP ++L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S  T  +L+ F  F +  RG +E+KGKG  +TYWL GE 
Sbjct:  547 QVFAKTAYYKGNLVAVKRV-NRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHN--GAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPE----PEQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLD-LSPKEIIERVTRGEQP-PFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNKE-NSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGER 1051          

HSP 2 Score: 226.483 bits (576), Expect = 2.961e-59
Identity = 146/507 (28.80%), Postives = 247/507 (48.72%), Query Frame = 3
Query:  270 LMLPKNFSMFPWPLTI--PAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLT--QEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLF------SSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISF-SAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNL 1748
            ++LP   + +PW      PA+++AL +VK+ P + P   +   L + E    +C +T   L   V       P V  GP C Y  AP+ R  A W +P+L+ GA   G     K E+   TR G  H+ L  G  +    ++  W H   + +     +  P +    G Y+   +   ITV++   +++ E               L+ A+  K  V  +C  P +   ++L A        +YVF ++ +F      + G   + PW        ++  A++A+++   +T K P+N ++  F  Q+K +A +++N+  E  L N   ++F+DG+LLY  A+ +TLA GG +++G  I + MWN +F+G+ G + ID +GDR  DFS+ DMDP+TG F+ V ++ GT    + V    + W       P   P+CG+DN        + +   + A ++G L LISF    +F+YR ++L+ EL +  W + WE L+ S   R+L
Sbjct:   35 VVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLA-AVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGV--KDEYALTTRTGPSHVKL--GDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNH---QEFVEGDPDHYPK-------LLRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPW---ERGDGQDRSARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYW--PLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLA-LVGSLSLISFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHL 520          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16067|ANPRB_RAT (Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 380/515 (73.79%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSFAI+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T   L   G F +  RG +E+KGKG  +TYWL GE +
Sbjct:  535 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERK 1041          

HSP 2 Score: 189.119 bits (479), Expect = 2.071e-47
Identity = 138/501 (27.54%), Postives = 228/501 (45.51%), Query Frame = 3
Query:  261 LAMLMLPKNFS-MFPWPLTIPAIKIALEKV-KSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY-LTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPK-PDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            LA+++   N S  + WP   PA+ +A+E + +++P     V S      +D  C E   A  R V   +   PD+L GP C Y  A +AR  + W++P+L+ GAV  GF   +   ++TL R G     L  G+ +      + WT    + +  A T+  P Y    G +   Q   ++V +                        I A G    +  +C     +H ILL+A + N  NG+YVF  + +F           T  PW      Q +    + A++++L +T + P N +++ F +++   A  ++       L+N     FYDG+LLYA  LN+T+ +GG   +G  I++ M    + G+ G V +D + DR  DF +  M D ++G+F+P AH+ G +          + W  V    P   P C +  D+  C K P   L I A+  G+   +F +S    + ++R + L+ EL +M W I WE L+
Sbjct:   27 LAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSS-----ELDGACSEY-LAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWHLPLLTAGAVASGF-AAKNEHYRTLVRTGPSAPKL--GEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH--------QVYTREPGGPEQATHFIRANGR---IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQ-DNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLESGDFQPAAHYSGAEKQIWWT-GRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVS---SFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q6VVW5|ANPRB_MOUSE (Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 294/515 (57.09%), Postives = 380/515 (73.79%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNL-GPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            Q+F  T  +KGNVVA+K + +++RI++ RQ+L ++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  + I LDW+F+YSLI D+ +GM +LHN++    G+LKSSNC+VDSRFVLKITD+GL S R + +    +DS+  +   LWTAPELL  +  P  G  K DVYSFAI+ QEI  R G F L+  D  S +EIV+ V+    P  FRPS+       E+ VLL+++ W +DP  RPDF  IK  +R+FNKEG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA EIARMA+A L A+  F I HRP  +L+LRIG+H+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T   L   G F +  RG +E+KGKG  +TYWL GE +
Sbjct:  535 QIFANTGHFKGNVVAIKHV-NKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAE---PDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPY-FRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQK 1041          

HSP 2 Score: 188.734 bits (478), Expect = 2.299e-47
Identity = 140/501 (27.94%), Postives = 227/501 (45.31%), Query Frame = 3
Query:  261 LAMLMLPKNFS-MFPWPLTIPAIKIALEKV-KSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY-LTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPK-PDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            LA+++   N S  + WP   PA+ +A+E + +++P     V S      +D  C E   A  R V   +   PD+L GP C Y  A +AR  + W +P+L+ GAV  GF   +   ++TL R G     L  G+ +      + WT    + +  A T+  P Y    G +   Q   ++V +           A            I A G    +  +C     +H ILL+A + N  NG+YVF  + +F           T  PW      Q +    + A++++L +T + P N +++ F +++   A  ++       L+N     FYDG+LLYA  LN+T+ +GG   +G  I++ M    + G+ G V +D + DR  DF +  M D  +G+F+P AH+ G +          + W  V    P   P C +  D+  C K P   L I A+  GV   +F +S    + ++R + L+ EL +M W I WE L+
Sbjct:   27 LAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSS-----ELDGACSEY-LAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGF-AAKNEHYRTLVRTGPSAPKL--GEFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQH--------QVYAREPGGPEQATHFIRANGR---IVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQ-DNRTQEQAQALREAFQTVLVITYREPPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWT-GRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVS---SFLIFRKLMLEKELASMLWRIRWEELQ 500          
BLAST of Guanylate cyclase vs. TrEMBL
Match: G4V651 (Guanylate cyclase OS=Schistosoma mansoni OX=6183 GN=Smp_142620 PE=3 SV=1)

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 542/1117 (48.52%), Postives = 706/1117 (63.21%), Query Frame = 3
Query:  315 IPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMP----DVLFGPICGYVLAPIARL-LAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDL--VLGQMIQKTFKKYKW------------THGIYIYHKT-AYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTF------KGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDA 3587
            +PAI +ALE ++S P    +           ++ +    AL       +TQ+     +V+FGP+  + LA  AR   A +N+PI++     +  +   K E+  LTR+   + DL  V G     T K Y W            T  +        +T +  ++ H     + Q+F +         YK L+          ++FL   + +   + +LC DP  V  I+L+A +LN  NG+Y F N+ L SS  + K PWY   S+  EN RA++AYR+L++VTL  P++ ++R F+++V+  A R+Y++ Y    +  F+  F+D V LYA ALN  LA GG I+NG+LI + MWN TF+G+ G V ID++GDR AD+S+LDM+P TG+F+ V ++ G   S   V   ++DW +  N  P   P CG+D S C      ++IG + A V   L  +S   G   YR  K QAEL AMNWIIPW++L+ +EK                              +L+  R E        ++  P+            +P+ K    IS  +    A        N+Q+F +TA Y  ++VALKP+  Q R++ ++ L I+VKKVKDLN DHICR IG CLE+ +Q +VY+YCPKGSL+DVL  EQI LDW+FK+SL+QDICRG++YLH   GP G LKSSNCLVDSRFVLKITDFGL  +RG      E  S ++ +NLLWTAPELL    P  D T       KGDVYSFAIVCQEIVYRKGVF + +  +     IV+ VKA   P PFRP+L ++ GC+ED V LI Q+W++DP +RPDF +IK  MRK NK GDS N+LDNLLSRMEQYANNLE++V++RT QYLEEKKK EDLLYSMLP+SVA QL +NQPV AES+++VTI+FSDIVGFT+LSAESTPMQ+++LLNRLYT FD IIEN+D YKVETIGDAYMV SGLPQ NGN HARE+ARM+IAFL AIF F IPHRP+K L+LRIGIHSGPVC+GVVG KMPRYCLFGDTVNTSSRMESNGLP KIHISQ T  +LKTF +F+MTERG +E+KGKG  +TYWLHGE+  IVDPIP  A
Sbjct:   97 LPAIDLALEDIQSFPAFGGVS--------FTTVLILYIDALACDALALLTQLNSNGVNVIFGPLNDFTLANAARFSTAMYNVPIVAPAG--FAHQLSDKLEYGMLTRVLFTYSDLEWVFGN----TLKHYGWLPDQQTPIAIVTTRNVRRREGVVGHTGMAGVFQH----LILQKFLVKA------AYKLLSVTLDDEFDVTDRFL-KRLPDSARIIILCTDPEVVRDIMLEAHKLNMVNGDYAFFNMDLLSSQTKLKRPWYRETSSPEENERARQAYRALMTVTLLKPDSPEYRTFTEEVRARALRDYDFSYRDSEVTPFIGTFHDAVKLYALALNDALAKGGTITNGTLITQEMWNRTFKGVTGVVRIDANGDRNADYSLLDMNPVTGDFEVVVNYFGNDKSLSTVLGRTIDWINTDNQPPLHTPPCGFDGSECHN-SHFIHIGIVGAVVFILLMTMSLVLGIIFYRRAKFQAELRAMNWIIPWDALQVTEK------------------------------HLRRYRRE-------SDIRSPNQS---------SDPLRK----ISSETCTAAAA-------NSQMFARTAFYMKSIVALKPLRRQTRMEPSKALSIEVKKVKDLNCDHICRLIGVCLEVPHQCIVYEYCPKGSLQDVLENEQIKLDWMFKFSLMQDICRGVMYLHQIFGPHGNLKSSNCLVDSRFVLKITDFGLPHIRGPPPLESEVGSFIFHRNLLWTAPELL----PDGDTTIYPRESIKGDVYSFAIVCQEIVYRKGVFYIQNFKNCEPDFIVKEVKAHRKP-PFRPTLDSLEGCSEDLVQLICQAWDDDPSVRPDFQSIKLSMRKLNKAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQVVELLNRLYTLFDGIIENFDAYKVETIGDAYMVASGLPQRNGNKHAREVARMSIAFLKAIFEFQIPHRPEKRLELRIGIHSGPVCAGVVGQKMPRYCLFGDTVNTSSRMESNGLPLKIHISQQTFDVLKTFKSFIMTERGLVEMKGKGRQKTYWLHGEDCYIVDPIPPGA 1125          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8HCY1 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 527/1133 (46.51%), Postives = 715/1133 (63.11%), Query Frame = 3
Query:  315 IPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARL--LAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKW----THGIY--------IYHKTAYTNV----IPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGG--AISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE----------TSEKIRNLVNHNCVKYQSKPI--HNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIY-KDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMY-FKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTA-----IHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFL 3593
            +P + IA+E V ++  ++    SL      DS C + + A   GV   + Q  D++ GP C + LA +AR   +  +  PIL+TG V    R   K+E+  L R+G    D V  +M+   F+++ W       I         +  K     +      + CH +  +  QE  I          + L           E F +  + ++  + VLC DP +V  I++KA +L F NGEYVF NI LFSS   T  PW         N +A RAYR+L+++TL+ P + ++RNFS QVK +A  +YN+ Y ++ +N+FV  F+D V+LYA A+N T+ + G   I+NGSLI + M N TFEGI GTV+I+++GDR AD+S+LDMD  T  F  VAH+ G +  + +VP   +DW +  N+ P   P+CG+D SMC +    +   A+   ++    L    A   +YR ++L++EL+AMNW IPW  LE          TSE  ++L   +    QS+P   H  + + HQ R+ +++       N       E  +SK +R+  K+  +       + +S  S++TIAG+ L +I   QLFTKTA YKG +VALKP+ L  +RI++  +LL++VK+VKDL +D++ RFIGACL+   + +V +YCPKGSL+DVL  + + LDW+FK+SL+ DICRGM+YLH+N G  G LKSSNCLVDSRF LKI DFGL SLRG+K Y  +ED+    ++N LWTAPELLR   PP +GT +GDVYSFAI+CQEI+YR+GVF +   D    QEIVE VK E S   +RP+L A         +E  +  ++  W EDP  RP FN+IK  + +FNK+ +SGNILDNLL RMEQY+NNLE +V +RT+ YLEEKKKAE+LLY MLPKSVA  L++ + V AE +D VTI+FSDI GFTALS+ESTP++++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NG LHAREI+RMA++FL  I+ F I H+PD +LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIHIS  T ++L+  G F+ T RG +E+KGKG   TYWLHGE + IVDP+  +  L
Sbjct:    7 LPVVDIAIETVTTLDLLHGHSVSLIA---NDSKC-DYSVAPVLGV-LLLQQKIDLMLGPYCSFALAAVARYNRMPHYRRPILTTGGVASALRD--KAEYFNLIRVGPS-FDGV-EKMLYLVFQRFNWKPRDVQTILFIELPDEDVKEKRTRDEIGVTQSRILCHGIEKHFVQEKYIV---------RRLQYEMHNAQFKSEIFRV--MRDEIRLVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIA--VIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHN-------EGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRNKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVK-EISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPVVSNGSL 1109          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A267GXV3 (Guanylate cyclase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000254g3 PE=3 SV=1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 484/936 (51.71%), Postives = 639/936 (68.27%), Query Frame = 3
Query:  864 QFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGG--AISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE----------TSEKIRNLVNHNCVKYQSKPI--HNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIY-KDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN-----MYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTA-----IHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFL 3593
            + L++ +GNK AV VLC DP +V  I++KA +L F NGEYVF NI LFSS   T  PW         N +A RAYR+L+++TL+ P + ++RNFS QVK +A  +YN+ Y ++ +N+FV  F+D V+LYA A+N T+ + G   I+NGSLI + M N TFEGI GTV+I+++GDR AD+S+LDMD  T  F  VAH+ G +  + +VP   +DW +  N+ P   P+CG+D SMC +    +   A+   ++    L    A   +YR ++L++EL+AMNW IPW  LE          TSE  ++L   +    QS+P   H  + + HQ R+ +++       N       E  +SK +R+  K+  +       + +S  S++TIAG+ L +I   QLFTKTA YKG +VALKP+ L  +RI++  +LL++VK+VKDL +D++ RFIGACL+   + +V +YCPKGSL+DVL  + + LDW+FK+SL+ DICRGM+YLH+N G  G LKSSNCLVDSRF LKI DFGL SLRG+K Y  +ED+        F + LWTAPELLR   PP +GT +GDVYSFAI+CQEI+YR+GVF +   D    QEIVE VK E S   +RP+L A         +E  +  ++  W EDP  RP FN+IK  + +FNK+ +SGNILDNLL RMEQY+NNLE +V +RT+ YLEEKKKAE+LLY MLPKSVA  L++ + V AE +D VTI+FSDI GFTALS+ESTP++++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NG LHAREI+RMA++FL  I+ F I H+PD +LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIHIS  T ++L+  G F+ T RG +E+KGKG   TYWLHGE + IVDP+  +  L
Sbjct:  245 KILLERVGNKLAVVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIA--VIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHN-------EGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRRQFYDKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVK-EISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPVVSNGSL 1170          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A267GHM2 (Guanylate cyclase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024971g2 PE=3 SV=1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 483/936 (51.60%), Postives = 639/936 (68.27%), Query Frame = 3
Query:  864 QFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGG--AISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE----------TSEKIRNLVNHNCVKYQSKPI--HNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIY-KDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN-----MYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTA-----IHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFL 3593
            + L++ +GNK AV VLC DP +V  I++KA +L F NGEYVF NI LFSS   T  PW         N +A RAYR+L+++TL+ P + ++RNFS QVK +A  +YN+ Y ++ +N+FV  F+D V+LYA A+N T+ + G   I+NGSLI + M N TFEGI GTV+I+++GDR AD+S+LDMD  T  F  VAH+ G +  + +VP   +DW +  N+ P   P+CG+D SMC +    +   A+   ++    L    A   +YR ++L++EL+AMNW IPW  LE          TSE  ++L   +    QS+P   H  + + HQ R+ +++       N       E  +SK +R+  K+  +       + +S  S++TIAG+ L +I   QLFTKTA YKG +VALKP+ L  +RI++  +LL++VK+VKDL +D++ RFIGACL+   + +V +YCPKGSL+DVL  + + LDW+FK+SL+ DICRGM+YLH+N G  G LKSSNCLVDSRF LKI DFGL SLRG+K Y  +ED+        F + LWTAPELLR   PP +GT +GDVYSFAI+CQEI+YR+GVF +   D    QEIVE VK E S   +RP+L A         +E  +  ++  W EDP  RP FN+IK  + +FNK+ +SGNILDNLL RMEQY+NNLE +V +RT+ YLEEKKKAE+LLY MLPKSVA  L++ + V AE +D VTI+FSDI GFTALS+ESTP++++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NG LHAREI+RMA++FL  I+ F I H+PD +LKLRIGI+SGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIHIS  T ++L+  G F+ T RG +E+KGKG   TYWLHGE + IVDP+  +  L
Sbjct:  245 KILLERVGNKLAVVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIA--VIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHN-------EGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRRQFYDKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVK-EISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGINSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPVVSNGSL 1170          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A267EU15 (Guanylate cyclase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000254g5 PE=3 SV=1)

HSP 1 Score: 934.095 bits (2413), Expect = 0.000e+0
Identity = 483/936 (51.60%), Postives = 638/936 (68.16%), Query Frame = 3
Query:  864 QFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGG--AISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE----------TSEKIRNLVNHNCVKYQSKPI--HNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIY-KDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPI-LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN-----MYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTA-----IHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFL 3593
            + L++ +GNK AV VLC DP +V  I++KA +L F NGEYVF NI LFSS   T  PW         N +A RAYR+L+++TL+ P + ++RNFS QVK +A  +YN+ Y ++ +N+FV  F+D V+LYA A+N T+ + G   I+NGSLI + M N TFEGI GTV+I+++GDR AD+S+LDMD  T  F  VAH+ G +  + +VP   +DW +  N+ P   P+CG+D SMC +    +   A+   ++    L    A   +YR ++L++EL+AMNW IPW  LE          TSE  ++L   +    QS+P   H  + + HQ R+ +++       N       E  +SK +R+  K+  +       + +S  S++TIAG+ L +I   QLFTKTA YKG +VALKP+ L  +RI++  +LL++VK+VKDL +D++ RFIGACL+   + +V +YCPKGSL+DVL  + + LDW+FK+SL+ DICRGM+YLH+N G  G LKSSNCLVDSRF LKI DFGL SLRG+K Y  +ED+        F + LWTAPELLR   PP +GT +GDVYSFAI+CQEI+YR+GVF +   D    QEIVE VK E S   +RP+L A         +E  +  ++  W EDP  RP FN+IK  + +FNK+ +SGNILDNLL RMEQY+NNLE +V +RT+ YLEEKKKAE+LLY MLPKSVA  L++ + V AE +D VTI+FSDI GFTALS+ESTP++++ LLN LYT FD IIE YD YKVETIGDAYMV SGLP  NG LHAREI+RMA++FL  I+ F I H+PD +LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIHIS  T ++L+  G F+ T RG +E+KGKG   TY LHGE + IVDP+  +  L
Sbjct:  245 KILLERVGNKLAVVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFSQQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSLITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIA--VIYRKLRLESELHAMNWRIPWSELEPMERIAAGRRTSESGKDLQQQDEEPEQSRPHRHHQHRGQSHQKRTDSVRILFGNSHN-------EGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRRQFYDKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVK-EISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYCLHGEGDSIVDPVVSNGSL 1170          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 398/1030 (38.64%), Postives = 581/1030 (56.41%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQ--YKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETK--YPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSR-SQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSG 3323
            ++LPK  + +PW  P   PA+  ALEKV S P + P   +     + E  + +C ++   L   V       P    GP C Y  +P+AR    W +P+++ GA   GF     + + ++T  G  H  L  G+ + +    + W     +       +  P Y    G Y     E+T D    +   + E        D      LI+ I  +  V  +C    +  +++++  +      EYVF  I LF     ++   PW   A   +++  AK+A++S+  +T + P+N ++++F  ++K  A +E+N+  E  L+N     F+DGVLLY+HALN+++   G    G ++ K MWN TF G+ G V +D +GDR  DF++ DM D ++G ++ V+ +  +    ++ P + V W  +    P   P CG+ N       K + +  + + V   +F+I  +   F+YR +KL+ EL A  W + WE ++    I NL              +  ++   SR + +L+G+                          N+G             SL T+ G       N Q++ KT  YKGN+ A+K  ++++RI++ R++L ++K ++D+ N+H+ RFIGAC++     ++ +YCP+GSL+D++  E ITLDW+F+YSLI DI +GM +LHN+ +   G LKSSNCLVDSRFVLKITD+GL S R  + YL  ED++ Y+   LWTAPEL+R  N    GT KGDVYSF I+ QE+   KGVF LDS   FS +EIVE V AE      RP L      +E+   L+++ W+ED   RPDFN IK  + K N  G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTA+SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH  EIARM++A L A++ F I HRPD +L+LRIGIH+G
Sbjct:   52 IILPKQNTEYPWAWPRVGPALNWALEKVNSDPTLLPGYHMQLVFSSSENKEGLCSDSVAPLV-AVDLKFAHDPWAFIGPGCDYASSPVARFTTHWEVPMVTAGAPALGF-----NMYSSITNTGPTHKKL--GEFVVRMHHNFGWHKYAMVMFHDKKNDDRPCYFAVEGPYT----EMTADNITAKDMVFNEDDEPLSYAD------LINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPW---ARGDADDEAAKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYEIVSVYNSSAKQMVLEPGMKVHW--LKGSPPPDIPVCGFKNDNPACLAKTVTMHQMISIVACFIFIIIVTVTVFIYRKVKLENELAAQLWRVYWEDIQ----ISNL--------------DKALRRACSRLTLSLRGS--------------------------NYG-------------SLLTLEG-------NVQIYAKTCYYKGNITAIK-YVNKKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR-KESYL--EDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFYLDSPP-FSPKEIVEHV-AEGRWPYLRP-LLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHK-NNRGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTG 986          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 305/518 (58.88%), Postives = 397/518 (76.64%), Query Frame = 3
Query: 2010 NAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSL-TAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            N Q+F KTA +KGN+VA+K  ++++RI++ R++L ++K ++D+ NDH+ RFIGAC++     +V +YCP+GSL+D+L  E ITLDW+FKYSLI DI +GM +LHN+ +   G LKSSNC+VD+RFVLKITD+GL S R        ED++ Y+   LW AP+LLRMSNPP  GT KGD+YSF I+ QE+  R+GVF ++  D  S +EIV+ V     P   RP++ T  H  +E+   L+++ W E+P  RP+F+ IK  +RK N+E  S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIARM++A L A+  F I HRPD++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG P KIH+S ++  +L+ F  F +  RG +E+KGKG  +TYWL GE++
Sbjct:  561 NFQVFAKTAYFKGNIVAIK-YVNRKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESD---PEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPY-LRPTVNTQAH--SEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESK 1069          

HSP 2 Score: 196.438 bits (498), Expect = 1.269e-50
Identity = 136/506 (26.88%), Postives = 235/506 (46.44%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWT-HGIYIYHKTAYTNVIPLYCH-ALGGYLTQEFEITV---------DYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG--NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETS 1730
            ++LPK  + +PW  P   PAI  A++ V S P + P   +    ++ E  D IC E+  A    V       P    GP C Y  +P+      W +P+++ GA   GF  +R   + ++T  G  H  L  G+      + + W+ H + ++  +         C+ A+ G  T+  E+ +         D  P+  Y E                +  I  +  V  +C  P    ++++   + N    E+VFI I +F     ++   PW   A   +++  AK+AY+S+  +T + P+N ++++F   +K  A + +N+  +  L+N     FYDG++LY  ALN++LA+     +   I + MWN T+ G+ G V ID  GDR  DF++ DM D  +  F+ VA + GT+     +P ++  W      IP   P CG+ N       + + +  + + V+  + +I F+   F+YR +KL+ EL A  W I WE ++ S
Sbjct:   53 VILPKTNTSYPWAWPRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSES-IAPLMAVDLKFAHEPWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGF-SDRSDAYTSITNTGPTHKKL--GEFALHICRHFGWSQHALLMFGDSKMGE---RECYFAVEGLYTELKEVNITTVDLVFEEDSRPV-NYSEH---------------LQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPW---ARGDADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 530          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 305/518 (58.88%), Postives = 397/518 (76.64%), Query Frame = 3
Query: 2010 NAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSL-TAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            N Q+F KTA +KGN+VA+K  ++++RI++ R++L ++K ++D+ NDH+ RFIGAC++     +V +YCP+GSL+D+L  E ITLDW+FKYSLI DI +GM +LHN+ +   G LKSSNC+VD+RFVLKITD+GL S R        ED++ Y+   LW AP+LLRMSNPP  GT KGD+YSF I+ QE+  R+GVF ++  D  S +EIV+ V     P   RP++ T  H  +E+   L+++ W E+P  RP+F+ IK  +RK N+E  S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIARM++A L A+  F I HRPD++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG P KIH+S ++  +L+ F  F +  RG +E+KGKG  +TYWL GE++
Sbjct:  561 NFQVFAKTAYFKGNIVAIK-YVNRKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESD---PEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPY-LRPTVNTQAH--SEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESK 1069          

HSP 2 Score: 196.438 bits (498), Expect = 1.269e-50
Identity = 136/506 (26.88%), Postives = 235/506 (46.44%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWT-HGIYIYHKTAYTNVIPLYCH-ALGGYLTQEFEITV---------DYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG--NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETS 1730
            ++LPK  + +PW  P   PAI  A++ V S P + P   +    ++ E  D IC E+  A    V       P    GP C Y  +P+      W +P+++ GA   GF  +R   + ++T  G  H  L  G+      + + W+ H + ++  +         C+ A+ G  T+  E+ +         D  P+  Y E                +  I  +  V  +C  P    ++++   + N    E+VFI I +F     ++   PW   A   +++  AK+AY+S+  +T + P+N ++++F   +K  A + +N+  +  L+N     FYDG++LY  ALN++LA+     +   I + MWN T+ G+ G V ID  GDR  DF++ DM D  +  F+ VA + GT+     +P ++  W      IP   P CG+ N       + + +  + + V+  + +I F+   F+YR +KL+ EL A  W I WE ++ S
Sbjct:   53 VILPKTNTSYPWAWPRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSES-IAPLMAVDLKFAHEPWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGF-SDRSDAYTSITNTGPTHKKL--GEFALHICRHFGWSQHALLMFGDSKMGE---RECYFAVEGLYTELKEVNITTVDLVFEEDSRPV-NYSEH---------------LQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPW---ARGDADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 530          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 301/516 (58.33%), Postives = 386/516 (74.81%), Query Frame = 3
Query: 2010 NAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            N Q++ KT  YKGN+ A+K + +++RI++ R++L ++K ++D+ N+H+ RFIGAC++     ++ +YCP+GSL+D++  E ITLDW+F+YSLI DI +GM +LHN+ +   G LKSSNCLVDSRFVLKITD+GL S R  + YL  ED++ Y+   LWTAPEL+R  N    GT KGDVYSF I+ QE+   KGVF LDS   FS +EIVE V AE      RP L      +E+   L+++ W+ED   RPDFN IK  + K N  G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTA+SAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH  EIARM++A L A++ F I HRPD +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S++T  +L+ F  F +  RG IE+KGKG  +TYWL GE+
Sbjct:  541 NVQIYAKTCYYKGNITAIKYV-NKKRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFR-KESYL--EDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFYLDSPP-FSPKEIVEHV-AEGRWPYLRP-LLCTQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHK-NNRGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLGES 1048          

HSP 2 Score: 165.622 bits (418), Expect = 4.476e-41
Identity = 111/398 (27.89%), Postives = 190/398 (47.74%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQ--YKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETK--YPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFK 1433
            ++LPK  + +PW  P   PA+  ALEKV S P + P   +     + E  + +C ++   L   V       P    GP C Y  +P+AR    W +P+++ GA   GF     + + ++T  G  H  L  G+ + +    + W     +       +  P Y    G Y     E+T D    +   + E        D      LI+ I  +  V  +C    +  +++++  +      EYVF  I LF     ++   PW   A   +++  AK+A++S+  +T + P+N ++++F  ++K  A +E+N+  E  L+N     F+DGVLLY+HALN+++   G    G ++ K MWN TF G+ G V +D +GDR  DF++ DM D ++G ++
Sbjct:   29 IILPKQNTEYPWAWPRVGPALNWALEKVNSDPTLLPGYHMQLVFSSSENKEGLCSDSVAPLV-AVDLKFAHDPWAFIGPGCDYASSPVARFTTHWEVPMVTAGAPALGF-----NMYSSITNTGPTHKKL--GEFVVRMHHNFGWHKYAMVMFHDKKNDDRPCYFAVEGPYT----EMTADNITAKDMVFNEDDEPLSYAD------LINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPW---ARGDADDEAAKQAFKSVKIMTYREPQNPEYKHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYE 405          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 290/518 (55.98%), Postives = 377/518 (72.78%), Query Frame = 3
Query: 2010 NAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSL-TAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            N Q+F KTA +KGN+VA+K  ++++RI++ R++L ++K ++D+ NDH+ RFIGAC++     +V +YCP+GSL+D+L  E ITLDW+FKYSLI DI +GM +LHN+ +   G LKSSNC+VD+RFVLKITD+GL S R        ED++ Y+   LW AP+LLRMSNPP  GT KGD+YSF I+ QE+  R+GVF ++  D  S +EIV+ V     P   RP++ T  H  +E+   L+++ W E+P  RP+F+ IK  +RK N+E  S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ                       VETIGDAYMV SGLP  NG LHAREIARM++A L A+  F I HRPD++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMESNG P KIH+S ++  +L+ F  F +  RG +E+KGKG  +TYWL GE++
Sbjct:  580 NFQVFAKTAYFKGNIVAIK-YVNRKRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRTESD---PEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPY-LRPTVNTQAH--SEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNREV-SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQ-----------------------VETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGESK 1065          

HSP 2 Score: 195.667 bits (496), Expect = 1.774e-50
Identity = 136/506 (26.88%), Postives = 235/506 (46.44%), Query Frame = 3
Query:  270 LMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWT-HGIYIYHKTAYTNVIPLYCH-ALGGYLTQEFEITV---------DYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG--NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETS 1730
            ++LPK  + +PW  P   PAI  A++ V S P + P   +    ++ E  D IC E+   L   V       P    GP C Y  +P+      W +P+++ GA   GF  +R   + ++T  G  H  L  G+      + + W+ H + ++  +         C+ A+ G  T+  E+ +         D  P+  Y E                +  I  +  V  +C  P    ++++   + N    E+VFI I +F     ++   PW   A   +++  AK+AY+S+  +T + P+N ++++F   +K  A + +N+  +  L+N     FYDG++LY  ALN++LA+     +   I + MWN T+ G+ G V ID  GDR  DF++ DM D  +  F+ VA + GT+     +P ++  W      IP   P CG+ N       + + +  + + V+  + +I F+   F+YR +KL+ EL A  W I WE ++ S
Sbjct:   72 VILPKTNTSYPWAWPRVGPAIDHAMKLVNSNPSLLPGYSLQFVFESSENTDGICSESIAPLM-AVDLKFAHEPWAFIGPGCDYTSSPVGLFTTHWGLPMITAGAPAVGF-SDRSDAYTSITNTGPTHKKL--GEFALHICRHFGWSQHALLMFGDSKMGE---RECYFAVEGLYTELKEVNITTVDLVFEEDSRPV-NYSEH---------------LQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPW---ARGDADDELAKKAYQSVKILTYREPQNPEYKDFVMDLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWP--GGFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDMQMS 549          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 312/536 (58.21%), Postives = 401/536 (74.81%), Query Frame = 3
Query: 1959 SCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLE-DVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGC-TEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            SC SL T  G N       Q+F KT  Y+GN+VA+KPI ++++I++ R++L ++K ++D+ N+H+ RF+GAC++     +V +YCP+GSL+ D+L  E ITLDWVF+YSLI DI +GM++LHN+ +G  G+LKSSNC+VDSRFVLKITD+GL S R   +    ED +  +   LWTAPELLR+ +PP  GT KGDVYS  I+ QEI  R G F ++  D  S +EIV+ VK    P  FRPS      C  E+  LL+++ W EDP  RPDF+ IK  + KFNKE +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQ++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG L+A+EIARM++A L A+  F I HR + +LKLRIGIH+GPVC+GVVGLKMPR+CLFGDTVNT+SRMESNG   KIH+SQ+T ++L  FG F +  RG +E+KGKG  +TYWL GE E
Sbjct:  303 SCGSLLTTQGRN-------QMFAKTGYYRGNLVAIKPI-NKKKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSCSEC---EDMHSLYAKKLWTAPELLRLEHPPPQGTQKGDVYSLGIILQEIALRNGTFYVEGMD-LSPKEIVQKVKNGQRPY-FRPSTD--ESCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNKE-NSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGEIE 822          

HSP 2 Score: 177.178 bits (448), Expect = 8.298e-46
Identity = 93/291 (31.96%), Postives = 156/291 (53.61%), Query Frame = 3
Query:  897 AVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSG------NETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETS--EKIR 1742
            +V   C   A   + +++A       G+YVF  +  FS        +E++ PW         + +AK AY++++ ++ + P+N ++++F  ++K+ A  ++N+  E  L+N    +FYD +++Y  ALNKTL+ GG + +G  I K+MWN T+ G+ G  TID +GDR  DFS+ D+ D  TGEF  V  + G  S  + VP + + W   S  IP   P CG++N  C       +   +   V   + LI   + + +YR +KL+ EL +M W + WE+++ S  EK R
Sbjct:    5 SVVYFCCSAAVFRQTMVQAHAEGMTAGDYVFFYVDPFSESLSESNVSESRKPW---KRGDEFDEQAKEAYKAVMIISYREPQNIEYKDFVVKLKKRAKEQFNFTIEDTLMNLIAGSFYDAIMMYTAALNKTLSSGGGVHDGHAITKHMWNRTYRGVTGEFTIDRNGDRETDFSLWDLTDMNTGEFNVVLSYDGASSKLIEVPGLEIQWPGGS--IPKDVPLCGFENEAC--ISGGFSTMEVLMIVFSLILLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKAR 288          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 280/511 (54.79%), Postives = 382/511 (74.76%), Query Frame = 3
Query: 2043 KGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGD------SGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            +GN+V + P +++++I++ RQ+L ++K ++D+ N+H+ RF+GAC+++    ++ +YCP+GSL+D+L  E I+LDW+F+YSL+ DI +GM+YLH++ +G  G LKSSNC+VDSRFVLKITD+GL S+R   +    + S  YF+  LWTAPELLR+      GT KGDVYSFAI+ QEI  R G F L++ +  +A+EIV+ VK    P   RP++    G +E+   L+++ W E+   RPDF+ IK  ++KF+ + D      +  ILDNLLSRMEQYANNLE++V+ERT+ YLEEK KAE LLY +LP SVA QL + + V AE++D VTI+ SDIVGFTA+SA+STPMQ++  LN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG  HA E+ARMA+A LSA+ CF I HRP + L LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRME+ G  H+IH+S +T  +L  +G F++   G +++KGKG+ +TYWL GEN
Sbjct:    1 QGNLVEI-PFINRKKIELTRQMLFELKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSK---ADSSANYFEKRLWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLEA-NHLTAKEIVQRVKLGEWPY-LRPTVDP-GGHSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 472.241 bits (1214), Expect = 6.035e-152
Identity = 307/799 (38.42%), Postives = 434/799 (54.32%), Query Frame = 3
Query: 1227 FYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTT---FEGIGGTVTIDSSGDRIADFSILDMDPK---TGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPK-PDKNLNIGAISAGVMGCLFLISFSA--GYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTR-NEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDI--NRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNM--YFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDD-------FSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
             +D  +LYA A+ + L  GG   +G  +I+ +  +    F G  G V+ID +G+R  D+++ D+  K   TGE +  +    T  +    P      G      PS  P CG+   +C + P    ++  +  G +  L +I   A   Y V ++  LQ            ES++T+    N  +   V     P+ N     ++S S+ + G + N   ++H    VE P                                                 +Y+GN VALK +      D+  NR  L    K++++ ++++  F G C+E+    +V  YC KGSL+DVL      LDW+FK S   DI  GM++LH +  PI   G LK S CL+DSR  +K+T FG+   R  K+    + +N+  +F  L WTAPELLRM + P++GT KGDV+SFAI+ +E++Y         ED+          ++I++ V+   +  P RP LT    C      LI+Q W+E    RPDF+++   +R  + EGD  NILDN++S++E+YAN+LE++V +RT Q   EKKK + LL S+LP  V  QL   + V  E Y+LVTIFF DIVGFTA+SA STP+++I+LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EIA M++ FLS+I  F I H P ++LKLRIGI+SGPV +GVVG  MPRYCLFGDTVN +SRMES G P  IH+S++T  LLK  G + + ERG I +KGKG+  TYWL G+
Sbjct:    4 LHDAGILYAMAVRELLRQGGNPRDGRAVIRTIRGSNKIKFYGASGQVSIDVNGERFLDYAVFDLQKKQTATGEMRIASKRYFTFQTINFTPEYQ-KMGWPDGRPPSDMPECGFTGELCQEAPISEPDLALVLVGSILSLIVIGTVAFLTYLVVQSRSLQ------------ESMDTTWWKINFEDITLV-----PLVNGS---YRSSSKQVSGNQSNVHHDVHGTDRVEIP-----------------------------------------------IGIYQGNQVALKFLERTHPPDLKSNRFAL----KMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKS--PIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINNLGSFFIELYWTAPELLRMEDLPVNGTPKGDVFSFAILMREVIYH--------EDEGPYVGIHLEPKDIIDQVRDGIAVPPLRPLLT--ERCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGDM-NILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 432.565 bits (1111), Expect = 5.634e-138
Identity = 239/492 (48.58%), Postives = 323/492 (65.65%), Query Frame = 3
Query: 2103 QLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLR-GSKQYLL----EEDS-NMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            ++ I + +++++ ++++  F G C+E+    +V  YC KGSL+DVL      LDW+FK S   DI  GM++LH +  PI   G LK S CL+DSR  +K+T FG+   R G K   L    +ED+  +  K L WTAPELLRM + P++GT KGDV+SFAI+ +E   R+   +  + +     +I++ V+   +  P RP LT    C      LI+Q W+E    RPDF+++   +R  + EG   NILDN++S++E+YAN+LE++V +RT Q   EKKK + LL S+LP  V  QL   + V  E Y+LVTIFF DIVGFTA+SA STP+++I+LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EIA M++ FLS+I  F I H P ++LKLRIGI+SGPV +GVVG  MPRYCLFGDTVN +SRMES G P  IH+S++T  LLK  G + + ERG I +KGKG+  TYWL G+
Sbjct:  142 EIPIGIYQMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKS--PIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWPTATRA-NRVPFPDIIDQVRDGIAVPPLRPLLT--ERCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 445.277 bits (1144), Expect = 1.039e-137
Identity = 243/522 (46.55%), Postives = 341/522 (65.33%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDI-NRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRK------GVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            ++FT   +Y+GN VALK +   R  D+ ++ LL +++ +++L ++++  F G C+E+    +V  YC KGSL+DVL      LD +FK S   DI  GM++LH +  PI   G LK S CL+DSR  +K+T FG+   R  K+  + + +N     L WT+PELLRM   P++GT KGDV+SF ++ +E++Y +      GV       D   +EI++ V+      P RP LT    C      LI++ W+E P  RPDF++I   +R  + EG   +ILDN++S++E+YAN+LE++V++RT Q   EKKK + LL S+LP  V  QL   + V  E ++ VTIFF DIVGFTA+SA S+P+++I LLN LY   D II+ YDVYKVETIGDAYMV SGLP  NG  H  EI+ M++ FLS+I  F I H P ++LK+RIG++SG V +GVVG  MPRYCLFGDTVN +SRMES G P +IH+S+ST  LLK+ G + + ERG I++KGKGS  TYWL+G+
Sbjct:  543 KMFTPLGIYQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKS--PIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRHGKKGKIMDVNNQDIAELFWTSPELLRMEIFPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGV-------DMEPKEIIDQVREGKCSPPLRPLLT--ERCEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHR-SILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGK 1052          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 60.8474 bits (146), Expect = 9.375e-10
Identity = 69/314 (21.97%), Postives = 137/314 (43.63%), Query Frame = 3
Query: 2037 LYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISL---RGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQ 2969
            ++    VA   I S++     ++LL +++  K +++ +I +FI    +    Y++ + CP GSL ++L + ++  +   ++   Q IC  + Y+H+       LK  N   DS + LKI DFGL ++      ++Y +    N       + APE+L   +     +F+ D++S  ++   ++  K  F            I E +K  +   P    +      +++  +LI+   + DP+ RP    I  ++         G    ++ S +   A N EDI +E++    ++  +   LL SM    +  Q
Sbjct:  106 IFAAKTVAKASIKSEK---TRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQ-ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPN-------YIAPEVLMGKHS--GHSFEVDIWSLGVMLYALLIGKPPFQAR-----DVNTIYERIKCRDFSFPRDKPI------SDEGKILIRDILSLDPIERPSLTEIMDYV------WFRGTFPPSIPSTVMSEAPNFEDIPEEQSLVNFKDCMEKSLLLESMSSDKIQRQ 389          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 60.077 bits (144), Expect = 2.161e-9
Identity = 50/182 (27.47%), Postives = 83/182 (45.60%), Query Frame = 3
Query: 2136 LNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQD---------ICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAE 2654
            L + HICR    C    + YM+++Y   G L          LD++ ++  I++         I   ++YLH N      LK  N ++     +KI DFGL ++  S++ L     + +  +L + APELL+ +  P  G  + DV+SF +V   +V   G    D E+     E ++  K E
Sbjct:  201 LYHPHICRLFEMCTLSNHFYMLFEYVSGGQL----------LDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQL-----HTFCGSLYFAAPELLKAN--PYTGP-EVDVWSFGVVLFVLVC--GKVPFDDENSSVLHEKIKQGKVE 362          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 56.9954 bits (136), Expect = 1.523e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 3
Query: 2127 VKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICR----GMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSP 2663
            +K+L++++I  + GA  E G   +  +Y P GS+  +L          F+ SLI +  R    G+ YLH        +K +N L+D +  +KITDFG IS + S     +        ++ W +PE+++ +      T K D++S   V  E+   K  F      DFS  + +  +    +P
Sbjct:  508 LKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNY-----GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFG-ISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTAT----TAKADIWSTGCVVIEMFTGKHPFP-----DFSQMQAIFKIGTNTTP 675          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 55.8398 bits (133), Expect = 4.097e-8
Identity = 49/171 (28.65%), Postives = 79/171 (46.20%), Query Frame = 3
Query: 2136 LNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVK 2648
            L + HICR    C    + YM+++Y   G L D + +   +L         + I   + YLH N      LK  N ++ S   +KI DFGL ++   ++ L     + +  +L + APELL+    P  G  + D++SF IV   +V  K  F     DD ++  + E +K
Sbjct:  180 LYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHG-SLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQL-----HTFCGSLYFAAPELLKAQ--PYTGP-EVDIWSFGIVLYVLVCGKVPF-----DDENSSILHEKIK 336          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 54.6842 bits (130), Expect = 9.720e-8
Identity = 36/153 (23.53%), Postives = 76/153 (49.67%), Query Frame = 3
Query: 2040 YKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELL 2498
            +   VVA+K ++ +   ++N  ++ ++  +K+LN+++I ++ G   +    Y++ +YC  GSL  ++++    L      + +     G+ YLH        +K++N L+ +   +K+ DFG+ ++  S    L    N       W APE+L
Sbjct:   46 HTDQVVAIKEVVYENDEELN-DIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTLN-------WMAPEIL 190          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 506.908 bits (1304), Expect = 4.283e-167
Identity = 257/494 (52.02%), Postives = 352/494 (71.26%), Query Frame = 3
Query: 2073 LSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHN-NLGPIGTLKSSNCLVDSRFVLKITDFGLISLRG-SKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKF-NKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAI-FCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWL 3542
            L +R IDI+RQLL+++K+++D+ +D++ +FIGAC+      +V  YC +GSL+D+L  + + LD VF  SL+ DI +GM YLHN ++   G LKSSNCLVDSR+VLKITD+GL  LR  SK+  +E +    +++LLW APE+LR+ + P  GT KGDVYSF+I+ QE   R G +S +       + I+E V+    P P+RP +  +    E+   L+KQ W EDP LRPDF  IK  +R+  +K G   NI DN+++ ME YA+NLE++V +RT+Q ++EK+K + LL S+LP+ VA QL K + V AES++ VTI+FSDIVGFT+LSAESTPMQ++  LN LYT FD II+ YDVYKVETIGDAYMV SGLP  NG  HA EIA+MA+  + A+   F++ H+P+ +L+LR+G H+GPV +GVVG  M RYCLFGDTVNT+SRMESNG P +IHISQ T  +L   GTF++  RG + +KGKG+ +T+WL
Sbjct:    8 LPKRTIDISRQLLLEMKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIETN----WRDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPYSANY---MEPKAIIEKVRKSEFP-PYRPIVANLIDGAEELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWL 493          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 504.982 bits (1299), Expect = 6.564e-167
Identity = 272/523 (52.01%), Postives = 358/523 (68.45%), Query Frame = 3
Query: 2004 IQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN--MYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAI--HGCT-EDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            I   Q+FT   +YK N+VA+K I ++R+I++ R++  ++K ++ + ++++  F GAC+E     ++  YCPKGSL+D+L  E I LD +F  SL+ DI +GM YLH+  +   G LKS NC+VD R+VLKITD+GL   + S Q + EE+    MY++ L WTAPELLR ++P   GT KGDVYSF I+ QE++ R G F L    +    +I+E V    SP PFRP L+ I   G T    V L K  W E+P  RPDF  I+  +RK    G   NI+DN+++ +E+YANNLE +V+ERT Q  +EK+K E+LL  MLP SVA  L+  + V AE++D V+IFFSDIVGFT+LS+ESTP+Q++DLLN LYT FD II NYDVYKVETIGDAYMV SGLP  NG+ HA EIA MA+  L  I  F I HRP+ +LKLRIGIHSG   +GVVG KMPRYCLFGDTVNT+SRMESNG   KIHIS ST ++L   G + + +RG + +KGKG+  TYWL G +
Sbjct:    2 INQRQIFTTVGIYKSNMVAIKRI-NKRQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFK-SNQDISEEEGEYAMYYRKL-WTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPFDLSYYTN-EPSDIIEKVTRVESP-PFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKL-PMGKQSNIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 407.527 bits (1046), Expect = 9.242e-130
Identity = 227/516 (43.99%), Postives = 324/516 (62.79%), Query Frame = 3
Query: 1899 LSRNNSKNFGN--PIYKDLDLISCASLETIAGINLDKIQNAQLF---TKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLH-NNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELL---RMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGL 3419
            LSR+   N+ +  P+  D    S     +++G   D   +  LF    + +  K  +VALK +L +  + + R +LI++K+V+D+ + ++  +IG C       +V  YC +GSL+++LA ++I+LDW F+ S   DI  GM  +H +++   G L+SS CL+DSR+V K+ DFGL  L+ +++   E   +  +  L W APELL   + +N P+  T  GDVYSF I+  E++ R+  ++     +F+  E++E ++   +P PFRP  T           L+ Q WN+DP  RP F+ IK  +R    +G   +I+DN+L  ME Y   LE IV ERT Q  +EK K ++LLY MLP+ +A  L + +PV AESY  VTIFFSDIVGFT L+A STP+Q++DLLN LYT FD+II+ +DVYKVETIGDAYMV SGLP  NG+ HA EIA MA+  LS++  F   H P++ + LRIGIH+G   +GVVGLKMPRYCLFGDTVN +SRMES G+
Sbjct:   13 LSRSWIINYDDIQPVNMDTRFASKVRYSSVSGNMCDYSISLALFPWFCEHSFIKSYLVALK-MLRKDSLTLTRDMLIEMKQVRDVQHTNLLHYIGVCTTPPNICIVSQYCHRGSLQEILANDEISLDWFFRESFANDIAMGMHVIHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLNLLKANQRPDPEIGVHAQYSRLFWRAPELLQNEKSTNKPVP-TQMGDVYSFGIILNELLTREEPYA---TTEFAPIEVIERIRCHLNP-PFRPE-TPFEIRNRSVTKLMTQCWNDDPQARPTFSDIKRQLRLL--KGGKSSIVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHDVYKVETIGDAYMVVSGLPVRNGHRHAGEIATMALNLLSSMGNFRARHLPNRPIHLRIGIHTGSCVAGVVGLKMPRYCLFGDTVNYASRMESTGV 519          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 400.979 bits (1029), Expect = 1.713e-128
Identity = 209/434 (48.16%), Postives = 288/434 (66.36%), Query Frame = 3
Query: 2235 VLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPI---GTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLD---GTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAI--HGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVK 3512
            +L  + I LDW+F+ S   DI  GM  +HN+  PI   G LKSSNCL+DSR+  KITD+GL  LR + Q   +      ++NL WT PELL +++   D    T  GDVYS+ IV  EI+ R   +S ++ D  S+++++E V+    P  FRP  +           V + +  W+ D   RP F+ IK  + K N  G + NI+DN+++ M +Y + LEDIV+ERT+Q  EEK K ++LLY MLP+ +A +L K  PV+AES+  VTIFFSDIVGFT+++A+STP+Q++DLLN+LYT FD +++ +DVYKVETIGDAYMV SGLP  NG  HA E+A MA+  LS +  F IPH P ++++LRIGIHSG   +GVVGLKMPRYCLFGDTVN +SRMES+GL  +IH+S    ++L   G + + ERG + +K
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNS--PIQAHGNLKSSNCLIDSRWACKITDYGLDLLRAN-QTPKDIGEFAVYRNLFWTVPELLPLADGFKDHKNKTQAGDVYSYGIVLYEIITRDEPYSTNT-DTLSSKDVIELVRKRQEP-AFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKL-KANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 392.889 bits (1008), Expect = 1.126e-124
Identity = 231/489 (47.24%), Postives = 291/489 (59.51%), Query Frame = 3
Query: 2127 VKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLH-NNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQ-YLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELK-----------LRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            V  L++ +I  +IG C+      +V + C +GSL DVL  + I LDW FK S   DI  GM  LH + +   G L SSNCLVD  +V KI D+GL   R SK  Y  EE         LW APE +R  N    G+  GDVYSF ++  EIV R   F    E   +   I+  + +   P P RP+L A   C       IKQ W+E+P  RP F  IK  MRK N  G S  ++D++L +M+ Y+NNLE +V+ERT Q   EK K + LLY MLP+ VA QL   + V AE +D VT+FFSDIVGFT LS+ STP+Q++  LN LYT FD+II NYDVYKVETIGDAYMV SGLP+ N + HA EIA MA+  L  I  F I H PD  L            L   I SGP  +GVVG+K PRY +FGDTVN +SRMESNG+P++IHIS    + L   G + M  RG IE+KGKG   TY+L+G++
Sbjct:    2 VHKLSHVNINPYIGVCITAPNICIVSEACGRGSLADVLINDDIKLDWTFKMSFATDIAAGMEALHASEVSFHGNLTSSNCLVDRMWVCKIADYGL--QRFSKHTYEPEEQLTGQTGKSLWMAPEHMR--NASSTGSQPGDVYSFGVILSEIVTRCEPF----ETLRATTSILRRIMSTEFP-PLRPTLNA-DDCDPTITKFIKQCWSEEPSARPTFRDIKKSMRKING-GRSLRLVDSMLGKMDIYSNNLEVLVEERTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFLNDLYTYFDNIIPNYDVYKVETIGDAYMVVSGLPEKNRDRHAGEIATMALHLLCDIRTFKIRHVPDTRLVSSYSLLLIITCLFYLIFSGPAVAGVVGIKKPRYDVFGDTVNVASRMESNGVPNRIHISAECRKALLNLGGYHMERRGEIELKGKGKVITYFLNGKD 479          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 446/1120 (39.82%), Postives = 645/1120 (57.59%), Query Frame = 3
Query:  273 MLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNPIVK---SLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIY---------HKTAYTNVIPLYCHALGGYLTQEFEITV-DYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFS---SGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGG------AISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            +LP   + +PW  P   PA+  A++ V S P++ P +K      + E  +  C ++   L   V   ++  P    GP C Y  +P+AR    W++P+++ GA   GF     S+F  +T  G  H  L  G+   K  + + W H   +           +T Y  +  LY       L  +  ITV DY+                    + L+  I     V  LC    ++  ++++  +   +   YVF  I LF+    G +   PW+       ++  A+ A+RS+  +T   P+N ++  F + +K+ A + +N+  +  L N     FYDGV+LY+ ALN+TL+             G ++ + MWN TF+G+ GTV +D  GDR  DF++ DM D  +G+F+ V  +  +    ++   ++  W   S   P   P CG+ N         + +  + A V+  +F+I  +   F+YR +KL+ EL A  W + W  ++ S  +  ++   C          S++ +      ++KG+                          N+G             SL T+ G       N Q++TKT  YKGN+VA+K I +++RI++ R +L ++K ++D++N+H+ RFIGAC++     ++ +YCP+GSL+D++  E +TLDW+F+YSLI DI +GM +LHN+ +   G LKSSNC+VDSRFVLKITD+GL SLR S      +D++ Y+   LWTAPELLR  +PPL GT KGDVYSF I+ QE+   KGVF +D+      +EI++ V     P   RPSL   H  +E+  +L+++ W E+P  RPDFNTIK  +RK ++ G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH RE+ARMA+A L A+  F I HRP ++L+LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES G   KIH+S++T Q+L+ F TF +  RG IEVKGKG  +TYWL GE+
Sbjct:   35 ILPLTNTDYPWAWPRVAPALYRAVDSVNSDPHLLPGLKLQLVHGSSENREGFCSDSAAPLV-AVDLKLSHDPWAFIGPGCDYSSSPVARFTTHWDVPMVTAGARADGF-----SKFAAVTNTGPTHKKL--GEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCYFAIEGLYS------LMGKHNITVFDYF-------------VESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWF---RGDQDDHAARLAFRSVKVLTYMEPQNAEYHQFVETLKKDAEKMFNFTIKDSLYNLIAGGFYDGVMLYSRALNETLSKRKPGLRPVQRPKGDMVTQRMWNRTFQGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVVCVYNSSIKELVLQKGLNFQWPGGSP--PLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMS-NLDKVLRRAC----------SRLTI------SMKGS--------------------------NYG-------------SLMTMEG-------NLQIYTKTGYYKGNLVAIKYI-NKKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS---CPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHT-LIPKEIIQGVIRGGVP-LLRPSL-CFHSHSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHR-GYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGED 1051          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 427/1114 (38.33%), Postives = 610/1114 (54.76%), Query Frame = 3
Query:  273 MLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNPIVK---SLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIY---------HKTAYTNVIPLYCHALGGYLTQEFEITV-DYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFS---SGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGEN 3554
            +LP   + +PW  P   PA+  A++ V S P++ P +K      + E  +  C ++   L   V   ++  P    GP C Y  +P+AR    W++P+++ GA   GF     S+F  +T  G  H  L  G+   K  + + W H   +           +T Y  +  LY       L  +  ITV DY+                    + L+  I     V  LC    ++  ++++  +   +   YVF  I LF+    G +   PW+       ++  A+ A+R        +     F +FS          YN      L  T     +  + + +  +                    W     G+ GTV +D  GDR  DF++ DM D  +G+F+ V H         +   ++  W   S   P   P CG+ N         + +  + A V+  +F+I  +   F+YR +KL+ EL A  W + W  ++ S  +  ++   C          S++ +      ++KG+                          N+G             SL T+ G       N Q++TKT  YKGN+VA+K I +++RI++ R +L ++K ++D++N+H+ RFIGAC++     ++ +YCP+GSL+D++  E +TLDW+F+YSLI DI +GM +LHN+ +   G LKSSNC+VDSRFVLKITD+GL SLR S      +D++ Y+   LWTAPELLR  +PPL GT KGDVYSF I+ QE+   KGVF +D+      +EI++ V     P   RPSL   H  +E+  +L+++ W E+P  RPDFNTIK  +RK ++ G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LH RE+ARMA+A L A+  F I HRP ++L+LRIG+HSGPVC+GVVGLKMPRYCLFGDTVNT+SRMES G   KIH+S++T Q+L+ F TF +  RG IEVKGKG  +TYWL GE+
Sbjct:   35 ILPLTNTDYPWAWPRVAPALYRAVDSVNSDPHLLPGLKLQLVHGSSENREGFCSDSAAPLV-AVDLKLSHDPWAFIGPGCDYSSSPVARFTTHWDVPMVTAGARADGF-----SKFAAVTNTGPTHKKL--GEFSLKIQETFGWHHHTMLIFSDNKDDNDERTCYFAIEGLYS------LMGKHNITVFDYF-------------VESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWF---RGDQDDHAARLAFR--------VRHPSIFNSFS---------VYN------LSTTITPQSFMQIKMCSEPV--------------------WCVVSAGVMGTVEMDKFGDREIDFALWDMTDINSGKFE-VKH---------LPKGLNFQWPGGSP--PLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMS-NLDKVLRRAC----------SRLTI------SMKGS--------------------------NYG-------------SLMTMEG-------NLQIYTKTGYYKGNLVAIKYI-NKKRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRTSS---CPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDTHT-LIPKEIIQGVIRGGVP-LLRPSL-CFHSHSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHR-GYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGED 992          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 297/517 (57.45%), Postives = 391/517 (75.63%), Query Frame = 3
Query: 2010 NAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENE 3557
            N Q+F KT  YKGN+VA+K   +++RI++NR++L ++K ++D+ N+H+ RFIGAC++     ++ +YCP+GSL+D+L  + ITL+W+FK+SLI DI +GMV+LHN+ +   G LKSSNC+VD+RFVLKITD+GL + R  ++  +  DS+ Y+   LW APELLRM NPP  GT KGDVYSF+I+ QE+  R+G F LD  D  S +EIV+ V   + P   RPS+      + +   L+++ W E+P  RPDFN I+  +RK NKE  + NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D V+I+FSDIVGFTALSAESTPM+++ LLN LYT FD++I+N+DVYKVETIGDAYMV SGLP  NG LH REIARMA+A L  +  F I HRP+++LKLRIGIHSGPVC+GVVGLKMPRYCLFGDTVNTSSRMES+G   KIH+S +T  +L  F +F +  RG I++KGKG   TYWL GE++
Sbjct:  552 NLQVFAKTGYYKGNIVAIK-YTNKKRIELNRKVLFELKHMRDVQNEHLTRFIGACVDPPNICIITEYCPRGSLQDILENDSITLEWMFKFSLINDIVKGMVFLHNSVIFSHGKLKSSNCVVDNRFVLKITDYGLSTFR--QESDVGSDSHSYYAQKLWMAPELLRMENPPPQGTQKGDVYSFSIILQEVALRRGAFYLDG-DPLSPKEIVDRVILGDWPC-LRPSIDP-QSHSPELGQLMQRCWAEEPTERPDFNHIRLLLRKHNKESRT-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWLLGESD 1061          

HSP 2 Score: 196.823 bits (499), Expect = 7.359e-51
Identity = 137/504 (27.18%), Postives = 233/504 (46.23%), Query Frame = 3
Query:  237 KRPDRIYPLAMLMLPKNFSMFPW--PLTIPAIKIALEKVKSMPYMNP---IVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETS 1730
            +RP +   LA++ LP+  + +PW  P   PA++ A+ K+ S P + P   +    K+ E  + IC E+   L   V       P    GP C Y  +P+      W++P+++ GA    F       + T+T  G  H  L  G+   +  + + W   + +       +  P Y  A+ G   +   I +        ++             Q L D I N   V  +C  P    R++++  + +  + +YVF+ I LF+     K PW   A    +++ AK A++S+  ++ + P+N++++ F   +K  A   +NY  +  L+N     FYDG++LYAHALN+T    GA   G LI   MWN TF G+ G + +D SGDR  DF++ D+ D  +  F+ V  +   +     VP  SV W  +    P   P+CG+ N       K + I  + +  +  +F ++ +   F+ R +KL+ EL A  W I W+ ++ S
Sbjct:   39 ERPRQNITLAII-LPETNTAYPWAWPRIGPALERAIIKINSDPNLLPNHHLTYVFKSSENSNGICSESVAPLV-AVDLEFAYKPWAFIGPGCSYTASPVGLFTTHWDVPLITAGAPAIAFLD---GIYPTITNTGPTHKKL--GRFALRICEHFGWREYVTLMFSDNKEDDRPCY-FAMEGLYEELKSINI------SLQDSVFEENKPPINYSQILAD-IQNIGRVMFVCCSPDVFRRLMIEFWKADLPHEQYVFLYIDLFAVSLSNKQPW---ARGDQDDTIAKDAFQSVKILSYREPQNQEYQQFVRDLKADAKTSFNYSVQDSLMNIIAGGFYDGLMLYAHALNETALVPGARPPGKLISGKMWNRTFHGVTGLLHLDVSGDRETDFALWDLVDTNSSSFQIVVVYNSFEEQVTPVPGTSVRW--LGGARPLDVPKCGFKNDNPACLTKTITIHQMVSITLFFIFTMTLTIAIFICRKMKLEKELVAQLWRISWDDIQMS 522          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 297/513 (57.89%), Postives = 386/513 (75.24%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            QLF KT  +KGN+VA+K + +++RI++ RQ+L+++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  E I LDW+F+YSLI DI +GM +LHN+  G  G LKSSNC+VDSRFVLKITD+GL S R S +    +DS+  +   LWTAPELL   + P  GT KGDVYSF I+ QEI  R G F ++S D  S +EIV+ V+    P  FRP+ T     +E+  +L++  W EDP  RPDF  IK +M K NKEG S +IL+NLLSRMEQYANNLE++V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIA M++A L  +  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T ++L  F  F +  RG +E+KGKG  +TYWL GE
Sbjct:  492 QLFAKTGYFKGNLVAIKHV-NKKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMD-LSPKEIVQKVRNGQRPY-FRPT-TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGE 996          

HSP 2 Score: 118.242 bits (295), Expect = 2.415e-26
Identity = 71/227 (31.28%), Postives = 120/227 (52.86%), Query Frame = 3
Query: 1062 ENSRAKRAYR---SLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            EN R+K  ++   S+  +T   P+N ++++F  ++   A R++  + E  L++    +FYDG +LYA AL++TLA+GGA +NG  I +   N +F G+ G V+ID    R  D  +  M + +TGE+  V+++ G+    +      + W S     P   P C +  D+  C      L I A+ +G+   +F IS    + +YR +KL+ EL  M W + WE L+
Sbjct:  236 ENGRSKFTHQYDTSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCGP--PLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFGIS---SFLIYRKLKLEKELAGMLWRVQWEDLQ 457          

HSP 3 Score: 73.9442 bits (180), Expect = 8.226e-13
Identity = 57/198 (28.79%), Postives = 86/198 (43.43%), Query Frame = 3
Query:  264 AMLMLPKNFSMFPW--PLTIPAIKIALE----KVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY--LTQEFEITVDYWPI---RQYKE 824
            A +MLP N+  +PW  P   PA+ +A E    K K +      + +  T  P        + A    V   +   PDV FGP C Y LA + R ++ W +P+++ G   YGF  E+  E+KT+ RIG       LG  +     ++ WT    +       +  P Y  + G +  L  E  +TV   P    + YKE
Sbjct:   36 AAVMLPDNYHKYPWALPRVFPALLMAQEDLHTKHKLLLGHTITILNYSTENPAAPGSCAESRAQVVVVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGF--EKLDEYKTIVRIGPSTTK--LGAFVNVLHTQFNWTSRAVVIFYDLKQDDRPHYFLSEGIFMNLKDEMNMTVSARPYTNEQDYKE 229          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 297/513 (57.89%), Postives = 386/513 (75.24%), Query Frame = 3
Query: 2016 QLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNN-LGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGE 3551
            QLF KT  +KGN+VA+K + +++RI++ RQ+L+++K ++D+  +H+ RFIGAC++     +V +YCP+GSL+D+L  E I LDW+F+YSLI DI +GM +LHN+  G  G LKSSNC+VDSRFVLKITD+GL S R S +    +DS+  +   LWTAPELL   + P  GT KGDVYSF I+ QEI  R G F ++S D  S +EIV+ V+    P  FRP+ T     +E+  +L++  W EDP  RPDF  IK +M K NKEG S +IL+NLLSRMEQYANNLE++V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTP+Q++ LLN LYT FD+II+N+DVYKVETIGDAYMV SGLP  NG LHAREIA M++A L  +  F I HRP+ +L+LRIGIH+GPVC+GVVGLKMPRYCLFGDTVNT+SRMESNG   KIH+S +T ++L  F  F +  RG +E+KGKG  +TYWL GE
Sbjct:  544 QLFAKTGYFKGNLVAIKHV-NKKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRSSCE---NDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMD-LSPKEIVQKVRNGQRPY-FRPT-TDSRFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNKEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGE 1048          

HSP 2 Score: 176.792 bits (447), Expect = 1.661e-44
Identity = 135/502 (26.89%), Postives = 227/502 (45.22%), Query Frame = 3
Query:  264 AMLMLPKNFSMFPW--PLTIPAIKIALE----KVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGY--LTQEFEITVDYWPI---RQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGE-YVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDM-DPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGY--DNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLE 1724
            A +MLP N+  +PW  P   PA+ +A E    K K +      + +  T  P        + A    V   +   PDV FGP C Y LA + R ++ W +P+++ G   YGF  E+  E+KT+ RIG     L  G  +     ++ WT    +       +  P Y  + G +  L  E  +TV   P    + YKE               L+  I     +  +C  P      ++K  Q    + E Y    + +F+     + PW    + + + +   + ++S+  +T   P+N ++++F  ++   A R++  + E  L++    +FYDG +LYA AL++TLA+GGA +NG  I +   N +F G+ G V+ID    R  D  +  M + +TGE+  V+++ G+    +      + W S     P   P C +  D+  C      L I A+ +G+   +F IS    + +YR +KL+ EL  M W + WE L+
Sbjct:   36 AAVMLPDNYHKYPWALPRVFPALLMAQEDLHTKHKLLLGHTITILNYSTENPAAPGSCAESRAQVVVVDAKLYSRPDVFFGPGCVYPLASVGRFVSHWKLPLITAGGPAYGF--EKLDEYKTIVRIGPSTTKL--GAFVNVLHTQFNWTSRAVVIFYDLKQDDRPHYFLSEGIFMNLKDEMNMTVSARPYTNEQDYKE---------------LVSFIKENGRIIYIC-GPLETFLSIMKLFQSEIQDPESYAIFYLDVFAESLTHRKPW---QNAKFDWTNPIQVFKSVFVITYHPPDNPEYKDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHWPSCGP--PLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFGIS---SFLIYRKLKLEKELAGMLWRVQWEDLQ 509          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 2352.78 bits (6096), Expect = 0.000e+0
Identity = 1143/1147 (99.65%), Postives = 1147/1147 (100.00%), Query Frame = 3
Query:  156 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFLL 3596
            MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQN+KGTRNEMENLHLLHEVEKPSSK+SRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN+YFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDP+PKDAFLL
Sbjct:    1 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNVKGTRNEMENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKDAFLL 1147          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 2333.52 bits (6046), Expect = 0.000e+0
Identity = 1137/1147 (99.13%), Postives = 1140/1147 (99.39%), Query Frame = 3
Query:  156 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFLL 3596
            MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQN       MENLHLLHEVEKPSSK+SRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSN+YFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDP+PKDAFLL
Sbjct:    1 MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVKVHQSRSQN-------MENLHLLHEVEKPSSKISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKDAFLL 1140          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 1412.9 bits (3656), Expect = 0.000e+0
Identity = 704/1162 (60.59%), Postives = 877/1162 (75.47%), Query Frame = 3
Query:  123 FPSRTEISFYNMLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNH--NCVKYQSKPIHNSKVKVHQSRSQNLKGTRNE------MENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKD 3584
            F S   + F+ +L   +IS    G E       Q C + RP+R YPLAML+LPKNFS FPW LTIP+IK+ LEKV+ M  +NPI+K++K L P+DS C++T+  LY  V  FV +MPDV+FGPIC YV+APIARL+AFWN P+++TGA+YY F  +R +EF TLTR+GSGHLD   G +I + F KYKW  G YI+ K AY + IP+YCH LG YL +     V  WPI+ Y EL    + ND+ ++  LI+ IGNK A+ +LC DP  V +I+L+A  LNF NGEY+F+NI +FSS +  + PWY       EN  AK+A+R+L+++TL+ PE EK++ FS +VK  A  EYN+  E +L+N+FVS+F+D V+LYA  LN TL+ GG I +G L++KNMWN +FE +G TVTI   GDR ADFS++D++ +TG F+ V+++IG K  +  V +  +DWG+V+N IP   P CGYD S CPKP    NIGAISAGVMG    I+   G F++R  K QAELNAMNWIIPW+ LETSEK R   +   N   Y  K   N    ++++  +NL  T+++      +EN +L+ +++    K  + N     N    D   IS  SL+TI GINLD +   QLF KTAL+KGN+VALKPI    +I+I  +LLI++KK+KD++NDHICRFIG CL+  + Y+VY+YCPKGSLEDVLAKEQI LDW+FKYSL+QDICRGM+YLHNN GP G LKSSNCLVDSRFVLKITDFGL SL+G+K  ++ E+ NMY+K+ LWTAPELL +SNPP++GT KGDVYSFA++CQEIVYR GVFSL  + + +++EI E V+ ++SP PFRP+L    GCT+D + LI+Q+W+EDP  RPDF TIK  MRK NK GD+GNILDNLLSRMEQYANNLE +V +RTEQYLEEK+KAEDLLYSMLPK VAHQLIKNQ V AESYD+VTIFFSDIVGFTALSAESTPMQII+LLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLH+REIARM+IAFL AI  F+IPHRPDK+L+LRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLP KIHISQST ++L TFGTF+++ERGHI++KGKG   TYWLHGE+  IVDP+P D
Sbjct:    3 FQSVKTMFFHCLLTGFIISLCREGSEA-LEKTNQGCDLVRPNRDYPLAMLLLPKNFSTFPWALTIPSIKMGLEKVRKMENINPIIKNIKILYPIDSDCLQTHKPLYESVINFVKEMPDVIFGPICDYVIAPIARLMAFWNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKWNKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKYKEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKP--GYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSNI---MNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKLNKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLD--HPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNMYYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSP-PFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLPVD 1155          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 1104.74 bits (2856), Expect = 0.000e+0
Identity = 587/1149 (51.09%), Postives = 766/1149 (66.67%), Query Frame = 3
Query:  159 LLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSM-FPWPLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQTFVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKV--KVHQSRSQNLKGTRNEME----NLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNP-PLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPK 3581
            L  +  SF VF   C+ +          PD  YPLA++M+P +    F   L + A  IALEK+++   ++P ++ LK     DS C+ +   LY  V+  +   P V FGPIC Y LAPIARLL FW+IPI++       FR+ +  E+ TLTR+ S  +   L  + +K F+ Y W+    IY +T        +C ++G     E            YK  T  ++    A     ID +G++ AV VLCV+P SV RILLKA +LNF NGEYVFINI L +S    + PWY        N +AK AYRSLL+VT + PE+E+++NF  +VK   + +Y    E    N F+  F+D +LLYA ALN T+A      NG+ I + MWN T +GI G ++ID +GDR AD+S+LDMD  TG FK VA++IG K  ++ V    +DW +  N+ P + P CGY+   CP  ++ +  G IS   M  + L +   G+++Y+ +K QAELNAMNW+IPW+++ET EK      H      S  + NS++  K  Q   + L     E +    N  L  +V K  S+ SR NS N           IS  S E+  G+  D +   + F  TALYKGNVVALK +   ++++INR LLI+VKKVK+LNN+HICRFIG CL+    +++ +YCPKGSL+D+L  EQI LDW+FK+SL+QDICRGM+YLH+N+GP G LKSSNCLVDSRFVLKI DFGL  LRG+K+YLLE D   Y++NLLWTAPE+LR +    L  + K DVYSF I+CQE+VYR GVF L S+ +   ++IVE V  +    P+RP L+    C+E    +I+QSW ED  LRPDF TIK  MR  NK GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQ+I+LLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARM++AFLSAIF F IPH+P+K ++LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIH+S+ ++ +L+TF  F++++RG + +KGKG   TYWLHGE+ +IVDPIP+
Sbjct:    9 LFILFYSFAVFIIICKSDITDNFPN-ANPD--YPLAIIMIPDDIRHNFNKNLMLSAFDIALEKIRTWN-IHPFIRKLKYYADADSDCLASRMPLYYTVKLLMKSKPGVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLN-----FCRSVGTLFDSE-----------NYKNKTFKSVVLLNAETLLEID-MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCP--NRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK-----RHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVK--SRPSRVNSIN-----------ISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYL-SDINLEPKQIVEFV-TKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPE 1111          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 555/1042 (53.26%), Postives = 715/1042 (68.62%), Query Frame = 3
Query:  477 VLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKEXXXXXXXXXXXXEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKV--KVHQSRSQNLKGTRNEME----NLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNP-PLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPK 3581
            V FGPIC Y LAPIARLL FW+IPI++       FR+ +  E+ TLTR+ S  +   L  + +K F+ Y W+    IY +T        +C ++G     E            YK  T  ++    A     ID +G++ AV VLCV+P SV RILLKA +LNF NGEYVFINI L +S    + PWY        N +AK AYRSLL+VT + PE+E+++NF  +VK   + +Y    E    N F+  F+D +LLYA ALN T+A      NG+ I + MWN T +GI G ++ID +GDR AD+S+LDMD  TG FK VA++IG K  ++ V    +DW +  N+ P + P CGY+   CP  ++ +  G IS   M  + L +   G+++Y+ +K QAELNAMNW+IPW+++ET EK      H      S  + NS++  K  Q   + L     E +    N  L  +V K  S+ SR NS N           IS  S E+  G+  D +   + F  TALYKGNVVALK +   ++++INR LLI+VKKVK+LNN+HICRFIG CL+    +++ +YCPKGSL+D+L  EQI LDW+FK+SL+QDICRGM+YLH+N+GP G LKSSNCLVDSRFVLKI DFGL  LRG+K+YLLE D   Y++NLLWTAPE+LR +    L  + K DVYSF I+CQE+VYR GVF L S+ +   ++IVE V  +    P+RP L+    C+E    +I+QSW ED  LRPDF TIK  MR  NK GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQ+I+LLNRLYTTFDSIIE++DVYKVETIGDAYMVCSGLPQ NG++H REIARM++AFLSAIF F IPH+P+K ++LRIGIHSGPVC+GVVGLKMPRYCLFGDTVNT+SRMESNGLP KIH+S+ ++ +L+TF  F++++RG + +KGKG   TYWLHGE+ +IVDPIP+
Sbjct:   53 VWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHEEYSTLTRVNSIIVTDHLKVLFRKIFQMYNWSRVKLIYEQTFLN-----FCRSVGTLFDSE-----------NYKNKTFKSVVLLNAETLLEID-MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQNFIKEVKNRTNEKYGSVEES---NKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCP--NRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREK-----RHRLTHKVSDTLPNSELFTKRFQYSKRGLAKFDEESDVLIGNPSLAGDVVK--SRPSRVNSIN-----------ISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRGTKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYL-SDINLEPKQIVEFV-TKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPE 1052          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR13.641e-5858.72natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR25.934e-4756.89natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2F1.257e-13147.42guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D1.603e-13045.18guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C7.727e-11745.33guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-282.731e-6150.69Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-283.199e-5650.69Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-281.418e-18050.69Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-282.551e-17449.22Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-72.394e-14131.35Receptor-type guanylate cyclase gcy-7 [Source:Uni... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311830.000e+042.04gene:FBgn0051183 transcript:FBtr0346151[more]
CG311830.000e+042.04gene:FBgn0051183 transcript:FBtr0083187[more]
CG107381.073e-17340.86gene:FBgn0036368 transcript:FBtr0302487[more]
CG107381.088e-17240.52gene:FBgn0036368 transcript:FBtr0302488[more]
CG107382.884e-17240.62gene:FBgn0036368 transcript:FBtr0304792[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1a0.000e+039.63natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a0.000e+039.63natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b0.000e+039.10natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr1b0.000e+044.81natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
si:dkey-37g12.10.000e+039.26si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR20.000e+057.77natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.77natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.77natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.77natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.77natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr12.880e-6158.17natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr20.000e+057.09natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr23.287e-4857.09natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr21.606e-15155.84natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2g1.516e-14332.47guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16066|ANPRA_HUMAN1.748e-5758.72Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|P18293|ANPRA_MOUSE2.015e-6058.17Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P18910|ANPRA_RAT2.961e-5958.33Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P16067|ANPRB_RAT2.071e-4757.09Atrial natriuretic peptide receptor 2 OS=Rattus no... [more]
sp|Q6VVW5|ANPRB_MOUSE2.299e-4757.09Atrial natriuretic peptide receptor 2 OS=Mus muscu... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V6510.000e+048.52Guanylate cyclase OS=Schistosoma mansoni OX=6183 G... [more]
A0A1I8HCY10.000e+046.51Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A267GXV30.000e+051.71Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A267GHM20.000e+051.60Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A267EU150.000e+051.60Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1a0.000e+038.64natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.269e-5058.88atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b1.269e-5058.88atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a4.476e-4158.33natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.774e-5055.98atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.18.298e-4658.21pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR10.000e+054.79natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.16.035e-15238.42pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008986.15.634e-13848.58pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000008942.11.039e-13746.55pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC59.375e-1021.97Polo-like kinase; controls targeting and activatio... [more]
KIN12.161e-927.47Serine/threonine protein kinase involved in regula... [more]
STE111.523e-826.78Signal transducing MEK kinase; involved in pheromo... [more]
KIN24.097e-828.65Serine/threonine protein kinase involved in regula... [more]
CDC159.720e-823.53Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO309854.283e-16752.02Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342756.564e-16752.01Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362039.242e-13043.99Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279231.713e-12848.16Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362041.126e-12447.24Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olgc70.000e+039.82membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc70.000e+038.33membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc27.359e-5157.45membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
npr22.415e-2657.89natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr21.661e-4457.89natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010241.10.000e+099.65SMESG000010241.1[more]
SMESG000010241.10.000e+099.13SMESG000010241.1[more]
SMESG000056411.10.000e+060.59SMESG000056411.1[more]
SMESG000068881.10.000e+051.09SMESG000068881.1[more]
SMESG000068881.10.000e+053.26SMESG000068881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018527 ID=SMED30018527|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3664bp
TCGATTTGATTGCTCACAATGATTAATAGCAATACTCGATTTTGATTGGC
CGATGGAGAACTCTCTAGAAATGGAATTGTTAATGGAATCAATGTTATCA
ATGTTCATTGGAATTTAGACATTTTCCCTCCAGAACTGAGATTTCGTTCT
ACAACATGCTTCTAAAAATTCTAATCTCATTTCTTGTGTTCGGATTCGAG
TGTCAATGCAATTCAGAAACCCAGCTTTGTACAATCAAACGTCCAGATCG
GATTTATCCGCTTGCCATGTTAATGCTACCGAAAAATTTCTCCATGTTTC
CTTGGCCGTTGACAATTCCAGCAATCAAAATTGCTTTGGAGAAAGTCAAA
AGTATGCCATACATGAATCCGATAGTGAAATCGTTAAAAACTTTGGAGCC
AGTAGATAGTATTTGCGTTGAAACCAATTATGCGTTATACAGAGGAGTCC
AAACGTTCGTGACTCAAATGCCAGATGTTCTGTTTGGTCCAATCTGTGGA
TATGTTCTTGCACCAATAGCTCGACTTCTTGCATTCTGGAATATACCGAT
TTTGTCTACAGGAGCAGTTTATTATGGATTTAGAAAAGAGAGAAAAAGTG
AATTTAAAACTCTAACAAGAATAGGCTCAGGCCATTTGGATCTTGTTCTG
GGTCAGATGATACAAAAGACATTTAAAAAGTATAAATGGACCCATGGAAT
ATACATCTACCACAAGACTGCGTATACCAATGTCATTCCACTTTATTGTC
ATGCTTTAGGGGGCTATTTGACCCAAGAATTCGAGATCACGGTTGACTAT
TGGCCAATCAGGCAATACAAAGAGCTGACTACGGCCACCTTGACAAATGA
CACAGCGTTAGAACAGTTCCTTATTGATGCGATTGGCAATAAGTATGCAG
TCGCCGTCCTGTGCGTTGATCCGGCTTCAGTTCATAGGATTCTCCTCAAA
GCCGATCAGCTCAATTTCAACAATGGCGAATATGTTTTCATTAATATCGG
TTTGTTTTCGAGTGGGAACGAAACAAAATACCCTTGGTACCTCACGGCAT
CAAATCAATCTGAAAATTCTCGAGCAAAGCGAGCTTATCGCTCTCTTTTA
TCAGTTACTCTGAAAATTCCAGAAAATGAAAAATTTCGCAACTTTTCCGA
CCAAGTAAAAGAAATGGCATCGAGGGAATACAATTATCATTACGAAAAAG
ACTTGATAAATACCTTTGTAAGCAATTTCTACGATGGAGTACTGCTGTAC
GCTCATGCTTTGAATAAAACATTGGCGGACGGGGGAGCCATCAGCAATGG
CAGTTTAATTATTAAGAATATGTGGAACACGACCTTTGAAGGTATCGGAG
GAACGGTAACAATTGACTCTTCTGGAGATAGGATAGCCGATTTTTCTATC
CTGGATATGGATCCTAAAACTGGAGAATTCAAACCAGTTGCCCATTTTAT
CGGAACGAAATCCTCATTCCTAGTCGTGCCGAATGTGAGCGTTGACTGGG
GCAGCGTCAGCAACGTGATACCGTCCACCAAACCGAGATGCGGATACGAC
AATTCCATGTGCCCAAAACCCGATAAGAATCTCAACATTGGAGCCATTTC
AGCCGGCGTCATGGGCTGCCTGTTCCTAATTTCATTTAGTGCCGGCTACT
TTGTTTACAGAAATATCAAATTACAAGCCGAACTAAATGCTATGAATTGG
ATAATTCCTTGGGAGTCACTGGAAACCTCGGAGAAGATCCGGAACTTGGT
GAACCACAATTGTGTCAAATATCAAAGCAAACCTATCCACAATAGCAAAG
TCAAAGTGCATCAATCAAGATCGCAAAATTTAAAGGGAACAAGAAATGAA
ATGGAAAATCTGCATTTACTACACGAGGTGGAGAAGCCTTCAAGTAAACT
TTCAAGGAATAATTCAAAAAATTTCGGTAACCCCATCTACAAGGATTTGG
ATCTAATCAGCTGTGCCTCATTGGAAACAATAGCGGGAATAAATCTGGAT
AAAATCCAAAATGCTCAACTATTTACGAAAACCGCTCTTTACAAAGGCAA
CGTCGTGGCATTGAAGCCGATCCTTAGCCAACGTAGAATTGATATTAATC
GCCAGCTGTTAATTCAAGTGAAAAAGGTTAAAGACTTGAATAATGATCAT
ATTTGCCGCTTCATTGGAGCGTGCTTGGAAATCGGGTACCAATACATGGT
TTATGATTATTGCCCCAAAGGGAGCCTGGAAGACGTTCTAGCAAAGGAAC
AAATCACTTTGGACTGGGTATTCAAATATTCCTTGATTCAGGATATTTGT
AGGGGAATGGTTTACCTTCACAATAACCTCGGACCGATAGGGACTCTCAA
GAGTTCCAATTGCTTGGTTGACTCTCGTTTCGTATTAAAAATTACGGATT
TTGGCTTGATCTCCCTGAGAGGAAGCAAACAATATCTGCTGGAGGAAGAC
TCGAATATGTATTTTAAAAATCTTTTGTGGACTGCGCCAGAACTTCTACG
GATGTCAAATCCTCCACTCGATGGCACTTTCAAAGGAGATGTTTACAGTT
TTGCAATTGTATGCCAAGAAATTGTGTATAGAAAAGGAGTTTTCTCCTTG
GATTCAGAAGACGATTTCTCAGCCCAAGAAATCGTCGAATCTGTCAAAGC
CGAAAACAGTCCAAATCCTTTTCGACCAAGTCTCACGGCCATACATGGTT
GCACTGAGGATTTTGTGCTGTTAATCAAACAGTCGTGGAATGAAGATCCA
GTTCTTAGGCCAGATTTCAATACCATTAAATATCACATGAGAAAATTTAA
CAAGGAAGGCGACAGTGGCAATATTCTGGATAATCTTCTTTCACGAATGG
AACAGTATGCCAACAATTTGGAAGACATTGTTCAAGAAAGAACCGAACAG
TATTTGGAAGAAAAGAAAAAAGCAGAAGATCTTCTCTATTCAATGTTACC
GAAATCGGTCGCCCACCAGTTAATTAAAAACCAGCCAGTAAATGCCGAGA
GCTATGATCTGGTGACGATTTTCTTCAGTGACATCGTCGGATTCACGGCT
TTATCTGCCGAGTCAACCCCGATGCAAATAATTGACTTACTTAATCGGCT
CTACACCACATTTGATTCCATAATTGAAAATTACGACGTGTACAAAGTTG
AAACGATTGGAGATGCGTATATGGTTTGTTCAGGTCTACCTCAATTAAAT
GGAAACCTTCATGCGAGAGAAATTGCAAGGATGGCCATTGCATTTCTCAG
TGCGATTTTCTGCTTCGTGATTCCTCATAGGCCGGACAAGGAGTTGAAAT
TACGAATCGGTATTCATTCAGGACCTGTTTGTTCTGGGGTTGTCGGTTTG
AAAATGCCAAGGTATTGCTTGTTTGGAGACACCGTCAACACTTCAAGTAG
AATGGAGAGCAACGGATTGCCCCACAAAATTCATATTAGCCAGAGCACCA
TGCAGTTACTGAAAACTTTCGGAACTTTTTTGATGACAGAAAGAGGTCAC
ATTGAAGTTAAAGGCAAAGGATCTACGCAAACTTACTGGCTACATGGGGA
AAACGAGCTTATTGTCGACCCAATTCCAAAAGACGCCTTTCTGCTGTAAA
GTTTCAAGGCTACGAGGTGGAGATTTGTTTGACAAATTCAATGTTATATT
TCAGATTTAATAAA
back to top

protein sequence of SMED30018527-orf-1

>SMED30018527-orf-1 ID=SMED30018527-orf-1|Name=SMED30018527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1148bp
MLLKILISFLVFGFECQCNSETQLCTIKRPDRIYPLAMLMLPKNFSMFPW
PLTIPAIKIALEKVKSMPYMNPIVKSLKTLEPVDSICVETNYALYRGVQT
FVTQMPDVLFGPICGYVLAPIARLLAFWNIPILSTGAVYYGFRKERKSEF
KTLTRIGSGHLDLVLGQMIQKTFKKYKWTHGIYIYHKTAYTNVIPLYCHA
LGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVA
VLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASN
QSENSRAKRAYRSLLSVTLKIPENEKFRNFSDQVKEMASREYNYHYEKDL
INTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGT
VTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGS
VSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFV
YRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVK
VHQSRSQNLKGTRNEMENLHLLHEVEKPSSKLSRNNSKNFGNPIYKDLDL
ISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQ
LLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQI
TLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFG
LISLRGSKQYLLEEDSNMYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFA
IVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCT
EDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQ
YANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESY
DLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVET
IGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLR
IGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQ
LLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPIPKDAFLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001170ANPR/GUC
IPR001054A/G_cyclase
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001828ANF_lig-bd_rcpt
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR028082Peripla_BP_I
IPR029787Nucleotide_cyclase
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 891..911
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 621..918
e-value: 1.1E-51
score: 177.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 162..464
e-value: 1.6E-105
score: 355.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 53..413
e-value: 1.6E-105
score: 355.4
NoneNo IPR availablePANTHERPTHR11920:SF300ATRIAL NATRIURETIC PEPTIDE RECEPTOR 1coord: 49..532
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 49..532
coord: 617..1134
NoneNo IPR availablePANTHERPTHR11920:SF300ATRIAL NATRIURETIC PEPTIDE RECEPTOR 1coord: 617..1134
NoneNo IPR availableCDDcd07302CHDcoord: 953..1129
e-value: 1.14303E-66
score: 220.143
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.598
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 478..500
IPR001170Adenylyl cyclase class-4/guanylyl cyclasePRINTSPR00255NATPEPTIDERcoord: 248..266
score: 26.32
coord: 396..413
score: 53.12
coord: 110..128
score: 45.07
coord: 481..503
score: 20.11
coord: 358..376
score: 55.59
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 918..1120
e-value: 1.6E-99
score: 346.6
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 946..1131
e-value: 1.2E-65
score: 220.6
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 954..1084
score: 49.395
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 939..1131
e-value: 1.4E-73
score: 248.5
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 940..1129
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 630..875
e-value: 2.5E-32
score: 112.2
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 56..420
e-value: 7.3E-45
score: 153.6
IPR018297Adenylyl cyclase class-4/guanylyl cyclase, conserved sitePROSITEPS00452GUANYLATE_CYCLASE_1coord: 1061..1084
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 595..880
score: 22.209
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 629..880
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 45..464