slc25a-22

Overview
Nameslc25a-22 (AKN21590.1)
Smed IDSMED30018526
Length (bp)1757
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-22 (SMED30018526) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-22 (SMED30018526) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-22 (SMED30018526) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-22 (SMED30018526) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018526SMESG000074801.1 dd_Smed_v4_8134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018526SMESG000074801.1 dd_Smed_v4_8134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30018526SMESG000074801.1 SMED30018526smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30018526SMESG000074801.1 dd_Smed_v4_8134_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30018526SMESG000074801.1 Smed-slc25a-22smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-22 vs. Ensembl Human
Match: SLC25A25 (solute carrier family 25 member 25 [Source:HGNC Symbol;Acc:HGNC:20663])

HSP 1 Score: 420.239 bits (1079), Expect = 1.077e-141
Identity = 196/417 (47.00%), Postives = 286/417 (68.59%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+GI+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GYVPN+LGI+PYAGIDLA++ET KN +L+ +   +     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   70 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQ-HYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 466          
BLAST of slc25a-22 vs. Ensembl Human
Match: SLC25A23 (solute carrier family 25 member 23 [Source:HGNC Symbol;Acc:HGNC:19375])

HSP 1 Score: 420.239 bits (1079), Expect = 1.213e-141
Identity = 207/466 (44.42%), Postives = 299/466 (64.16%), Query Frame = 3
Query:  243 EAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKS-----EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E +  +D  + +  L+  L        +   ++   S+  AD       E+F  +L+ +E +L L F  +DRN D  ID  EIQ++   LGI I +++AE++L  +D D  + ID+ EW+   L  S  +++D++ +W+ S  +DIGE +T+PD+FS QEK+TG+ WK LVAG VAG VSRT TAPLDR+KV MQ H +K   L I+  ++SM+ EGG+ SLWRGNG++  KI PESAIKF++YE  K+ +  +    T  + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLR++GQY  + DCA+ +   EG + F+RGY+PN+LGI+PYAGIDLA++ET KN +L+  +  S     + V L  G  SS CGQ A+YPLALVRT++QA      Q+++             +++M+ + R I  QEG  G YRGI PN +KVIPAVSISY V++  +  LG+
Sbjct:   20 ELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRSLWRGNGINVLKIAPESAIKFMAYEQIKRAI--LGQQET--LHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSHDSA-DPGILVLLACGTISSTCGQIASYPLALVRTRMQA------QASIE---------GGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGV 465          
BLAST of slc25a-22 vs. Ensembl Human
Match: SLC25A25 (solute carrier family 25 member 25 [Source:HGNC Symbol;Acc:HGNC:20663])

HSP 1 Score: 420.239 bits (1079), Expect = 1.988e-141
Identity = 196/417 (47.00%), Postives = 286/417 (68.59%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+GI+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GYVPN+LGI+PYAGIDLA++ET KN +L+ +   +     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   90 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQ-HYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 486          
BLAST of slc25a-22 vs. Ensembl Human
Match: SLC25A25 (solute carrier family 25 member 25 [Source:HGNC Symbol;Acc:HGNC:20663])

HSP 1 Score: 419.853 bits (1078), Expect = 4.994e-141
Identity = 196/417 (47.00%), Postives = 286/417 (68.59%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+GI+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GYVPN+LGI+PYAGIDLA++ET KN +L+ +   +     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:  104 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQ-HYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 500          
BLAST of slc25a-22 vs. Ensembl Human
Match: SLC25A24 (solute carrier family 25 member 24 [Source:HGNC Symbol;Acc:HGNC:20662])

HSP 1 Score: 417.542 bits (1072), Expect = 1.867e-140
Identity = 201/463 (43.41%), Postives = 298/463 (64.36%), Query Frame = 3
Query:  249 EKKQDTIITIQTLKNVLKNEH----DDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            ++  D ++ I  L+  L+N       DA        + +KD     E+F+++LK  E ++KLAFK +D+N+D KI++ EI +++  LG+ I  ++AE +L  +D+D  + +D++EW+ + L +    +++II++W+ S  IDIG+++TIPD+F+  EK +G  W+ L+AGG+AG VSRT+TAPLDR+K+ MQ HG+K   + I    + M+ EGG+ SLWRGNG +  KI PE+A+KF +YE YKK +          +   ERF +G++AGAT+Q  I+PMEV+KTR+ + K+GQYS IYDCAK + + EG   F++GYVPNLLGI+PYAGIDLA++E  K+ +L  N     +   V V L  GA SS CGQ A+YPLALVRT++QA  M+                 S ++ MV +FR I  +EG  G YRGI PN +KV+PAV ISY V++  +  LG+
Sbjct:   32 DRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQK----IGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWL-DNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAML---------------EGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGV 474          
BLAST of slc25a-22 vs. Ensembl Celegans
Match: F55A11.4 (pep chromosome:WBcel235:V:11771248:11773490:1 gene:WBGene00010077.1 transcript:F55A11.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55A11.4)

HSP 1 Score: 370.933 bits (951), Expect = 6.157e-122
Identity = 195/460 (42.39%), Postives = 280/460 (60.87%), Query Frame = 3
Query:  261 DTIITIQTLKNVLKNE--HDDANNLNTEKSNESKDIADKSE--KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYS-SIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            D  I I+ L   LK+E  H  AN      S  S D   + +   F  ++   E +L   F  MDRNHD  +D  E++    D+G+ +   +A+ +++++D   + ++D  E++ F++   +  L+DI+ +WR +  IDIGE+  IP+DFS QE   GI W+ LVAGG AG VSRT TAP DRIKV +Q + +K   LG+++ +K + +EGG+ S WRGNG++  KI PESAIKF+ Y+  K+ + +   N   +++  ER  AG+ AGA SQ+ I+PMEV+KTR+ LRK+GQ    I   A  +Y  EG + F++GY+PNL+GI+PYAGIDLA++ET K  Y++   ET+  +  V   L  G  SS CGQ ++YP ALVRT+LQA+ +  Y                Q  TM   F+ I + EG  GFYRGI PN LKVIPAVSISY V+++ R  LG+
Sbjct:   90 DGTIDIRDLTLALKHETPHIPANLAPVIMSKMSPDDEGRVDFYSFSSYVLENEQKLAEMFADMDRNHDGLVDVVEMKNYCKDIGVPLDDHKAQHIVNKMDQTGSASVDLKEFQEFMMLYPSSDLKDIVDFWRHNLIIDIGEDSQIPEDFSQQEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNE--EISTFERLCAGSAAGAISQSTIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLAIYETLKRTYVRY-YETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYS--------------PQPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGV 532          
BLAST of slc25a-22 vs. Ensembl Celegans
Match: F55A11.4 (pep chromosome:WBcel235:V:11770456:11773494:1 gene:WBGene00010077.1 transcript:F55A11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F55A11.4)

HSP 1 Score: 370.933 bits (951), Expect = 6.157e-122
Identity = 195/460 (42.39%), Postives = 280/460 (60.87%), Query Frame = 3
Query:  261 DTIITIQTLKNVLKNE--HDDANNLNTEKSNESKDIADKSE--KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYS-SIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            D  I I+ L   LK+E  H  AN      S  S D   + +   F  ++   E +L   F  MDRNHD  +D  E++    D+G+ +   +A+ +++++D   + ++D  E++ F++   +  L+DI+ +WR +  IDIGE+  IP+DFS QE   GI W+ LVAGG AG VSRT TAP DRIKV +Q + +K   LG+++ +K + +EGG+ S WRGNG++  KI PESAIKF+ Y+  K+ + +   N   +++  ER  AG+ AGA SQ+ I+PMEV+KTR+ LRK+GQ    I   A  +Y  EG + F++GY+PNL+GI+PYAGIDLA++ET K  Y++   ET+  +  V   L  G  SS CGQ ++YP ALVRT+LQA+ +  Y                Q  TM   F+ I + EG  GFYRGI PN LKVIPAVSISY V+++ R  LG+
Sbjct:   90 DGTIDIRDLTLALKHETPHIPANLAPVIMSKMSPDDEGRVDFYSFSSYVLENEQKLAEMFADMDRNHDGLVDVVEMKNYCKDIGVPLDDHKAQHIVNKMDQTGSASVDLKEFQEFMMLYPSSDLKDIVDFWRHNLIIDIGEDSQIPEDFSQQEMQEGIWWRHLVAGGAAGAVSRTCTAPFDRIKVYLQVNSSKTNRLGVMSCLKLLHAEGGIKSFWRGNGINVIKIAPESAIKFMCYDQLKRLIQKKKGNE--EISTFERLCAGSAAGAISQSTIYPMEVMKTRLALRKTGQLDRGIIHFAHKMYTKEGIRCFYKGYLPNLIGIIPYAGIDLAIYETLKRTYVRY-YETNSSEPGVLALLACGTCSSTCGQLSSYPFALVRTRLQALSITRYS--------------PQPDTMFGQFKYILQNEGVTGFYRGITPNFLKVIPAVSISYVVYEKVRTGLGV 532          
BLAST of slc25a-22 vs. Ensembl Celegans
Match: F17E5.2 (Probable calcium-binding mitochondrial carrier F17E5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q19529])

HSP 1 Score: 354.755 bits (909), Expect = 9.825e-116
Identity = 170/416 (40.87%), Postives = 271/416 (65.14%), Query Frame = 3
Query:  381 FLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYS-SIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLS-GATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLG 1622
            F  ++ + E +L   F ++D N D ++D  EI+    ++G+ +  ++A  ++ ++D   + +++ +E++ F+L   +  ++D++ +WR +  IDIGE+  +P+DF+ QE ++G+ W+ LVAGGVAG +SRT TAP DRIKV +Q +  K   LG+++ +  + +EGG+ S WRGNG++  KI PESA+KF+ Y+  K+++         +++ +ER  AG+ AGA SQ  I+PMEV+KTR+ LR++GQ    ++  A  +Y  EG + F++GY+PNLLGI+PYAGIDL ++E+ K++Y K   E ++   P  ++LL+ G  SS CGQ A+YPLALVRT+LQA              + + ++ +Q  TMV  F+ I + EGF G YRGI PN +KVIPAVSISY V+++ R  LG
Sbjct:  130 FTNYVIAHEARLAEVFDKIDLNSDGEVDMAEIKSYCKEMGVNLDDQKAMSIVKKMDQSGSSSVNLNEFQDFMLLYPSTDMRDMVDFWRHNLIIDIGEDGQVPEDFTPQELLSGVWWRHLVAGGVAGAMSRTCTAPFDRIKVYLQVNSTKTNKLGVVSCVHLLHAEGGIKSFWRGNGINVIKIAPESAMKFMCYDQIKRWMQEYKGG--AELSTIERLLAGSSAGAISQTAIYPMEVMKTRLALRRTGQLDKGMFHFAHKMYTKEGIKCFYKGYLPNLLGIIPYAGIDLTVYESLKSMYTKYYTEHTE---PGVLALLACGTCSSTCGQLASYPLALVRTRLQA-------------RAISPKNSTQPDTMVGQFKHILQTEGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLG 527          
BLAST of slc25a-22 vs. Ensembl Celegans
Match: slc-25A42 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q93717])

HSP 1 Score: 138.272 bits (347), Expect = 1.964e-36
Identity = 87/299 (29.10%), Postives = 153/299 (51.17%), Query Frame = 3
Query:  732 TLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANL-GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGF-FGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLG 1622
            +L AG +AG +++TT APLDR K+  Q    +  +    I  IK    E G  +L+RGN  +  ++ P ++++F ++E YKK + ++  N  G  T ++R+  G+LA  T+  + +P++  K R+++    QYSS+       Y+  G Q+ +RG  P +LG++PYAG     +ET K +Y     E        Y  +L G  + + GQ ++YPL +VR ++Q   + S  S +                ++ ++ +    EG   G Y+G+  N LK   AV +S+  +++   L+G
Sbjct:   17 SLSAGAIAGALAKTTIAPLDRTKIYFQVSSTRGYSFRSAIKFIKLTYRENGFFALYRGNSATMARVVPYASMQFAAFEQYKK-LLKVDEN--GSRTPVKRYITGSLAATTATMITYPLDTAKARLSVSSKLQYSSLKHVFVKTYKEGGIQLLYRGIYPTILGVIPYAGSSFFTYETLKIMYRDHRGEVEN----SYYRMLFGMLAGLIGQSSSYPLDIVRRRMQTGRIPSGWSPLR--------------ALIHIYHT----EGLKRGLYKGLSMNWLKGPIAVGVSFTTYEKVLELVG 290          
BLAST of slc25a-22 vs. Ensembl Celegans
Match: hpo-12 (pep chromosome:WBcel235:IV:12283174:12285065:1 gene:WBGene00016588.1 transcript:C42C1.10.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-12)

HSP 1 Score: 106.301 bits (264), Expect = 5.188e-25
Identity = 73/288 (25.35%), Postives = 136/288 (47.22%), Query Frame = 3
Query:  741 AGGVAGCVSRTTTAPLDRIKVTMQAH-----GAKVANL-GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQ--YSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFE--SFAIQSDSQKITMVSVFRSIK---KQEGFFGFYRGIGPNTLKV 1565
            AG  +G V+R    PLD +K+  Q       G K     G++ +I  +  E G  + W+G+  +         ++F S+E   +   ++       V     F  GAL+G  +     P++V++TR+  +K+G   Y+      K+++  EG   +FRG+VP+++ I P+ G+  AL+  F +++  +  E++        +L SGA +    +   YPL +VR +LQ          +N FE   F   S+  +     +F++I    K E ++G ++G+ P+ +K 
Sbjct:   21 AGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSVRSTSDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYNCFMDLWPFNGYESAG-------ALFSGAMAGTVAKTVLYPLDMVRHRLQ----------MNGFERAGFGKTSNYSQ----GLFKTIGMVVKNESWYGLFKGLWPSQIKA 287          

HSP 2 Score: 58.151 bits (139), Expect = 6.153e-9
Identity = 49/196 (25.00%), Postives = 87/196 (44.39%), Query Frame = 3
Query: 1035 AGALAGATSQNLIFPMEVLKTRMTL-------RKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
            AG  +G  ++ +I P++VLK R  L       +KSG+Y  +      + R EG   F++G++P       Y  +  + FE       K     +Q  +        GA S      A  PL ++RT+L           V Q    A+ +     TM +V + I ++EG  G++RG  P+ +++ P   + +A+++
Sbjct:   21 AGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQ-SVRSTSDFACGALSGCLAMTAAMPLDVIRTRL-----------VAQKAGHAVYTG----TMHAV-KHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYN 199          
BLAST of slc25a-22 vs. Ensembl Fly
Match: SCaMC (gene:FBgn0052103 transcript:FBtr0332090)

HSP 1 Score: 414.075 bits (1063), Expect = 5.603e-138
Identity = 199/419 (47.49%), Postives = 283/419 (67.54%), Query Frame = 3
Query:  378 KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLS-GATSSVCGQFATYPLALVRTKL--QAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +FL +++  E  L L F  +D+N D K+D +E+     DLG+ I + EA  LL+R+D D +L I ++EW+ F+L + +  + D+IK+WR S  +DIGE+M +PDDF+ +E  TG+ W+ LVAGG+AG VSRT TAPLDRIKV +Q    +   +GI   +  M++EGG  S+WRGNG++  KI PE+A KF +YE  K+ +    ++ +  ++++ERFYAGA AG  SQ +I+PMEVLKTR+ LR++GQY+ I D A  +Y+ EG + F+RGYVPN+LGILPYAGIDLA++ET K  Y+ +++   Q   P ++ LL+ G+TSS  GQ  +YPLALVRT+L  QA   ++ Q    Q    +  + S + TM  +FR I +QEG  G YRGI PN LKV+PAVSISY V++ T   LGI
Sbjct:  170 EFLHYVREHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEARNLLTRMDKDGSLNISFNEWRDFMLLAPSTDIHDLIKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQ---VQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIR--GDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQ---PSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580          
BLAST of slc25a-22 vs. Ensembl Fly
Match: SCaMC (gene:FBgn0052103 transcript:FBtr0075982)

HSP 1 Score: 414.075 bits (1063), Expect = 5.603e-138
Identity = 199/419 (47.49%), Postives = 283/419 (67.54%), Query Frame = 3
Query:  378 KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLS-GATSSVCGQFATYPLALVRTKL--QAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +FL +++  E  L L F  +D+N D K+D +E+     DLG+ I + EA  LL+R+D D +L I ++EW+ F+L + +  + D+IK+WR S  +DIGE+M +PDDF+ +E  TG+ W+ LVAGG+AG VSRT TAPLDRIKV +Q    +   +GI   +  M++EGG  S+WRGNG++  KI PE+A KF +YE  K+ +    ++ +  ++++ERFYAGA AG  SQ +I+PMEVLKTR+ LR++GQY+ I D A  +Y+ EG + F+RGYVPN+LGILPYAGIDLA++ET K  Y+ +++   Q   P ++ LL+ G+TSS  GQ  +YPLALVRT+L  QA   ++ Q    Q    +  + S + TM  +FR I +QEG  G YRGI PN LKV+PAVSISY V++ T   LGI
Sbjct:  170 EFLHYVREHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEARNLLTRMDKDGSLNISFNEWRDFMLLAPSTDIHDLIKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQ---VQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIR--GDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQ---PSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580          
BLAST of slc25a-22 vs. Ensembl Fly
Match: SCaMC (gene:FBgn0052103 transcript:FBtr0075983)

HSP 1 Score: 334.724 bits (857), Expect = 3.718e-110
Identity = 171/370 (46.22%), Postives = 242/370 (65.41%), Query Frame = 3
Query:  531 LLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCA--IDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLS-GATSSVCGQFATYPLALVRTKL--QAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +L      +NL +DY   +   +  +   ++D +  +R      +DIGE+M +PDDF+ +E  TG+ W+ LVAGG+AG VSRT TAPLDRIKV +Q    +   +GI   +  M++EGG  S+WRGNG++  KI PE+A KF +YE  K+ +    ++ +  ++++ERFYAGA AG  SQ +I+PMEVLKTR+ LR++GQY+ I D A  +Y+ EG + F+RGYVPN+LGILPYAGIDLA++ET K  Y+ +++   Q   P ++ LL+ G+TSS  GQ  +YPLALVRT+L  QA   ++ Q    Q    +  + S + TM  +FR I +QEG  G YRGI PN LKV+PAVSISY V++ T   LGI
Sbjct:    1 MLRNSTYQYNLPVDYHNIQQMAV--AGDMMEDFVVIFRDMMGRYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQV---QTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIR--GDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQ---PSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 360          
BLAST of slc25a-22 vs. Ensembl Fly
Match: SCaMC (gene:FBgn0052103 transcript:FBtr0332089)

HSP 1 Score: 332.413 bits (851), Expect = 2.073e-109
Identity = 164/326 (50.31%), Postives = 225/326 (69.02%), Query Frame = 3
Query:  657 IDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLS-GATSSVCGQFATYPLALVRTKL--QAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +DIGE+M +PDDF+ +E  TG+ W+ LVAGG+AG VSRT TAPLDRIKV +Q    +   +GI   +  M++EGG  S+WRGNG++  KI PE+A KF +YE  K+ +    ++ +  ++++ERFYAGA AG  SQ +I+PMEVLKTR+ LR++GQY+ I D A  +Y+ EG + F+RGYVPN+LGILPYAGIDLA++ET K  Y+ +++   Q   P ++ LL+ G+TSS  GQ  +YPLALVRT+L  QA   ++ Q    Q    +  + S + TM  +FR I +QEG  G YRGI PN LKV+PAVSISY V++ T   LGI
Sbjct:   30 LDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQV---QTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIR--GDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQ---PSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 347          
BLAST of slc25a-22 vs. Ensembl Fly
Match: DPCoAC (gene:FBgn0067783 transcript:FBtr0344280)

HSP 1 Score: 138.658 bits (348), Expect = 7.472e-36
Identity = 96/297 (32.32%), Postives = 158/297 (53.20%), Query Frame = 3
Query:  732 TLVAGGVAGCVSRTTTAPLDRIKVTMQAHG-AKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKF--VCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTL--RKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKN-IYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFF-GFYRGIGPNTLKVIPAVSISYAVFD 1601
            +L++G  AG +++T  APLDR K+  Q       +    +  +++  +  GV +LWRGN  +  +I P +AI+F ++E +++   V +   NT G      RF AG+LAG TSQ+L +P+++ + RM +  R +G Y ++      ++  EG +  FRGY   +LG++PYAG     +ET K   Y+  NN+ + L     VSL  GA +   GQ A+YPL +VR ++Q +        VN           +  T++     I ++EG   GFY+G+  N +K   AV IS++ +D
Sbjct:   75 SLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKG-----RRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTG-YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYVVGNNKPNTL-----VSLAFGAAAGAAGQTASYPLDIVRRRMQTM-------RVN------TAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYD 347          
BLAST of slc25a-22 vs. Ensembl Zebrafish
Match: slc25a24 (solute carrier family 25 member 24 [Source:NCBI gene;Acc:447867])

HSP 1 Score: 455.677 bits (1171), Expect = 1.209e-155
Identity = 214/417 (51.32%), Postives = 295/417 (70.74%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F ++LK  E +L+L FK +D+N D ++D+KEIQ+++ DLGI +  K+AE++L  +D+D  + +D++EW+   L + A  LQ II+YW+KS  +DIG+++TIPD+F+ +EK TG+ WK L AGGVAG VSRT TAPLDR+KV MQ H +K   + ++N  K MI EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK + +      G V   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + R EG + F++GYVPN+LGI+PYAGIDLA++ET KN +L S+         V V L  G  SS CGQ A+YPLAL+RT++QA+               A    S++++M  + + I ++EGFFG YRGI PN +KVIPAVSISY V++  R  LGI
Sbjct:   79 EEFSKYLKEHEKKLRLTFKSLDKNEDGRVDAKEIQQSLKDLGINLSDKDAEKILHSIDVDGTMTLDWNEWREHFLFNPAEDLQQIIRYWKKSTVLDIGDSLTIPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFKQMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSK----DGGKVQSHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAGIDLAVYETLKNTWL-SHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAM---------------ASMEGSEQVSMSKLVKKIMQKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 475          
BLAST of slc25a-22 vs. Ensembl Zebrafish
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 435.261 bits (1118), Expect = 1.445e-147
Identity = 199/418 (47.61%), Postives = 300/418 (71.77%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 1628
            E+F E+L+S E +L+L F+ +DRN+D ++D  EIQ+++ +LG+ I +++A ++L  +D DH++ ID+ EW+   L +   ++++I ++W+ S  +DIGE++T+PD+FS +EK +G  W+ L+AG VAG VSRT TAPLDR+KV +Q HG       + + +++M+ EGG+++LWRGNG++  KI PE+AIKFL+YE  K+ +    +N  G + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLRK+GQYSS+ DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++ET KN +L+ + E S     V V +  G  SS CGQ A+YPLAL+RT++QA      Q+++           + +++M+++FRSI  QEG  G YRGI PN LKVIPAVSISY V++  R +LG+G
Sbjct:   77 EEFTEYLRSHEKRLRLMFRSLDRNNDGEVDVGEIQQSLHNLGVDITLEQAAKILQSMDKDHSMTIDWIEWRDHFLFNPLHNMEEIAQFWKHSVMLDIGEHLTVPDEFSEKEKRSGFVWRQLMAGAVAGSVSRTGTAPLDRLKVFLQVHGQSSDKGNVWSGLRAMVKEGGLTALWRGNGINVLKIAPETAIKFLAYEQIKRLMR--GSNEGGTLKVHERFVAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVADCAKQILQKEGVRAFYKGYLPNMLGIIPYAGIDLAVYETLKNAWLQRHTEGSA-DPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQA------QASIK---------GAPQLSMLTLFRSIVAQEGVVGLYRGIAPNFLKVIPAVSISYVVYEHMRKVLGVG 476          
BLAST of slc25a-22 vs. Ensembl Zebrafish
Match: slc25a25b (solute carrier family 25 member 25b [Source:NCBI gene;Acc:569227])

HSP 1 Score: 413.305 bits (1061), Expect = 4.271e-139
Identity = 196/417 (47.00%), Postives = 283/417 (67.87%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D  IDS+EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L   A ++ +II YW+ S   D+GE+M +PD+F+ +EK TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H  +  ++GI      MI EGG+ SLWRGNG++  KI PESAIKF++YE  K+ +   +N  T  + ++ER  +G+LAGA +Q+ I+PMEVLKTR+ L ++GQYS I DCAK++++ EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+    T      V+V L  G  SS CGQ A+YPLALVRT++QA                A Q  S ++TM  +FR I + EG  G YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   70 EEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAEKILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEEKNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLRSLWRGNGINVLKIAPESAIKFMAYEQIKRLIG--SNQET--LGILERLVSGSLAGAIAQSSIYPMEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETLKNSWLQ-RFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQ---------------ASQEGSPQMTMSGLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 466          
BLAST of slc25a-22 vs. Ensembl Zebrafish
Match: slc25a25b (solute carrier family 25 member 25b [Source:NCBI gene;Acc:569227])

HSP 1 Score: 414.075 bits (1063), Expect = 9.763e-139
Identity = 196/417 (47.00%), Postives = 283/417 (67.87%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D  IDS+EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L   A ++ +II YW+ S   D+GE+M +PD+F+ +EK TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H  +  ++GI      MI EGG+ SLWRGNG++  KI PESAIKF++YE  K+ +   +N  T  + ++ER  +G+LAGA +Q+ I+PMEVLKTR+ L ++GQYS I DCAK++++ EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+    T      V+V L  G  SS CGQ A+YPLALVRT++QA                A Q  S ++TM  +FR I + EG  G YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:  125 EEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAEKILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEEKNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLRSLWRGNGINVLKIAPESAIKFMAYEQIKRLIG--SNQET--LGILERLVSGSLAGAIAQSSIYPMEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETLKNSWLQ-RFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQ---------------ASQEGSPQMTMSGLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 521          
BLAST of slc25a-22 vs. Ensembl Zebrafish
Match: slc25a25b (solute carrier family 25 member 25b [Source:NCBI gene;Acc:569227])

HSP 1 Score: 414.075 bits (1063), Expect = 9.763e-139
Identity = 196/417 (47.00%), Postives = 283/417 (67.87%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D  IDS+EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L   A ++ +II YW+ S   D+GE+M +PD+F+ +EK TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H  +  ++GI      MI EGG+ SLWRGNG++  KI PESAIKF++YE  K+ +   +N  T  + ++ER  +G+LAGA +Q+ I+PMEVLKTR+ L ++GQYS I DCAK++++ EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+    T      V+V L  G  SS CGQ A+YPLALVRT++QA                A Q  S ++TM  +FR I + EG  G YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:  125 EEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAEKILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEEKNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLRSLWRGNGINVLKIAPESAIKFMAYEQIKRLIG--SNQET--LGILERLVSGSLAGAIAQSSIYPMEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETLKNSWLQ-RFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQ---------------ASQEGSPQMTMSGLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 521          
BLAST of slc25a-22 vs. Ensembl Xenopus
Match: slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:NCBI gene;Acc:100216197])

HSP 1 Score: 428.328 bits (1100), Expect = 2.293e-145
Identity = 207/417 (49.64%), Postives = 287/417 (68.82%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F  +L+ +E +L + F  +DRN+D +ID  EIQE    LGI I + +A+++L  +D D  L ID+ EW+   L +   +++D+I YW+ S  +DIGE++ +PD+FS +E  +G+ WK L+AGGVAG VSRT TAPLDR+KV MQ HG++   L I+  ++ MI EGGV SLWRGNG++  KI PESAIKF++YE  KK + R  + T   + + ERF AG+LAGA +Q  I+PMEVLKTRM LR++GQYS + DCA+ + R EG + FF+GY+PNLLGI+PYAGIDLA++ET KN +L+    ++     V V L  G  SS CGQ A+YPLALVRT++QA      Q++V           S +++MV++FR I  +EGF G YRGI PN +KVIPAVSISY V++  + LLG+
Sbjct:   37 EEFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQ--GLSILRGLRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLI-RGQHET---LRVRERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQA------QASVQ---------GSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGV 432          
BLAST of slc25a-22 vs. Ensembl Xenopus
Match: slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:NCBI gene;Acc:100216197])

HSP 1 Score: 429.098 bits (1102), Expect = 2.682e-145
Identity = 207/417 (49.64%), Postives = 287/417 (68.82%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F  +L+ +E +L + F  +DRN+D +ID  EIQE    LGI I + +A+++L  +D D  L ID+ EW+   L +   +++D+I YW+ S  +DIGE++ +PD+FS +E  +G+ WK L+AGGVAG VSRT TAPLDR+KV MQ HG++   L I+  ++ MI EGGV SLWRGNG++  KI PESAIKF++YE  KK + R  + T   + + ERF AG+LAGA +Q  I+PMEVLKTRM LR++GQYS + DCA+ + R EG + FF+GY+PNLLGI+PYAGIDLA++ET KN +L+    ++     V V L  G  SS CGQ A+YPLALVRT++QA      Q++V           S +++MV++FR I  +EGF G YRGI PN +KVIPAVSISY V++  + LLG+
Sbjct:   64 EEFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQ--GLSILRGLRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLI-RGQHET---LRVRERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQA------QASVQ---------GSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGV 459          
BLAST of slc25a-22 vs. Ensembl Xenopus
Match: slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:NCBI gene;Acc:100216197])

HSP 1 Score: 428.713 bits (1101), Expect = 4.024e-145
Identity = 207/417 (49.64%), Postives = 287/417 (68.82%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F  +L+ +E +L + F  +DRN+D +ID  EIQE    LGI I + +A+++L  +D D  L ID+ EW+   L +   +++D+I YW+ S  +DIGE++ +PD+FS +E  +G+ WK L+AGGVAG VSRT TAPLDR+KV MQ HG++   L I+  ++ MI EGGV SLWRGNG++  KI PESAIKF++YE  KK + R  + T   + + ERF AG+LAGA +Q  I+PMEVLKTRM LR++GQYS + DCA+ + R EG + FF+GY+PNLLGI+PYAGIDLA++ET KN +L+    ++     V V L  G  SS CGQ A+YPLALVRT++QA      Q++V           S +++MV++FR I  +EGF G YRGI PN +KVIPAVSISY V++  + LLG+
Sbjct:   70 EEFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQ--GLSILRGLRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLI-RGQHET---LRVRERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQA------QASVQ---------GSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGV 465          
BLAST of slc25a-22 vs. Ensembl Xenopus
Match: slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:NCBI gene;Acc:100216197])

HSP 1 Score: 428.713 bits (1101), Expect = 5.592e-145
Identity = 207/417 (49.64%), Postives = 287/417 (68.82%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F  +L+ +E +L + F  +DRN+D +ID  EIQE    LGI I + +A+++L  +D D  L ID+ EW+   L +   +++D+I YW+ S  +DIGE++ +PD+FS +E  +G+ WK L+AGGVAG VSRT TAPLDR+KV MQ HG++   L I+  ++ MI EGGV SLWRGNG++  KI PESAIKF++YE  KK + R  + T   + + ERF AG+LAGA +Q  I+PMEVLKTRM LR++GQYS + DCA+ + R EG + FF+GY+PNLLGI+PYAGIDLA++ET KN +L+    ++     V V L  G  SS CGQ A+YPLALVRT++QA      Q++V           S +++MV++FR I  +EGF G YRGI PN +KVIPAVSISY V++  + LLG+
Sbjct:   76 EEFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQ--GLSILRGLRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLI-RGQHET---LRVRERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQA------QASVQ---------GSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGV 471          
BLAST of slc25a-22 vs. Ensembl Xenopus
Match: slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:NCBI gene;Acc:100216197])

HSP 1 Score: 428.328 bits (1100), Expect = 7.644e-145
Identity = 207/417 (49.64%), Postives = 287/417 (68.82%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F  +L+ +E +L + F  +DRN+D +ID  EIQE    LGI I + +A+++L  +D D  L ID+ EW+   L +   +++D+I YW+ S  +DIGE++ +PD+FS +E  +G+ WK L+AGGVAG VSRT TAPLDR+KV MQ HG++   L I+  ++ MI EGGV SLWRGNG++  KI PESAIKF++YE  KK + R  + T   + + ERF AG+LAGA +Q  I+PMEVLKTRM LR++GQYS + DCA+ + R EG + FF+GY+PNLLGI+PYAGIDLA++ET KN +L+    ++     V V L  G  SS CGQ A+YPLALVRT++QA      Q++V           S +++MV++FR I  +EGF G YRGI PN +KVIPAVSISY V++  + LLG+
Sbjct:   73 EEFTHYLEERERRLLIMFNSLDRNNDGQIDISEIQECFHGLGIHITLAQAKKVLQSMDRDGTLTIDWLEWRDHFLLNPLHNMEDVITYWKHSSMLDIGESLAVPDEFSKKEIRSGMWWKQLLAGGVAGAVSRTGTAPLDRLKVLMQVHGSQ--GLSILRGLRVMIEEGGVRSLWRGNGINVIKIAPESAIKFMAYEQIKKLI-RGQHET---LRVRERFIAGSLAGAIAQTAIYPMEVLKTRMALRRTGQYSGMSDCARQILRNEGVRAFFKGYIPNLLGIVPYAGIDLAVYETLKNTWLQRYRSSTSADPGVLVLLACGTVSSTCGQIASYPLALVRTRMQA------QASVQ---------GSPQLSMVALFRHIVAREGFLGLYRGIAPNFMKVIPAVSISYVVYENMKRLLGV 468          
BLAST of slc25a-22 vs. Ensembl Mouse
Match: Slc25a23 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 [Source:MGI Symbol;Acc:MGI:1914222])

HSP 1 Score: 423.705 bits (1088), Expect = 3.631e-143
Identity = 208/449 (46.33%), Postives = 294/449 (65.48%), Query Frame = 3
Query:  279 QTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            Q L  + + + D A    +   +   D     E+F  +L+ +E +L L F  +DRN D  ID  EIQ++   LGI I +++AE++L  +D D  + ID+ EW+   L  S  +++D++ +W+ S  +DIGE +T+PD+FS +EK+TG+ WK LVAG VAG VSRT TAPLDR+KV MQ H +K   L I+  +++MI EGGV SLWRGNG++  KI PESAIKF++YE  K+ + R    T   + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLR++GQY  + DCAK +   EG + F+RGY+PN+LGI+PYAGIDLA++ET KN +L+  +  S     + V L  G  SS CGQ A+YPLALVRT++QA      Q+++             +++MV + R I  QEG +G YRGI PN +KVIPAVSISY V++  +  LG+
Sbjct:   36 QGLARLGRGDPDRAQQGVSSDWDADPDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSLWRGNGINVLKIAPESAIKFMAYEQIKRAI-RGQQET---LHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNRWLQQYSHESA-NPGILVLLGCGTISSTCGQIASYPLALVRTRMQA------QASIE---------GGPQVSMVGLLRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGV 464          
BLAST of slc25a-22 vs. Ensembl Mouse
Match: Slc25a25 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 [Source:MGI Symbol;Acc:MGI:1915913])

HSP 1 Score: 416.387 bits (1069), Expect = 2.556e-140
Identity = 195/417 (46.76%), Postives = 284/417 (68.11%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+ I+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+     S     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   70 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSA-DPGVFVLLACGTISSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 466          
BLAST of slc25a-22 vs. Ensembl Mouse
Match: Slc25a25 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 [Source:MGI Symbol;Acc:MGI:1915913])

HSP 1 Score: 416.772 bits (1070), Expect = 3.404e-140
Identity = 195/417 (46.76%), Postives = 284/417 (68.11%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+ I+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+     S     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   90 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSA-DPGVFVLLACGTISSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 486          
BLAST of slc25a-22 vs. Ensembl Mouse
Match: Slc25a25 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 [Source:MGI Symbol;Acc:MGI:1915913])

HSP 1 Score: 416.001 bits (1068), Expect = 9.413e-140
Identity = 195/417 (46.76%), Postives = 284/417 (68.11%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+ I+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+     S     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:  103 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSA-DPGVFVLLACGTISSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 499          
BLAST of slc25a-22 vs. Ensembl Mouse
Match: Slc25a25 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 [Source:MGI Symbol;Acc:MGI:1915913])

HSP 1 Score: 411.764 bits (1057), Expect = 4.996e-138
Identity = 196/429 (45.69%), Postives = 284/429 (66.20%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDH------------NLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L R+   H             + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+ I+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+     S     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   90 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAPESAIKFMAYEQMK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETLKNTWLQRYAVNSA-DPGVFVLLACGTISSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 498          
BLAST of slc25a-22 vs. UniProt/SwissProt
Match: sp|Q66L49|SCMC1_DANRE (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio OX=7955 GN=slc25a24 PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 9.126e-155
Identity = 214/417 (51.32%), Postives = 295/417 (70.74%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F ++LK  E +L+L FK +D+N D ++D+KEIQ+++ DLGI +  K+AE++L  +D+D  + +D++EW+   L + A  LQ II+YW+KS  +DIG+++TIPD+F+ +EK TG+ WK L AGGVAG VSRT TAPLDR+KV MQ H +K   + ++N  K MI EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK + +      G V   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + R EG + F++GYVPN+LGI+PYAGIDLA++ET KN +L S+         V V L  G  SS CGQ A+YPLAL+RT++QA+               A    S++++M  + + I ++EGFFG YRGI PN +KVIPAVSISY V++  R  LGI
Sbjct:   79 EEFSKYLKEHEKKLRLTFKSLDKNEDGRVDAKEIQQSLKDLGINLSDKDAEKILHSIDVDGTMTLDWNEWREHFLFNPAEDLQQIIRYWKKSTVLDIGDSLTIPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFKQMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSK----DGGKVQSHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAGIDLAVYETLKNTWL-SHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAM---------------ASMEGSEQVSMSKLVKKIMQKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 475          
BLAST of slc25a-22 vs. UniProt/SwissProt
Match: sp|Q5XHA0|SCMC1_XENTR (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis OX=8364 GN=slc25a24 PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 7.486e-143
Identity = 203/416 (48.80%), Postives = 287/416 (68.99%), Query Frame = 3
Query:  378 KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +F+ +L+  E ++K+AF  +D+N D KI+S EI  ++  LGI I ++ AE++L  +D D  L +D++EW+   L + A ++Q II+YW+ S  +DIG+++TIPD+F+ +EK TG  WK L+AGG+AG VSRT TAPLDR+KV MQ HG+K  N  II  +K M+ EGG+ SLWRGNGV+  KI PE+A+KF +YE YKK       + +G +   ERF AG+LAGAT+Q  I+PMEVLKTR+ + K+GQYS ++DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++ET K  +L+ N  T      V V L  G  SS CGQ A+YPLAL+RT++QA      Q+++           + ++ M  +FR I  +EGFFG YRGI PN LKV+PAVSISY V+++ +  LGI
Sbjct:   79 EFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGINISLEHAEKILKSMDADGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLAGGMAGAVSRTGTAPLDRLKVMMQVHGSK-GNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLF----TSESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQ-NYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQA------QASIE---------GAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 473          
BLAST of slc25a-22 vs. UniProt/SwissProt
Match: sp|Q6GQS1|SCMC3_MOUSE (Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.540e-142
Identity = 208/449 (46.33%), Postives = 294/449 (65.48%), Query Frame = 3
Query:  279 QTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            Q L  + + + D A    +   +   D     E+F  +L+ +E +L L F  +DRN D  ID  EIQ++   LGI I +++AE++L  +D D  + ID+ EW+   L  S  +++D++ +W+ S  +DIGE +T+PD+FS +EK+TG+ WK LVAG VAG VSRT TAPLDR+KV MQ H +K   L I+  +++MI EGGV SLWRGNG++  KI PESAIKF++YE  K+ + R    T   + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLR++GQY  + DCAK +   EG + F+RGY+PN+LGI+PYAGIDLA++ET KN +L+  +  S     + V L  G  SS CGQ A+YPLALVRT++QA      Q+++             +++MV + R I  QEG +G YRGI PN +KVIPAVSISY V++  +  LG+
Sbjct:   36 QGLARLGRGDPDRAQQGVSSDWDADPDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSLWRGNGINVLKIAPESAIKFMAYEQIKRAI-RGQQET---LHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNRWLQQYSHESA-NPGILVLLGCGTISSTCGQIASYPLALVRTRMQA------QASIE---------GGPQVSMVGLLRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGV 464          
BLAST of slc25a-22 vs. UniProt/SwissProt
Match: sp|Q7T0U6|SCM1B_XENLA (Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis OX=8355 GN=slc25a24-b PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.112e-141
Identity = 201/416 (48.32%), Postives = 287/416 (68.99%), Query Frame = 3
Query:  378 KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +F+ +L+  E ++K+AF  +D+N D KI+S EI  ++  LGI I +  A+++L  +D D  L +D++EW+   L + A ++Q II+YW+ S  +DIG+++TIPD+F+ +EK TG  WK L+AGG+AG VSRT TAPLDR+KV MQ HG+K  N  II  +K M+ EGG+ SLWRGNGV+  KI PE+A+KF +YE YKK       + +G +   ERF AG+LAGAT+Q  I+PMEVLKTR+ + ++GQYS ++DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++ET KN +L+ N+        V V L  G  SS CGQ A+YPLAL+RT++QA      Q+++           + ++ M  +FR I  +EGF G YRGIGPN LKV+PAVSISY V+++ +  LGI
Sbjct:   79 EFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKVLGIKISLDHADKILKSMDSDGTLTVDWNEWRDHFLFNPADNIQQIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLMAGGMAGAVSRTGTAPLDRLKVMMQVHGSK-GNSNIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLF----TSESGKLGTAERFVAGSLAGATAQTSIYPMEVLKTRLAVGRTGQYSGMFDCAKKIMQKEGIRAFYKGYIPNILGIIPYAGIDLAIYETLKNYWLQ-NHAKDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQA------QASIE---------GAPQLNMGGLFRKIVAKEGFLGLYRGIGPNFLKVLPAVSISYVVYEKMKVQLGI 473          
BLAST of slc25a-22 vs. UniProt/SwissProt
Match: sp|Q6KCM7|SCMC2_HUMAN (Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens OX=9606 GN=SLC25A25 PE=1 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 5.172e-141
Identity = 196/417 (47.00%), Postives = 286/417 (68.59%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E+F+ +L+  E +L+L FK +D+ +D +ID++EI +++ DLG+ I  ++AE++L  +D +  + ID++EW+ + L     ++ +II YW+ S   D+GEN+T+PD+F+V+E+ TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ H ++  N+GI+     MI EGG  SLWRGNG++  KI PESAIKF++YE  K    R+  +    + + ER  AG+LAGA +Q+ I+PMEVLKTRM LRK+GQYS + DCA+ +   EG   F++GYVPN+LGI+PYAGIDLA++ET KN +L+ +   +     V+V L  G  SS CGQ A+YPLALVRT++QA      Q+++           + ++TM S+F+ I + EG FG YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   70 EEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIK----RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQ-HYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQA------QASIE---------GAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGV 466          
BLAST of slc25a-22 vs. TrEMBL
Match: A0A0H3YF57 (Slc25a-22 OS=Schmidtea mediterranea OX=79327 GN=slc25a-22 PE=2 SV=1)

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 482/482 (100.00%), Postives = 482/482 (100.00%), Query Frame = 3
Query:  183 MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 1628
            MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG
Sbjct:    1 MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 482          
BLAST of slc25a-22 vs. TrEMBL
Match: A0A0H3YF46 (Slc25a-7 OS=Schmidtea mediterranea OX=79327 GN=slc25a-7 PE=2 SV=1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 307/461 (66.59%), Postives = 362/461 (78.52%), Query Frame = 3
Query:  249 EKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKS--EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +K +D +ITI  LK  LKN+ D  N +     +  K+  DK   E+FL F++S+ET LKLAF+QMD+N+DNKI + EIQ TMA+LG+ I IKEAE+LLS +D D NL IDYDEW+++LL S+AR ++DII++WRKS +ID+GENMTIPDDF+ +EK+ GIAWKTLVAGG+AGCVSRT TAPLDR+KVTMQAHGAK AN GIIN IK M++EGGVSSLWRGNGV+C KI PESAIKFL+YE YKK +   T N TG+VTL E+F AGA+AGAT+Q LI+PMEVLKTRM LRKSGQYSSI+DCAK VY  EG QVFFRGYVPN+LGI+PYAGIDLAL+ETFKN+YLKS N       P+YVSL SGA SSVCGQ ATYPLALVRTKLQA+                 +SD  KI+M +V R I K EG  GFYRGIGPN LKVIPAVSISYAVF+QTRH LGI
Sbjct:   24 DKNKDGVITIDELKEALKNQQDSENEILGLMKSTDKNADDKMSFEEFLNFVQSRETHLKLAFRQMDKNNDNKISADEIQITMAELGMNIDIKEAEKLLSHMDKDSNLNIDYDEWRSYLLLSNARDMKDIIRFWRKSFSIDLGENMTIPDDFTPEEKLKGIAWKTLVAGGIAGCVSRTATAPLDRLKVTMQAHGAKAANHGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLIVNFTQNETGNVTLGEKFVAGAMAGATAQTLIYPMEVLKTRMCLRKSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIYVSLCSGAVSSVCGQVATYPLALVRTKLQAMS----------------KSDG-KISMKNVSRDIIKNEGVLGFYRGIGPNMLKVIPAVSISYAVFEQTRHFLGI 467          
BLAST of slc25a-22 vs. TrEMBL
Match: A0A0V0J6L6 (Calcium-binding mitochondrial carrier protein SCaMC-1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=SCMC1 PE=3 SV=1)

HSP 1 Score: 509.99 bits (1312), Expect = 3.249e-173
Identity = 252/514 (49.03%), Postives = 347/514 (67.51%), Query Frame = 3
Query:  129 FDLLFLSLIHFKILFFINMSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDA--------------NNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQI-PVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            F + +  L   +  F+  M D+   N +   +  S   + +  +D  +++  L +++++E   A                +NT  + ++       ++F+E+++  ETQLKLAFKQ+DRN DN++D+ EI+  M +LGI +G KEA +LL ++D D +L+IDY EW+ FLL S + +++DI  YWR++ A+DIGE + +PDDF+ +E+ +G AWKTLVAGG+AGC+SRT TAPLDR+KV  QA G K A+ G+  + + M+SEGG +S+WRGNGV+C KI PESAIKF +YE++KK +    +     V L E+F AGA+AGAT+Q LI+PMEVLKTRM LRK+GQYSS++DCA+ ++   G  +F+RGYVPNL+GILPYAGIDLAL+ETFKN Y+KS    +++   PVYVSL +GA SSVCGQ ATYPLALVRTKLQA                     S+K +M  +F+SI K EGF G YRGIGPN LKVIPAVSISYA ++Q R L GI
Sbjct:   10 FSVHWWWLFLHRPNFYFEMEDNSQMNLDDRERVASLFSKLDVDKDGRVSVSELASIIRSEPQQAAVGSEAAKRVVGHGKPINTADTQQTMSF----QEFVEYVRDTETQLKLAFKQLDRNKDNQVDASEIRAAMRELGIEVGEKEAAKLLRKMDKDGSLSIDYQEWRDFLLLSGSSNIRDIFHYWRRASAVDIGEGILVPDDFTEEERKSGEAWKTLVAGGIAGCISRTATAPLDRVKVIWQARGGKAASTGLFGSFQKMLSEGGYASMWRGNGVNCIKIAPESAIKFQTYELFKKII--RGDRRDPYVALHEKFLAGAMAGATAQTLIYPMEVLKTRMCLRKTGQYSSMFDCARKLFAEHGIGIFYRGYVPNLIGILPYAGIDLALYETFKNFYVKSMGAKAEVGAPPVYVSLTAGALSSVCGQVATYPLALVRTKLQA--------------------QSEKSSMKKMFKSILKDEGFVGLYRGIGPNMLKVIPAVSISYACYEQCRGLFGI 497          
BLAST of slc25a-22 vs. TrEMBL
Match: A0A4E0RTX3 (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Fasciola hepatica OX=6192 GN=D915_004922 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 6.847e-172
Identity = 245/471 (52.02%), Postives = 338/471 (71.76%), Query Frame = 3
Query:  243 EAEKKQDTIITIQTLKNVLKNEHD-DANNLNTEK---SNESKDIADKS----EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNN-TTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQ-LQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E +  +D  +++  L  V++ E + + N++ T K   S  +++ A++S     +FL +++  ETQL+LAF+Q+DRNHD+ +D++EI+  M DLG+ I + +A++LL+R+D D +L ID+DEW+ FLL S    + +I +YW+++ AIDIGE+M +PDDF+ +EK TG AWKTLVAGG+AGCVSRT TAPLDRIK+  QA G K A +G+I T+  M+ EGGV SLWRGNGV+C KI PESAIKF +YE+YK+++  +  +   G V+L  +F +GA AGAT+Q +I+PMEVLKTRM LRKSGQYSSI+DCA+ ++   G+++F+RGYVPN+LGILPYAGI+LALFETFK  Y++  N   +    PVYVS+ +GA SSVCGQ  TYPLALVRTKLQ                 A  + S KI +V + ++I K EGF G +RG+GPN LKVIPAVS+SYA +DQ R + GI
Sbjct:   18 ELDVDKDGRVSVAELARVIRGETEGEGNHVETAKRIISRGTQNEANRSTLTFNEFLAYIRDTETQLRLAFRQLDRNHDSVVDAEEIRSAMKDLGVNISLADAQRLLNRMDKDGSLNIDFDEWRNFLLFSGTSRIDEIFQYWKRASAIDIGEDMLVPDDFTEEEKKTGQAWKTLVAGGIAGCVSRTVTAPLDRIKLFWQALGGKAAEVGLIGTVNKMLKEGGVGSLWRGNGVNCLKIAPESAIKFQTYELYKQWLGAVLGDEMNGPVSLQTKFLSGAFAGATAQTIIYPMEVLKTRMCLRKSGQYSSIFDCARKLHHEYGWRIFYRGYVPNMLGILPYAGIELALFETFKQSYVRYTNSGKEGATPPVYVSVTAGALSSVCGQLGTYPLALVRTKLQ-----------------AQTAGSDKIGLVQLCQNIVKNEGFTGLFRGLGPNMLKVIPAVSVSYACYDQLRLMFGI 471          
BLAST of slc25a-22 vs. TrEMBL
Match: A0A504YTN4 (Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Fasciola gigantica OX=46835 GN=FGIG_05234 PE=3 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 2.849e-171
Identity = 244/471 (51.80%), Postives = 337/471 (71.55%), Query Frame = 3
Query:  243 EAEKKQDTIITIQTLKNVLKN-EHDDANNLNTEK---SNESKDIADKS----EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNN-TTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQ-LQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E +  +D  +++  L  V++     + N++ T K   S  +++ A++S     +FL +++  ETQL+LAF+Q+DRNHD+ +D++EI+  M DLG+ I + +A++LL+R+D D +L ID+DEW+ FLL S    + +I +YW+++ AIDIGE+M +PDDF+ +EK TG AWKTLVAGG+AGCVSRT TAPLDRIK+  QA G K A +G+I T+  M+ EGGV SLWRGNGV+C KI PESAIKF +YE+YK+++  +  +   G V+L  +F++GA AGAT+Q +I+PMEVLKTRM LRKSGQYSSI+DCA+ ++   G+++F+RGYVPN+LGILPYAGI+LALFETFK  Y++  N   +    PVYVS+ +GA SSVCGQ  TYPLALVRTKLQ                 A  + S KI +V + ++I K EGF G +RG+GPN LKVIPAVS+SYA +DQ R + GI
Sbjct:   18 ELDVDKDGRVSVAELARVIRGGTEGEGNHVETAKRIISRGTQNEANRSTLTFNEFLAYIRDTETQLRLAFRQLDRNHDSVVDAEEIRSAMKDLGVNISLADAQRLLNRMDKDGSLNIDFDEWRNFLLFSGTSRIDEIFQYWKRASAIDIGEDMLVPDDFTEEEKKTGQAWKTLVAGGIAGCVSRTVTAPLDRIKLFWQALGGKAAEVGLIGTVNKMLKEGGVGSLWRGNGVNCLKIAPESAIKFQTYELYKQWLGAVLGDEMNGPVSLQTKFFSGAFAGATAQTIIYPMEVLKTRMCLRKSGQYSSIFDCARKLHHEYGWRIFYRGYVPNMLGILPYAGIELALFETFKQSYVRYTNSGKEGATPPVYVSVTAGALSSVCGQLGTYPLALVRTKLQ-----------------AQTAGSDKIGLVQLCQNIVKNEGFTGLFRGLGPNMLKVIPAVSVSYACYDQLRLMFGI 471          
BLAST of slc25a-22 vs. Ensembl Cavefish
Match: slc25a24 (solute carrier family 25 member 24 [Source:NCBI gene;Acc:103040313])

HSP 1 Score: 432.18 bits (1110), Expect = 1.515e-146
Identity = 210/426 (49.30%), Postives = 295/426 (69.25%), Query Frame = 3
Query:  363 ADKSEK--FLEF---LKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +DK E+  FLEF   L+  E +L L FK +D+N+D  ID +EIQ+ + DLG+ I  + AE++L  +D D  +++D++EW+   L + A  L++II+YW+ S  +DIG+++TIPD+F+ +EK TG+ WK L AG +AG VSRT TAPLDR+KV MQ H +K   + +++  K MI EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK + +      G +   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + + EG + F++GYVPN+LGI+PYAGIDLA++ET KN +L S          V V L  G  SS CGQ A+YPLALVRT++QA      Q+++           +++++M  + R I ++EGFFG YRGI PN +KVIPAVSISY V++  +  LGI
Sbjct:   69 SDKDEQLDFLEFCSYLQEHEKKLNLTFKSLDKNNDGSIDYREIQQALKDLGVNISKENAEKILKSIDADGTMSVDWNEWRNHFLFNPATDLEEIIRYWKHSTVLDIGDSLTIPDEFTEEEKTTGLWWKQLAAGAMAGAVSRTGTAPLDRMKVFMQVHSSKSNKISLVSGFKQMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSK----EGGKIRTHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILKKEGVKAFYKGYVPNILGIIPYAGIDLAIYETLKNTWL-SLYAKDTANPGVLVLLGCGTISSTCGQLASYPLALVRTRMQA------QASME---------GAEQVSMSKLVRKILEKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMKTGLGI 474          
BLAST of slc25a-22 vs. Ensembl Cavefish
Match: slc25a23a (calcium-binding mitochondrial carrier protein SCaMC-3 [Source:NCBI gene;Acc:103026535])

HSP 1 Score: 421.394 bits (1082), Expect = 1.881e-142
Identity = 198/418 (47.37%), Postives = 288/418 (68.90%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 1628
            E+F ++L+S E +L+L F  +DRN+D +ID  EIQ ++  +G+ +  +EA ++L  +D D  + ID+ EW+ + L +   S++DI  YW+ S  +DIGE++T+PD+FS +E+ +G  W+ L+AG +AG VSRT TAPLDR+KV +Q HG       +   +K+M+ EGG+ +LWRGNG++  KI PE+AIKFL+YE  K+ +    +   G + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLRK+GQYSS+ DCA+ + + EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+ +   S     V V +  G  SS CGQ A+YPLAL+RT++QA      Q++V             +++M+S+FRSI  QEG  G YRGI PN LKVIPAVSISY V++  R +LG+G
Sbjct:   68 EEFTQYLRSHEKRLRLMFSSLDRNNDGQIDVGEIQLSLQSVGVDVTYEEASKILQSMDKDGTMTIDWVEWRDYFLFNPLHSIEDIAHYWKHSLILDIGEHLTVPDEFSEKERKSGFVWRQLMAGAMAGSVSRTGTAPLDRLKVFLQVHGQSSDKGSVWKGLKAMVKEGGIRALWRGNGINVLKIAPETAIKFLAYEQIKRMMN--GSKDGGSLKVQERFIAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDLAVYETLKNTWLQRHRCDSA-DPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQA------QASVK---------GGPQLSMLSLFRSIVAQEGVVGLYRGIAPNFLKVIPAVSISYVVYEHMRKVLGVG 467          
BLAST of slc25a-22 vs. Ensembl Cavefish
Match: slc25a23a (calcium-binding mitochondrial carrier protein SCaMC-3 [Source:NCBI gene;Acc:103026535])

HSP 1 Score: 415.231 bits (1066), Expect = 1.166e-139
Identity = 198/417 (47.48%), Postives = 286/417 (68.59%), Query Frame = 3
Query:  375 EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTT--GDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            E+F ++L+S E +L+L F  +DRN+D +ID  EIQ ++  +G+ +  +EA ++L  +D D  + ID+ EW+ + L +   S++DI  YW+ S  +DIGE++T+PD+FS +E+ +G  W+ L+AG +AG VSRT TAPLDR+KV +Q HG       +   +K+M+ EGG+ +LWRGNG++  KI PE+AIKFL+YE  K    R+ N +   G + + ERF AG+LAGAT+Q +I+PMEVLKTR+TLRK+GQYSS+ DCA+ + + EG   F++GY+PN+LGI+PYAGIDLA++ET KN +L+ +   S     V V +  G  SS CGQ A+YPLAL+RT++QA      Q++V             +++M+S+FRSI  QEG  G YRGI PN LKVIPAVSISY V++  R L+
Sbjct:   84 EEFTQYLRSHEKRLRLMFSSLDRNNDGQIDVGEIQLSLQSVGVDVTYEEASKILQSMDKDGTMTIDWVEWRDYFLFNPLHSIEDIAHYWKHSLILDIGEHLTVPDEFSEKERKSGFVWRQLMAGAMAGSVSRTGTAPLDRLKVFLQVHGQSSDKGSVWKGLKAMVKEGGIRALWRGNGINVLKIAPETAIKFLAYEQIK----RMMNGSKDGGSLKVQERFIAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSSVVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDLAVYETLKNTWLQRHRCDSA-DPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQA------QASVK---------GGPQLSMLSLFRSIVAQEGVVGLYRGIAPNFLKVIPAVSISYVVYEHMRVLI 480          

HSP 2 Score: 60.8474 bits (146), Expect = 2.110e-9
Identity = 39/193 (20.21%), Postives = 88/193 (45.60%), Query Frame = 3
Query:  735 LVAGGVAGCVSRTTTAPLDRIK--VTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLR---KSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQ 1298
             +AG +AG  ++T   P++ +K  +T++  G   +   +++  + ++ + GV + ++G   +   I P + I    YE  K    +     + D  ++     G ++    Q   +P+ +++TRM  +   K G   S+    +++   EG    +RG  PN L ++P   I   ++E  + +  +  + + Q
Sbjct:  300 FIAGSLAGATAQTIIYPMEVLKTRLTLRKTGQYSS---VVDCARQILQKEGVLAFYKGYIPNILGIIPYAGIDLAVYETLKNTWLQRHRCDSADPGVLVLVGCGTVSSTCGQLASYPLALIRTRMQAQASVKGGPQLSMLSLFRSIVAQEGVVGLYRGIAPNFLKVIPAVSISYVVYEHMRVLIFRLTDHSHQ 489          
BLAST of slc25a-22 vs. Ensembl Cavefish
Match: slc25a25a (calcium-binding mitochondrial carrier protein SCaMC-2-A [Source:NCBI gene;Acc:103038782])

HSP 1 Score: 413.69 bits (1062), Expect = 2.559e-139
Identity = 202/446 (45.29%), Postives = 292/446 (65.47%), Query Frame = 3
Query:  288 KNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            K +LK E  D N           D     E+F+ +L+  E  LKL FK +D+ +  K  + EI E++ +LG+ I +++AE +L  +D +  + ID++EW+ +  Q    ++ +II YW+ S   D+GEN+ +PD+F+ +E++TG+ W+ LVAGG AG VSRT TAPLDR+KV MQ HG++ +N+ +++ +  MI EGG+ SLWRGNG++  KI PESA+KF++YE  K+ +    N T G   + ERF AG+LAG  +Q+ I+PMEVLKTR+ LRK+GQY+ I DCAK + + EG   F++GYVPN+LGI+PYAGIDLA++ET KN +L+    T      V+V L  G  SS CGQ A+YPLALVRT++QA      Q+TV+          S +++M  +F+ I K EG  G YRG+ PN +KVIPAVSISY V++  +  LG+
Sbjct:   53 KKILKTEEQDKNG--------QLDF----EEFVHYLQDHEKDLKLVFKSLDKKNAGKASASEIVESLRELGVHISLQQAESVLKSMDKNGTMTIDWNEWRNYPSQQPTDNIPEIILYWKHSTIFDVGENLMVPDEFTTEERLTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHGSRSSNMCLMSGLTQMIKEGGLRSLWRGNGINVIKIAPESALKFMAYEQIKRLMGS-ENETLG---ITERFVAGSLAGVIAQSTIYPMEVLKTRLALRKTGQYTGISDCAKQILKREGMTAFYKGYVPNMLGIVPYAGIDLAVYETLKNTWLQQYG-TDSTNPGVFVLLACGTISSTCGQLASYPLALVRTRMQA------QATVD---------GSSQVSMSGLFKQIMKTEGPTGLYRGMTPNFMKVIPAVSISYVVYEHIKSTLGV 466          
BLAST of slc25a-22 vs. Ensembl Cavefish
Match: ENSAMXT00000052808.1 (calcium-binding mitochondrial carrier protein SCaMC-1-like [Source:NCBI gene;Acc:111189548])

HSP 1 Score: 410.223 bits (1053), Expect = 5.367e-138
Identity = 198/419 (47.26%), Postives = 289/419 (68.97%), Query Frame = 3
Query:  378 KFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGD-VTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGAT--SSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +F  +LK  E +L L FK +D+N+D ++D+ EI++++++LG+ I  + A ++L  +D+D  + +D++EW+   L + A  L++II+YW+ S  +DIG+N+ IPD+F+ +EK TG  WK LVAG  AG VSRT TAPLDRIKV MQ H ++   +G++   + M+ EGGV+SLWRGNG++  KI PE+AIKF++YE YKK +      + GD +   +RF AG+LAGAT+Q +I+PMEV+KTR+TLR +GQYS + DCAK + + EG + F +GYVPNLLGI+PYAGIDLA++E+ KN +L  ++       P  + LL   T    V GQ A+YPLALVRT++QA      Q+ ++          +Q+++M S+ +SI  +EGF G YRGI PN +KVIPAVSISY V++ T+  LGI
Sbjct:   72 EFTRYLKEHEKKLWLTFKSLDKNNDGRLDACEIKQSLSELGMDISTEAALKILQSIDVDGTMTVDWNEWREHFLFNPATDLEEIIRYWKHSSQLDIGDNLAIPDEFTSEEKTTGGWWKQLVAGATAGAVSRTGTAPLDRIKVFMQVHASRSNRIGLVGGFRQMLREGGVASLWRGNGLNVLKIAPETAIKFMAYEQYKKLL------SEGDKIGTTQRFMAGSLAGATAQTVIYPMEVMKTRLTLRSTGQYSGMMDCAKTILKKEGIKAFSKGYVPNLLGIIPYAGIDLAVYESLKNAWL--SHYARDTANPGVLCLLGCGTVFQHVVGQLASYPLALVRTRMQA------QACLDS---------AQQMSMRSLMKSIVMKEGFLGLYRGILPNFMKVIPAVSISYVVYEYTKSSLGI 467          
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 421.779 bits (1083), Expect = 6.469e-143
Identity = 202/429 (47.09%), Postives = 301/429 (70.16%), Query Frame = 3
Query:  342 SNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYL-KSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            S++ +D     E+F+++L+  E +LKL FK +D+N+D +ID+ EI +++  LG+ I + +AE++L  +D D  + ID+ EW+ + L   A ++++II YW+ S   D+G+++T+PD+F+ +E+ +G+  + L+AGG AG VSRT TAPLDR+KV MQ HG+K  N+ I+   K MI EGG++SLWRGNGV+  KI PE+AIKF++YE  KKF+   +NN +  + + ERF AG+LAGAT+Q +I+PMEV+KTR+TLRK+GQYS + DCAK ++  EG   F++GYVPN++GI+PYAGIDLA++ET KN +L K   +T+   I   V L  G  SS CGQ A+YPLAL+RT++QA      Q+++             +++MV +FR+I K +G  G YRGI PN +KVIPAVSISY V++  + +LG+
Sbjct:   83 SDKDQDGQLDFEEFVKYLRDHEKKLKLVFKSLDKNNDGRIDAAEIVQSLQSLGVEISLSQAEKVLRSMDKDGTMTIDWSEWRDYHLLHPAANIREIILYWKHSTIFDVGDSLTVPDEFTEEERKSGMWLRQLMAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNISILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKFIG--SNNVS--LGIHERFMAGSLAGATAQTIIYPMEVMKTRLTLRKTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYETLKNTWLTKYAKDTADPGI--LVLLACGTVSSSCGQVASYPLALIRTRMQA------QASME---------GGPQLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVLGV 490          
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.939 bits (829), Expect = 2.376e-107
Identity = 160/324 (49.38%), Postives = 215/324 (66.36%), Query Frame = 3
Query:  657 IDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYL-KSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +D+G++M +PD+F+ +E+ +G  W+ LVAGG AG VSRT TAPLDR+KV MQ   ++   +G++  +  MI EGGV SLWRGNGV+  KI PE+AIKF++YE  KK +          + + ER  AG+LAGAT+Q +I+PMEV+KTR+ L K+GQYSS+ DCA+ + + EG + FF+GY+PN+LGI+PYAGIDLA +ET KN +L K   E +   I V   L    TSS CGQ A+YPLALVRT++QA              S      SQ   MV + RSI +Q+G  G YRGI PN +KVIPAV ISY V++  +  LG+
Sbjct:    2 LDVGDSMAVPDEFTEEERRSGTWWRQLVAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLI----GMRQEQIGVQERLVAGSLAGATAQTVIYPMEVVKTRLALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQKHGAEGANPGIAVL--LCCATTSSTCGQLASYPLALVRTRMQAA------------ASIGGPGASQP-GMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLKGALGV 306          
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Match: slc25a16 (solute carrier family 25 member 16 [Source:ZFIN;Acc:ZDB-GENE-030131-3299])

HSP 1 Score: 135.576 bits (340), Expect = 1.091e-35
Identity = 89/322 (27.64%), Postives = 159/322 (49.38%), Query Frame = 3
Query:  726 W-KTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGA--------LAGATSQNLIFPMEVLKTRMTLRKSGQ--YSSIYDCAKNVYRTE-GFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYL-----------KSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGF-FGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            W +  +AGG+AGC ++TT APLDR+K+ +QA+     +LG+ +T+ ++  + G   L++GNG    +I P  AI+F ++E YK    R+ +   G    + R  AG+          G T+    +P+++++ R+  +  G   Y  I      +Y+ E GF+ F+ G VP ++G+ PYAG     F T K++ L             N +   L+ P  ++LL G T+    Q  +YPL + R ++Q          +   E+F         +M     ++ KQ G   G YRG+  N ++ +P+ ++++  ++  R +L
Sbjct:   35 WMRNFLAGGIAGCCAKTTIAPLDRVKILLQAYNPHYKHLGVFSTLVAIPRKEGFLGLYKGNGAMMVRIFPYGAIQFTAFEKYK----RVLSKQMGITGHVHRLLAGSHGWYLSPCAPGITAVIFTYPLDMVRARLAYQVKGDHGYRGILHAFSLIYKKEGGFRGFYHGLVPTIIGMAPYAGFSFFTFSTLKSVGLTRAPALLGRPSADNPDVLVLRTP--INLLFGGTAGAIAQTISYPLDVARRRMQ------LAGILPNSENFG--------SMWQTLTNVYKQYGVRRGLYRGLSLNYVRCVPSQAVAFTTYEFMRQVL 336          
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 90.8929 bits (224), Expect = 1.995e-20
Identity = 68/295 (23.05%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  729 KTLVAGGVAGCVSRTTTAPLDRIKVTMQA-HGAKVANL-----GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKK-FVCRITNNTTGDVTLMERFYAGAL-----AGATSQNLIFPMEVLKTRMTL-----RKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLK 1562
            K  +AGG+A  +S+T  AP++R+K+ +Q  H +K   +     GI++ +  +  E G  S WRGN  +  +  P  A+ F   + YK+ F+  +  +         R++AG L     AGATS   ++P++  +TR+       +   ++  + DC   +++++G +  ++G+  ++ GI+ Y      +++T K + L +   T     P+ VS +   + +      +YP   VR ++               +S    +D      +  ++ I +QEG   F++G   N ++
Sbjct:   12 KDFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQ-----FWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGQAEREFKGLADCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGM-LPNPKST-----PLVVSWMIAQSVTAVSGIVSYPFDTVRRRM-------------MMQSGRKGADIMYRGTIDCWKKILQQEGGKAFFKGAWSNVIR 282          

HSP 2 Score: 69.3218 bits (168), Expect = 3.131e-13
Identity = 52/216 (24.07%), Postives = 92/216 (42.59%), Query Frame = 3
Query:  999 TTGDVTL--MERFYAGALAGATSQNLIFPMEVLKTRMTLRKSG-------QYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            T  DV +  ++ F AG +A A S+  + P+E +K  + ++ +        QY  I DC   + R +GF  F+RG + N++   P   ++ A  + +K I+L   ++  Q       +L SG  +        YPL   RT+L A   V       +F+  A                I K +G  G Y+G   +   +I   +  + ++D  + +L
Sbjct:    2 TMSDVAIGFLKDFMAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAVDQQYKGIMDCVVRIPREQGFVSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAA--DVGKGQAEREFKGLA-----------DCISKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGIYDTAKGML 204          
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 85.5001 bits (210), Expect = 1.686e-18
Identity = 61/254 (24.02%), Postives = 117/254 (46.06%), Query Frame = 3
Query:  840 GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
            G ++    ++   GV+SLW G   +     P + I F SY++ +  + R  N+    +     F AGA+A   +  +I P+E+++T+M  R+   Y  + +C ++    +G++  +RG+ P +   +P++G+    +E  K+  + S       Q    +   SGA S      AT P  +V+T+ Q I +   + T   F         + I+  +  + I  + G  G + G  P  +KV PA +I  + ++
Sbjct:   55 GTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNSQHPSIP----FVAGAVARLGAVTVISPLELIRTKMQSRQL-TYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLMGSAGVN---QATFLIHFTSGAVSGTFAGIATLPFDVVKTRRQ-IELGEMEITKGAF---------RDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYE 290          

HSP 2 Score: 75.485 bits (184), Expect = 3.565e-15
Identity = 50/193 (25.91%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  735 LVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLR------KSGQYSSI--YDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNE 1289
             VAG VA   + T  +PL+ I+  MQ+       L     ++  +++ G  SLWRG G + F+  P S + +L+YE+ K  +  + +      T +  F +GA++G  +     P +V+KTR  +         G +  I  +   K +Y   G +  F G++P ++ + P   I ++ +E  K+ + K N +
Sbjct:  114 FVAGAVARLGAVTVISPLELIRTKMQSRQLTYKELS--ECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGL--MGSAGVNQATFLIHFTSGAVSGTFAGIATLPFDVVKTRRQIELGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYEFGKSFFRKLNQQ 302          
BLAST of slc25a-22 vs. Ensembl Yeast
Match: YPR011C_mRNA (Mitochondrial transporter; major substrates are adenosine 5'-phosphosulfate (APS) and 3'-phospho-adenosine 5'-phosphosulfate (PAPS); member of the mitochondrial carrier family; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000006215])

HSP 1 Score: 154.066 bits (388), Expect = 1.240e-42
Identity = 91/305 (29.84%), Postives = 159/305 (52.13%), Query Frame = 3
Query:  735 LVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVA-NLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRIT-NNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYS-------------SIYDCAKNVYRTE-GFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
             +AGGVAG VSRT  +P +R+K+ +Q   +  + N GI ++I+ +  E G   L+RGNG++C +I P SA++F+ YE  KK +  +  NN    +T  +R ++GAL G  S    +P++++KTR++++ +   S              I+      YR E G +  +RG  P  LG++PY  ++ A++E  +   + S++     +  +Y  L  GA S    Q  TYP  L+R + Q + M               +  S    +V++ R+    EG  G+Y+G+  N  KV+P+ ++S+ V++
Sbjct:   26 FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLY-KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGG--------NELGFRYTSVWDALVTIGRA----EGVSGYYKGLAANLFKVVPSTAVSWLVYE 317          

HSP 2 Score: 97.0561 bits (240), Expect = 1.510e-22
Identity = 62/202 (30.69%), Postives = 103/202 (50.99%), Query Frame = 3
Query: 1029 FYAGALAGATSQNLIFPMEVLKTRMTLRKS------GQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHL 1616
            F AG +AGA S+ ++ P E +K  + ++ S      G +SSI    + VY  EG +  FRG   N + I PY+ +   ++E  K      N    Q Q+     L SGA    C   ATYPL L++T+L      +  S++N+ ++ +I        ++S   + + + G  G YRG+ P +L V+P V++++AV++Q R  
Sbjct:   26 FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSI----RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSI--QTANLSSLNRSKAKSISKPPGIWQLLS--ETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREF 219          
BLAST of slc25a-22 vs. Ensembl Yeast
Match: TPC1 (Mitochondrial membrane transporter; mediates uptake of the essential cofactor thiamine pyrophosphate (ThPP) into mitochondria; expression appears to be regulated by carbon source; member of the mitochondrial carrier family [Source:SGD;Acc:S000003328])

HSP 1 Score: 117.857 bits (294), Expect = 9.555e-30
Identity = 85/309 (27.51%), Postives = 143/309 (46.28%), Query Frame = 3
Query:  723 AWKTLVAGGVAGCVSRTTTAPLDRIKVTMQ---AHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFA---TYPLALVRTKLQAIPMVSYQSTVNQFESFAIQS----DSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            AWKTL+AG V+G ++R+ TAP+D IK+ +Q   A+G K     ++   +SMI   G+ S W+GN           + +F SY ++ +++        G    +     GA AG TS  + +P +VL+TR+         SI    +++++ EG   FF+G + ++  I   A I    +ET + IY   N +T+       ++ L+ +  ++ G  A   T+PL  +R ++Q +            E F+  S      +      +   I KQEG    YRGI     K IP   +S+  ++   H L
Sbjct:   16 AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF-----GLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR-IYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFM-------NSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIHYL 311          
BLAST of slc25a-22 vs. Ensembl Yeast
Match: LEU5 (Mitochondrial carrier protein; involved in the accumulation of CoA in the mitochondrial matrix; homolog of human Graves disease protein SLC25A16, which complements yeast null mutant; does not encode an isozyme of Leu4p, as first hypothesized [Source:SGD;Acc:S000001044])

HSP 1 Score: 116.701 bits (291), Expect = 4.197e-29
Identity = 81/341 (23.75%), Postives = 152/341 (44.57%), Query Frame = 3
Query:  729 KTLVAGGVAGCVSRTTTAPLDRIKVTMQ---AHGAKVAN--LGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTL---MERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQV----------------FFRGYVPNLLGILPYAGIDL------------ALFETFKNIYLKSNNETSQLQ------IPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            ++ +AGG++G  ++T  APLDRIK+  Q    H  K     +G++   K +    GV   ++G+  +  +I P +A+KF++YE       +I N             R  +G+LAG  S  + +P+++++ R+      +   +    K +Y+                      F+RGYVP +LG++PYAG+                F  +  + L  ++E  ++Q      +  +  L+SG  + +  Q A YP  ++R +LQ   +       ++F+S +            +   I K+ G  GF+ G+    +KV P V+ S+ V+++ +   GI
Sbjct:   35 RSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYE-------QIRNTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSIS-----------EIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI 357          
BLAST of slc25a-22 vs. Ensembl Yeast
Match: SFC1 (Mitochondrial succinate-fumarate transporter; transports succinate into and fumarate out of the mitochondrion; required for ethanol and acetate utilization [Source:SGD;Acc:S000003856])

HSP 1 Score: 109.768 bits (273), Expect = 6.443e-27
Identity = 91/324 (28.09%), Postives = 153/324 (47.22%), Query Frame = 3
Query:  735 LVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANL------GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIF-PMEVLKTRMTLRK--------SGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTR-HLLGIG*SFGQSNIPK 1658
            L+AGG AG        PLD IKV MQ +  +VA +      G I T +++  + G  +L++G G     I P+ AI+F SYE Y+     + N  +G V+    F AG  AG T   L+  PMEV+K R+  +           +Y++    A  + + EG    +RG            G +  ++   K  +L++ ++   L  P + +   G  S   G F+  PL  ++T+LQ    +S +           QS  +KI  +++   + K+EGF   Y+GI P  ++V P  ++++ V++  R HL  +G  F +++ PK
Sbjct:   14 LMAGGTAGLFEALCCHPLDTIKVRMQIY-RRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTL---LVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKE-FLQNYHQMDVL--PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEK----------QSGMKKI--ITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHLENLG-IFKKNDTPK 317          
BLAST of slc25a-22 vs. Ensembl Yeast
Match: MRS4 (Iron transporter of the mitochondrial carrier family; mediates Fe2+ transport across the inner mitochondrial membrane; active under low-iron conditions; may transport other cations; protein abundance increases in response to DNA replication stress; MRS4 has a paralog, MRS3, that arose from the whole genome duplication [Source:SGD;Acc:S000001760])

HSP 1 Score: 109.383 bits (272), Expect = 6.529e-27
Identity = 80/296 (27.03%), Postives = 138/296 (46.62%), Query Frame = 3
Query:  735 LVAGGVAGCVSRTTTAPLDRIKVTMQAHGA-KVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            L+AG  AG +  +   P+D +K  +QA G  K A+ G+I+ I  + +  G  +LW+G        GP  A+ F +YE  K  +    +  T     M+   +G +A   +  L+ P + +K R+ L  + +   +++  K +Y+ EGF  F+  Y   L   +P+A  +  ++E+    +   N+       P+   L  G + + C    T PL  ++T LQ    V    TV    S  I  D+      S  R+I +  G+ GF+RG+ P  +  IPA +IS+  ++  +H L
Sbjct:   27 LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQP--MKTALSGTIATIAADALMNPFDTVKQRLQLDTNLR---VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYN-----PLIHCLCGGISGATCAALTT-PLDCIKTVLQ----VRGSETV----SIEIMKDANTFGRAS--RAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301          
BLAST of slc25a-22 vs. Ensembl Nematostella
Match: EDO32185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT7])

HSP 1 Score: 378.637 bits (971), Expect = 4.312e-126
Identity = 200/468 (42.74%), Postives = 280/468 (59.83%), Query Frame = 3
Query:  243 EAEKKQDTIITIQTLKNVLKNEHDDANNLNTEK-----SNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTF-LLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIP-VYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            E +K QD  I +  L   LK  H         +      +E+ D     E+F+ ++ S E +L + FK +D +    +D+ EI+     + + +  +E + LL R+D D  L ++++EW+ + LL  S  S+ DII++WR +  +DIGE+M +PD+F+  EK +G+ W+ LVAGG AG VSRT TAPLDR+KV +Q   +     GI++  K M+ EGG+ SLWRGNG +  KI PES IKF +YE  KK V     + T  + + +R  AG++AG  SQ  I+P+EVLKTR+ +RK+GQY  +   A  +Y+ EG + F+RG  P+LLGI+PYAGIDLA++ET KN YL  N   +Q   P V V L  G  SS CGQ A+YPL+LVRT+LQA             E    Q D+    MVSV R I  ++GF G YRG+ PN LKV PAVSISY V++  R  LG+
Sbjct:   23 ELDKNQDGKIDVNELAEGLKKLHGPRYKPGQAQQIMTLGDETLDGHLSFEEFVNYITSHEKKLWIVFKSIDLDDSGSVDASEIKRAFEKMDMKVTQQEVDLLLKRMDKDKTLKVNWNEWREYHLLNPSGHSMHDIIQFWRHTIYLDIGEDMLVPDEFTEAEKRSGMWWRQLVAGGGAGVVSRTATAPLDRLKVLLQVQASSTNRFGIVSGFKMMLREGGIKSLWRGNGANVIKIAPESGIKFFAYEKAKKLV----GSDTKALGVTDRLLAGSMAGVASQTSIYPLEVLKTRLAIRKTGQYRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDLAVYETLKNFYL--NYHKNQSADPGVLVLLACGTASSTCGQLASYPLSLVRTRLQA----------QAREKGGGQGDN----MVSVLRKIITEDGFKGLYRGLAPNFLKVAPAVSISYVVYENLRLGLGV 470          
BLAST of slc25a-22 vs. Ensembl Nematostella
Match: EDO34426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF1])

HSP 1 Score: 169.088 bits (427), Expect = 1.173e-47
Identity = 100/312 (32.05%), Postives = 168/312 (53.85%), Query Frame = 3
Query:  726 WKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQ-YSSIYDCAKNVYRTEG---FQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQ----------LQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            +K L+AGG+AG VSRT+ +PL+R+K+ +Q         G++ T+  +  E G+   ++GNG +  +I P SA++F +YE YKK +  I ++     T ++R  AGA+AG TS    +P+++++TR++ + + + Y  I    + +   EG       +RG VP  +GI PY G++ A++ET K     +   +SQ           ++PV   L+ G+ +    Q ATYPL +VR ++Q                  I++D    + +  F SI K EGF G Y+G+ PN LKV P+V I +A ++ ++  L
Sbjct:   35 FKHLLAGGIAGAVSRTSVSPLERVKILLQIQVKNPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKKLL-NIPDDPEHQ-TPIKRLVAGAMAGVTSITATYPLDLIRTRLSAQGADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFLFSTVMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMK---------------GIRADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILKVAPSVGIQFAAYELSKSFL 329          
BLAST of slc25a-22 vs. Ensembl Nematostella
Match: EDO38453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCS6])

HSP 1 Score: 164.081 bits (414), Expect = 3.704e-46
Identity = 96/299 (32.11%), Postives = 163/299 (54.52%), Query Frame = 3
Query:  732 TLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPV-YVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGF-FGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLG 1622
            +L +G +AG V++T  APLDR K+  Q    + +  G+++ +    +  G + L+RGN  +  ++ P ++I+F S+E YKK + RI +   G +  + RF AG+LAG T+  L +P+++++ R+ + +  +Y+ + +    +YR EG + F+RGYVP L+GI+PYAGI    +ET K    K+  E    + P  +  L  GA + + GQ ATYP+ +VR ++QA             +        +   M S  + + K EG   G Y+G+  N +K   AV IS+ V+D  +  +G
Sbjct:    6 SLTSGAIAGAVAKTAIAPLDRTKIIFQTSNTRFSVQGVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKLL-RI-DEGKGALPPVRRFVAGSLAGMTAALLTYPLDMVRARLAITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCK----KAFGEFYDGKKPTPFHRLAFGACAGLFGQSATYPIEIVRRRMQA-------------DGIYGPRRPEYAHMWSTAKYVYKTEGLRTGLYKGLSLNWVKGPVAVGISFTVYDLMQAFIG 285          

HSP 2 Score: 66.6254 bits (161), Expect = 3.707e-12
Identity = 44/155 (28.39%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  729 KTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTL-----RKSGQYSSIYDCAKNVYRTEGFQ 1178
            +  VAG +AG  +   T PLD ++  + A   K    G+IN    +  + G+ + +RG   +   I P + I F +YE  KK      +      T   R   GA AG   Q+  +P+E+++ RM        +  +Y+ ++  AK VY+TEG +
Sbjct:  101 RRFVAGSLAGMTAALLTYPLDMVRARL-AITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAFGEFYDGK--KPTPFHRLAFGACAGLFGQSATYPIEIVRRRMQADGIYGPRRPEYAHMWSTAKYVYKTEGLR 252          
BLAST of slc25a-22 vs. Ensembl Nematostella
Match: EDO37153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK5])

HSP 1 Score: 150.599 bits (379), Expect = 4.173e-41
Identity = 90/308 (29.22%), Postives = 159/308 (51.62%), Query Frame = 3
Query:  732 TLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQ--YSSIYDCAKNVYRTEGFQV-FFRGYVPNLLGILPYAGIDLALFETFKNIYL-------KSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKI-TMVSVFRSIKKQEGF-FGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            T VAGG++ C ++TTTAPL+R+K+  QA      N+ +   +K++  + G+   ++GNG    ++ P  +I+F+SYE YK        N+      + +  AG LAG T+ +  +P++++++R+  + + +  Y  I    K ++ TEG  V  +RG+ P  L ++P  GI    FE+FK+ ++       + + ET +  +     LL GA +    Q   YPL +VR ++Q    V               +D  K  T ++ F S+  ++G   G YRG+  N L+V P V++ +AV++  + LL
Sbjct:    9 TFVAGGLSTCCAKTTTAPLERLKILFQAQNKHYKNMSVFGALKAIYKKEGLQGYYKGNGAMMVRVFPYGSIQFVSYEQYKLLFENALQNSH-----LSKIVAGGLAGLTACSCTYPLDIVRSRLAFQVADEHTYCGICQTVKQIFMTEGGMVALYRGFTPTSLSMIPAVGIGFYAFESFKDFFVAMKGVLTRIHPETGETVLTAPGGLLCGALAGATSQTLAYPLDVVRRRMQLAGTV---------------ADGHKYSTCINTFISVYTEDGIRRGLYRGLSINYLRVCPQVAVMFAVYEVVKQLL 296          
BLAST of slc25a-22 vs. Ensembl Nematostella
Match: EDO29140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4H4])

HSP 1 Score: 154.066 bits (388), Expect = 4.440e-41
Identity = 122/464 (26.29%), Postives = 218/464 (46.98%), Query Frame = 3
Query:  243 EAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMT----IPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVAN-LGIINTIKSMISEG-GVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTL-----RKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
            E ++  D  I+   L+   K    + +N +    +  +D   +   F  F K    +L+  FK++D ++   ID  EI   +  L I +  ++ + +L  +DL+++  ID+DE+  F     + +LQ I K W     +D G ++      P +  + + M+        AGGVAG  SRT TAPL+++K+  Q   A+ ++    I  + +MI +G G+  L+ GN  +C ++ P SAI  L Y    K+     +N       + RF +GA AG  +     P++V++ R+T+     R    Y+ I    + ++  EG +  ++G VP+L+ I P+ G+  ++++  K   L S    +         L+ GA + +  Q   +PL +VR ++Q          V++  S +I       T +S  + + KQ G    Y G+  + LKV+PA + S  V D
Sbjct:   13 EVDESADHRISWAELQQCCKKLQIELDNDDQSVFHSCEDQQGEGLSFNGFCKFVTLRLEKIFKEIDEDNSGYIDHNEISNALKKLDINLPSRQIDGILKGMDLNNDNRIDFDEFCAFFSDIPSPNLQLIAKKWSSGVGLDFGSDIAPTSIPPTEMPLVQFMS--------AGGVAGVASRTLTAPLEKMKIIAQVWKAQTSSGRSSIANMFTMIWKGEGIRGLFSGNLTNCVRVFPTSAIVCLVYSRMIKYTP--VDNDKNPHQPLWRFVSGATAGVVATASTHPLDVVRARLTVQDMSTRSISNYTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQQSVYDIMKLRALDSAFAANSGTF-----LVCGAIAGMIAQTVVHPLDVVRRQMQ----------VDRGRSGSITQ-----TSLSALKILWKQGGPRRIYAGLTASYLKVMPAAATSLLVRD 446          
BLAST of slc25a-22 vs. Ensembl Medaka
Match: slc25a24 (calcium-binding mitochondrial carrier protein SCaMC-1 [Source:NCBI gene;Acc:101160474])

HSP 1 Score: 436.032 bits (1120), Expect = 4.836e-148
Identity = 209/443 (47.18%), Postives = 302/443 (68.17%), Query Frame = 3
Query:  297 LKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +K E+  A  + +       D  D SE F  +LK  E ++KL FK +D+N D +I+  EI++++ADLG+ I  +EA+ +L  +D D  +++D++EW+   L +   +LQ+II+YW+ S  +DIG++++IPD+F+ +EK+TG+ WK L+AG  AG VSRT TAPLDR+KV MQ H +K   + ++N  K M+ EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK +    ++ +G V   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++E+ KN +L S +        V V L  G  SS CGQ A+YPLAL+RT++QA                A    S++++M S+ + I  ++GFFG YRGI PN +KVIPAVSISY V++  R  LGI
Sbjct:   52 IKTENQAAQKIISAGDKNKDDFLDFSE-FSRYLKDHEKKIKLVFKSLDKNKDGEINLAEIKQSLADLGLNISTEEAKTILQSIDADGTMSVDWNEWRDHFLFNPVNNLQEIIRYWKHSTVLDIGDSLSIPDEFTEEEKITGMWWKQLMAGAAAGAVSRTGTAPLDRMKVFMQVHASKSNKISMVNGFKQMLKEGGVTSLWRGNGVNVLKIAPETAIKFMAYEQYKKLL----SSNSGKVQTHERFIAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILKKEGVKAFYKGYIPNILGIIPYAGIDLAVYESLKNFWL-SKHAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAA---------------ASLEGSEQLSMGSMVKQILAKDGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 473          
BLAST of slc25a-22 vs. Ensembl Medaka
Match: slc25a24 (calcium-binding mitochondrial carrier protein SCaMC-1 [Source:NCBI gene;Acc:101160474])

HSP 1 Score: 436.417 bits (1121), Expect = 5.813e-148
Identity = 209/443 (47.18%), Postives = 302/443 (68.17%), Query Frame = 3
Query:  297 LKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +K E+  A  + +       D  D SE F  +LK  E ++KL FK +D+N D +I+  EI++++ADLG+ I  +EA+ +L  +D D  +++D++EW+   L +   +LQ+II+YW+ S  +DIG++++IPD+F+ +EK+TG+ WK L+AG  AG VSRT TAPLDR+KV MQ H +K   + ++N  K M+ EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK +    ++ +G V   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++E+ KN +L S +        V V L  G  SS CGQ A+YPLAL+RT++QA                A    S++++M S+ + I  ++GFFG YRGI PN +KVIPAVSISY V++  R  LGI
Sbjct:   71 IKTENQAAQKIISAGDKNKDDFLDFSE-FSRYLKDHEKKIKLVFKSLDKNKDGEINLAEIKQSLADLGLNISTEEAKTILQSIDADGTMSVDWNEWRDHFLFNPVNNLQEIIRYWKHSTVLDIGDSLSIPDEFTEEEKITGMWWKQLMAGAAAGAVSRTGTAPLDRMKVFMQVHASKSNKISMVNGFKQMLKEGGVTSLWRGNGVNVLKIAPETAIKFMAYEQYKKLL----SSNSGKVQTHERFIAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILKKEGVKAFYKGYIPNILGIIPYAGIDLAVYESLKNFWL-SKHAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAA---------------ASLEGSEQLSMGSMVKQILAKDGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 492          
BLAST of slc25a-22 vs. Ensembl Medaka
Match: slc25a24 (calcium-binding mitochondrial carrier protein SCaMC-1 [Source:NCBI gene;Acc:101160474])

HSP 1 Score: 436.417 bits (1121), Expect = 7.642e-148
Identity = 209/443 (47.18%), Postives = 302/443 (68.17%), Query Frame = 3
Query:  297 LKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +K E+  A  + +       D  D SE F  +LK  E ++KL FK +D+N D +I+  EI++++ADLG+ I  +EA+ +L  +D D  +++D++EW+   L +   +LQ+II+YW+ S  +DIG++++IPD+F+ +EK+TG+ WK L+AG  AG VSRT TAPLDR+KV MQ H +K   + ++N  K M+ EGGV+SLWRGNGV+  KI PE+AIKF++YE YKK +    ++ +G V   ERF AG+LAGAT+Q  I+PMEV+KTR+TLRK+GQYS ++DCAK + + EG + F++GY+PN+LGI+PYAGIDLA++E+ KN +L S +        V V L  G  SS CGQ A+YPLAL+RT++QA                A    S++++M S+ + I  ++GFFG YRGI PN +KVIPAVSISY V++  R  LGI
Sbjct:   78 IKTENQAAQKIISAGDKNKDDFLDFSE-FSRYLKDHEKKIKLVFKSLDKNKDGEINLAEIKQSLADLGLNISTEEAKTILQSIDADGTMSVDWNEWRDHFLFNPVNNLQEIIRYWKHSTVLDIGDSLSIPDEFTEEEKITGMWWKQLMAGAAAGAVSRTGTAPLDRMKVFMQVHASKSNKISMVNGFKQMLKEGGVTSLWRGNGVNVLKIAPETAIKFMAYEQYKKLL----SSNSGKVQTHERFIAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILKKEGVKAFYKGYIPNILGIIPYAGIDLAVYESLKNFWL-SKHAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAA---------------ASLEGSEQLSMGSMVKQILAKDGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGI 499          
BLAST of slc25a-22 vs. Ensembl Medaka
Match: ENSORLT00000039290.1 (calcium-binding mitochondrial carrier protein SCaMC-1 [Source:NCBI gene;Acc:101174699])

HSP 1 Score: 418.698 bits (1075), Expect = 3.205e-141
Identity = 203/460 (44.13%), Postives = 306/460 (66.52%), Query Frame = 3
Query:  258 QDTIITIQTLKNVLKN----EHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +D  + +  L+  LK      H  A  +     +++KD      +F ++LK  E +L L FK +DRN+D +ID+ EIQ+++A+LGI +  ++A ++L  +D+D  + ID++EW+   L   A +L++I +YW+ S  +DIG+++ IPD+F+ +EK + + WK LVAG  AG VSRT TAPLDR+KV MQ H +K   +G+   ++ MI+EGG++SLWRGNG++  KI PE+AIKF++YE YKK +    ++    +   +RF AG++AGAT+Q  I+PMEVLKTR+TLRK+GQY+ ++DCAK + + EG   F++GY+PNLLGI+PYAGIDLA++ET KN +L    + S     V V L  G  SS CGQ ++YPLALVRT++QA      Q+++           S++++M  + ++I  ++G FG YRGI PN +KVIPAVSISY V++  +  LGI
Sbjct:   35 KDGKVDVAELREGLKAMGIFRHGAAQEI-VSSGDQNKDGCLDFNEFTKYLKEHEMKLWLTFKSLDRNNDGRIDASEIQQSLAELGINLSKEDARKILHSMDIDGTMMIDWNEWREHFLLCPAHNLEEIFRYWKHSSVLDIGDSLAIPDEFTEEEKSSDVWWKQLVAGASAGAVSRTGTAPLDRLKVFMQVHSSKTNRIGLTGGLRQMIAEGGLTSLWRGNGINVLKIAPETAIKFMAYEQYKKLL----SSEGKKIETHKRFMAGSMAGATAQTAIYPMEVLKTRLTLRKTGQYAGMFDCAKKILKKEGVIAFYKGYIPNLLGIIPYAGIDLAVYETLKNAWLSYYAKDSA-NPGVLVLLGCGTISSTCGQLSSYPLALVRTRMQA------QASLGS---------SEQVSMTGLLKTIVAKDGLFGLYRGILPNFMKVIPAVSISYVVYEYMKTGLGI 473          
BLAST of slc25a-22 vs. Ensembl Medaka
Match: ENSORLT00000034226.1 (calcium-binding mitochondrial carrier protein SCaMC-1 [Source:NCBI gene;Acc:101174699])

HSP 1 Score: 418.698 bits (1075), Expect = 3.205e-141
Identity = 203/460 (44.13%), Postives = 306/460 (66.52%), Query Frame = 3
Query:  258 QDTIITIQTLKNVLKN----EHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +D  + +  L+  LK      H  A  +     +++KD      +F ++LK  E +L L FK +DRN+D +ID+ EIQ+++A+LGI +  ++A ++L  +D+D  + ID++EW+   L   A +L++I +YW+ S  +DIG+++ IPD+F+ +EK + + WK LVAG  AG VSRT TAPLDR+KV MQ H +K   +G+   ++ MI+EGG++SLWRGNG++  KI PE+AIKF++YE YKK +    ++    +   +RF AG++AGAT+Q  I+PMEVLKTR+TLRK+GQY+ ++DCAK + + EG   F++GY+PNLLGI+PYAGIDLA++ET KN +L    + S     V V L  G  SS CGQ ++YPLALVRT++QA      Q+++           S++++M  + ++I  ++G FG YRGI PN +KVIPAVSISY V++  +  LGI
Sbjct:   35 KDGKVDVAELREGLKAMGIFRHGAAQEI-VSSGDQNKDGCLDFNEFTKYLKEHEMKLWLTFKSLDRNNDGRIDASEIQQSLAELGINLSKEDARKILHSMDIDGTMMIDWNEWREHFLLCPAHNLEEIFRYWKHSSVLDIGDSLAIPDEFTEEEKSSDVWWKQLVAGASAGAVSRTGTAPLDRLKVFMQVHSSKTNRIGLTGGLRQMIAEGGLTSLWRGNGINVLKIAPETAIKFMAYEQYKKLL----SSEGKKIETHKRFMAGSMAGATAQTAIYPMEVLKTRLTLRKTGQYAGMFDCAKKILKKEGVIAFYKGYIPNLLGIIPYAGIDLAVYETLKNAWLSYYAKDSA-NPGVLVLLGCGTISSTCGQLSSYPLALVRTRMQA------QASLGS---------SEQVSMTGLLKTIVAKDGLFGLYRGILPNFMKVIPAVSISYVVYEYMKTGLGI 473          
BLAST of slc25a-22 vs. Planmine SMEST
Match: SMESG000074801.1 (SMESG000074801.1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 466/482 (96.68%), Postives = 466/482 (96.68%), Query Frame = 3
Query:  183 MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 1628
            MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPM                SDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG
Sbjct:    1 MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPM----------------SDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG 466          
BLAST of slc25a-22 vs. Planmine SMEST
Match: SMESG000074820.1 (SMESG000074820.1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 307/461 (66.59%), Postives = 362/461 (78.52%), Query Frame = 3
Query:  249 EKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKS--EKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLGI 1625
            +K +D +ITI  LK  LKN+ D  N +     +  K+  DK   E+FL F++S+ET LKLAF+QMD+N+DNKI + EIQ TMA+LG+ I IKEAE+LLS +D D NL IDYDEW+++LL S+AR ++DII++WRKS +ID+GENMTIPDDF+ +EK+ GIAWKTLVAGG+AGCVSRT TAPLDR+KVTMQAHGAK AN GIIN IK M++EGGVSSLWRGNGV+C KI PESAIKFL+YE YKK +   T N TG+VTL E+F AGA+AGAT+Q LI+PMEVLKTRM LRKSGQYSSI+DCAK VY  EG QVFFRGYVPN+LGI+PYAGIDLAL+ETFKN+YLKS N       P+YVSL SGA SSVCGQ ATYPLALVRTKLQA+                 +SD  KI+M +V R I K EG  GFYRGIGPN LKVIPAVSISYAVF+QTRH LGI
Sbjct:   24 DKNKDGVITIDELKEALKNQQDSENEILGLMKSTDKNADDKMSFEEFLNFVQSRETHLKLAFRQMDKNNDNKISADEIQITMAELGMNIDIKEAEKLLSHMDKDSNLNIDYDEWRSYLLLSNARDMKDIIRFWRKSFSIDLGENMTIPDDFTPEEKLKGIAWKTLVAGGIAGCVSRTATAPLDRLKVTMQAHGAKAANHGIINAIKYMVNEGGVSSLWRGNGVNCIKIAPESAIKFLAYESYKKLIVNFTQNETGNVTLGEKFVAGAMAGATAQTLIYPMEVLKTRMCLRKSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIYVSLCSGAVSSVCGQVATYPLALVRTKLQAMS----------------KSDG-KISMKNVSRDIIKNEGVLGFYRGIGPNMLKVIPAVSISYAVFEQTRHFLGI 467          
BLAST of slc25a-22 vs. Planmine SMEST
Match: SMESG000000216.1 (SMESG000000216.1)

HSP 1 Score: 305.834 bits (782), Expect = 1.440e-97
Identity = 171/468 (36.54%), Postives = 268/468 (57.26%), Query Frame = 3
Query:  207 CNTGIKK--TSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLNTEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQETMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDIIKYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLK-SNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
            C + I K  +S N+  +  QD I+    LKN   N                    D SE F+++ ++++  L   F + +   ++ +  ++I      L I+I  +EA++L+ +VD D N  I  D+W+  L     R+ + I+ +W     ID+G +  IP++F V +    +  K L+AGG+AG  SRT TAPLDR+KV +Q HG K  N GI  +I+ M++EGG+ SLWRGNG++  KI PESAIKF  YE +K  + + T ++  + +L ++F AG+LAG ++Q  I+P+E LKTR+ LRK+GQ+ S + CA+ +Y+  G + F+RG+  N+ GI+PYAGI+L L++  K++Y+  +    +    P  + L+S + S+ CG F TYP AL+RTKLQ+    S +  VN              ++  + R+I    GF GFYRG+  N  KV+PA SISY  ++
Sbjct:   25 CLSDITKYLSSRNLNRKYYQDKILAKHFLKNADMNR---------------DGYVDFSE-FVKYFENRDKLLHATFNESEPKMNDTVTVEDIMSLFNRLNIVISSEEADKLIGKVDKDGNRQISVDDWRDALFFHPTRTWEQIVHFWENGQFIDVGADWVIPEEFDVDDGSLLLQLKRLLAGGIAGAFSRTFTAPLDRVKVLLQVHGYKHVNSGIYQSIRYMLNEGGIWSLWRGNGINVIKIVPESAIKFSMYEHFKFQLRKNTESSIANQSLGDKFVAGSLAGVSAQAFIYPLETLKTRLCLRKTGQFHSSFHCAQMIYKEAGLRTFYRGFFINIAGIIPYAGIELTLYDKCKSLYVDWAEVPVASHPHPAIIPLIS-SFSATCGIFTTYPFALIRTKLQSKSEFS-ERNVN--------------SVGGLVRAIYSTAGFPGFYRGVVANLCKVLPASSISYLTYE 460          

HSP 2 Score: 62.3882 bits (150), Expect = 4.553e-10
Identity = 47/195 (24.10%), Postives = 85/195 (43.59%), Query Frame = 3
Query: 1035 AGALAGATSQNLIFPMEVLKTRMTLRKSGQYSS-IYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHL 1616
            AG +AGA S+    P++ +K  + +      +S IY   + +    G    +RG   N++ I+P + I  +++E FK   L+ N E+S     +    ++G+ + V  Q   YPL  ++T+L                   ++   Q  +     + I K+ G   FYRG   N   +IP   I   ++D+ + L
Sbjct:  189 AGGIAGAFSRTFTAPLDRVKVLLQVHGYKHVNSGIYQSIRYMLNEGGIWSLWRGNGINVIKIVPESAIKFSMYEHFK-FQLRKNTESSIANQSLGDKFVAGSLAGVSAQAFIYPLETLKTRL------------------CLRKTGQFHSSFHCAQMIYKEAGLRTFYRGFFINIAGIIPYAGIELTLYDKCKSL 364          
BLAST of slc25a-22 vs. Planmine SMEST
Match: SMESG000015827.1 (SMESG000015827.1)

HSP 1 Score: 114.39 bits (285), Expect = 1.063e-27
Identity = 83/313 (26.52%), Postives = 150/313 (47.92%), Query Frame = 3
Query:  723 AWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAHGAKVAN-----LGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYE-VYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQ-YSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKS-------NNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLL 1619
            A ++  AG  +G VSR    PLD +K+ +Q     +        GI  TI  +  E G  +LW+G+          S I+F +Y  + +K+   +  ++T    L+  F+ G+L+G  + +L  P+++L+TR   +   + Y S+Y  A ++ + EGF   +RG +P++L I P +G+   LF  F N  + S           ++L+I V  S+ SG  +    +   +PL +V+ ++Q       Q      + F     SQ    +  F  I ++EG+  F +G+ P  LK   ++ + ++V++Q   LL
Sbjct:   12 ARESAFAGAASGFVSRAMVQPLDVLKIRLQLQVEPLKKKFGKYHGIFPTICCIYKEEGFKALWKGHMCGQIHAISFSMIQFYTYTCLIEKYKFSLQRHSTFSEKLISNFFCGSLSGILAISLTQPLDILRTRFVAQGEPKLYRSLYHAAASIVQKEGFLTLYRGSIPSILLIAPQSGLQF-LFYNFSNAVIGSIFSLFRFYENKNELKIGVVQSIASGGMAGALSKVLVFPLDIVKKRMQV------QGFEEARKKFGKLHRSQ--GFIRCFGVIYREEGWTAFTKGLKPTLLKSFISIGLKFSVYEQAYQLL 315          

HSP 2 Score: 60.8474 bits (146), Expect = 9.100e-10
Identity = 47/206 (22.82%), Postives = 90/206 (43.69%), Query Frame = 3
Query: 1023 ERFYAGALAGATSQNLIFPMEVLKTRMTL------RKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFDQTRHLLG 1622
            E  +AGA +G  S+ ++ P++VLK R+ L      +K G+Y  I+     +Y+ EGF+  ++G++   +  + ++ I    +      Y  S    S     +  +   G+ S +     T PL ++RT+  A      Q     + S           +     SI ++EGF   YRG  P+ L + P   + +  ++ +  ++G
Sbjct:   14 ESAFAGAASGFVSRAMVQPLDVLKIRLQLQVEPLKKKFGKYHGIFPTICCIYKEEGFKALWKGHMCGQIHAISFSMIQFYTYTCLIEKYKFSLQRHSTFSEKLISNFFCGSLSGILAISLTQPLDILRTRFVA------QGEPKLYRS-----------LYHAAASIVQKEGFLTLYRGSIPSILLIAPQSGLQFLFYNFSNAVIG 202          
BLAST of slc25a-22 vs. Planmine SMEST
Match: SMESG000054493.1 (SMESG000054493.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.869e-26
Identity = 79/315 (25.08%), Postives = 145/315 (46.03%), Query Frame = 3
Query:  720 IAWKTLVAGGVAGCVSRTTTAPLDRIKVTMQAH-GAKVA----NLGIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLR-------------KSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLK-SNNETSQLQIPVYVSLLSGATSSVCGQFATYPLALVRTKLQAIPMVSYQSTVNQFESFAIQSDSQKIT--MVSVFRSIKKQEGFFGFYRGIGPNTLKVIPAVSISYAVFD 1601
            + W+ LV+G  AG +S     PLD IK+  Q + G  VA      G+++  + ++   G S L++G   +    G      F+ Y   K++  +   N   +++ +E     AL+GA +     P+ V+KTR+ L+             K+  YS + +C   +Y+TEG +  ++G++P L G   +  +    +E+ KN Y +    +    ++  +  LL G  S +     TYP  +VR++LQ                     D  ++   ++ V   + K EG +GFY+G+ P+ ++V PA  I + V++
Sbjct:   10 VQWEHLVSGMSAGIISTLVLHPLDLIKIRFQVNEGTGVAIRPKYYGMVDACRRIVKVNGFSGLYQGVMPNTVGSGCAWGFYFIIYNSMKEY--QQKGNLKQELSKLEYMTMAALSGALTLAFTNPIWVVKTRLCLQYDKELFNTSKNNPKTVHYSGMINCFNQIYKTEGMRGLYKGFIPGLFGT-SHGAVQFVTYESMKNFYSQWYYRKDINTKLNTWEYLLLGCVSKLVAASTTYPYQVVRSRLQ---------------------DQHRVYGGIIDVIFQLWKYEGIYGFYKGLLPSLIRVTPASGIVFVVYE 300          

HSP 2 Score: 50.447 bits (119), Expect = 1.725e-6
Identity = 35/152 (23.03%), Postives = 70/152 (46.05%), Query Frame = 3
Query:  840 GIINTIKSMISEGGVSSLWRGNGVSCFKIGPESAIKFLSYEVYKKFVCR--ITNNTTGDVTLMERFYAGALAGATSQNLIFPMEVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAGIDLALFETFKNIYLKSNNE 1289
            G+IN    +    G+  L++G     F      A++F++YE  K F  +     +    +   E    G ++   + +  +P +V+++R+   +   Y  I D    +++ EG   F++G +P+L+ + P +GI   ++ET    YL  N  
Sbjct:  163 GMINCFNQIYKTEGMRGLYKGFIPGLFGTS-HGAVQFVTYESMKNFYSQWYYRKDINTKLNTWEYLLLGCVSKLVAASTTYPYQVVRSRLQ-DQHRVYGGIIDVIFQLWKYEGIYGFYKGLLPSLIRVTPASGIVFVVYETMST-YLLPNKH 311          
The following BLAST results are available for this feature:
BLAST of slc25a-22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A251.077e-14147.00solute carrier family 25 member 25 [Source:HGNC Sy... [more]
SLC25A231.213e-14144.42solute carrier family 25 member 23 [Source:HGNC Sy... [more]
SLC25A251.988e-14147.00solute carrier family 25 member 25 [Source:HGNC Sy... [more]
SLC25A254.994e-14147.00solute carrier family 25 member 25 [Source:HGNC Sy... [more]
SLC25A241.867e-14043.41solute carrier family 25 member 24 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F55A11.46.157e-12242.39pep chromosome:WBcel235:V:11771248:11773490:1 gene... [more]
F55A11.46.157e-12242.39pep chromosome:WBcel235:V:11770456:11773494:1 gene... [more]
F17E5.29.825e-11640.87Probable calcium-binding mitochondrial carrier F17... [more]
slc-25A421.964e-3629.10SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
hpo-125.188e-2525.35pep chromosome:WBcel235:IV:12283174:12285065:1 gen... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCaMC5.603e-13847.49gene:FBgn0052103 transcript:FBtr0332090[more]
SCaMC5.603e-13847.49gene:FBgn0052103 transcript:FBtr0075982[more]
SCaMC3.718e-11046.22gene:FBgn0052103 transcript:FBtr0075983[more]
SCaMC2.073e-10950.31gene:FBgn0052103 transcript:FBtr0332089[more]
DPCoAC7.472e-3632.32gene:FBgn0067783 transcript:FBtr0344280[more]
back to top
BLAST of slc25a-22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a241.209e-15551.32solute carrier family 25 member 24 [Source:NCBI ge... [more]
slc25a23a1.445e-14747.61solute carrier family 25 member 23a [Source:ZFIN;A... [more]
slc25a25b4.271e-13947.00solute carrier family 25 member 25b [Source:NCBI g... [more]
slc25a25b9.763e-13947.00solute carrier family 25 member 25b [Source:NCBI g... [more]
slc25a25b9.763e-13947.00solute carrier family 25 member 25b [Source:NCBI g... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a232.293e-14549.64solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a232.682e-14549.64solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a234.024e-14549.64solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a235.592e-14549.64solute carrier family 25 (mitochondrial carrier; p... [more]
slc25a237.644e-14549.64solute carrier family 25 (mitochondrial carrier; p... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a233.631e-14346.33solute carrier family 25 (mitochondrial carrier; p... [more]
Slc25a252.556e-14046.76solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a253.404e-14046.76solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a259.413e-14046.76solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a254.996e-13845.69solute carrier family 25 (mitochondrial carrier, p... [more]
back to top
BLAST of slc25a-22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66L49|SCMC1_DANRE9.126e-15551.32Calcium-binding mitochondrial carrier protein SCaM... [more]
sp|Q5XHA0|SCMC1_XENTR7.486e-14348.80Calcium-binding mitochondrial carrier protein SCaM... [more]
sp|Q6GQS1|SCMC3_MOUSE2.540e-14246.33Calcium-binding mitochondrial carrier protein SCaM... [more]
sp|Q7T0U6|SCM1B_XENLA1.112e-14148.32Calcium-binding mitochondrial carrier protein SCaM... [more]
sp|Q6KCM7|SCMC2_HUMAN5.172e-14147.00Calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF570.000e+0100.00Slc25a-22 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YF460.000e+066.59Slc25a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0V0J6L63.249e-17349.03Calcium-binding mitochondrial carrier protein SCaM... [more]
A0A4E0RTX36.847e-17252.02Calcium-binding mitochondrial carrier protein SCaM... [more]
A0A504YTN42.849e-17151.80Calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a241.515e-14649.30solute carrier family 25 member 24 [Source:NCBI ge... [more]
slc25a23a1.881e-14247.37calcium-binding mitochondrial carrier protein SCaM... [more]
slc25a23a1.166e-13947.48calcium-binding mitochondrial carrier protein SCaM... [more]
slc25a25a2.559e-13945.29calcium-binding mitochondrial carrier protein SCaM... [more]
ENSAMXT00000052808.15.367e-13847.26calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a23a6.469e-14347.09solute carrier family 25 member 23a [Source:ZFIN;A... [more]
ENSPMAT00000004577.12.376e-10749.38pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
slc25a161.091e-3527.64solute carrier family 25 member 16 [Source:ZFIN;Ac... [more]
slc25a41.995e-2023.05solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
SLC25A401.686e-1824.02solute carrier family 25 member 40 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPR011C_mRNA1.240e-4229.84Mitochondrial transporter; major substrates are ad... [more]
TPC19.555e-3027.51Mitochondrial membrane transporter; mediates uptak... [more]
LEU54.197e-2923.75Mitochondrial carrier protein; involved in the acc... [more]
SFC16.443e-2728.09Mitochondrial succinate-fumarate transporter; tran... [more]
MRS46.529e-2727.03Iron transporter of the mitochondrial carrier fami... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321854.312e-12642.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344261.173e-4732.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384533.704e-4632.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371534.173e-4129.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291404.440e-4126.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a244.836e-14847.18calcium-binding mitochondrial carrier protein SCaM... [more]
slc25a245.813e-14847.18calcium-binding mitochondrial carrier protein SCaM... [more]
slc25a247.642e-14847.18calcium-binding mitochondrial carrier protein SCaM... [more]
ENSORLT00000039290.13.205e-14144.13calcium-binding mitochondrial carrier protein SCaM... [more]
ENSORLT00000034226.13.205e-14144.13calcium-binding mitochondrial carrier protein SCaM... [more]
back to top
BLAST of slc25a-22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074801.10.000e+096.68SMESG000074801.1[more]
SMESG000074820.10.000e+066.59SMESG000074820.1[more]
SMESG000000216.11.440e-9736.54SMESG000000216.1[more]
SMESG000015827.11.063e-2726.52SMESG000015827.1[more]
SMESG000054493.11.869e-2625.08SMESG000054493.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018526
GenBankAKN21590.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018526 ID=SMED30018526|Name=slc25a-22|organism=Schmidtea mediterranea sexual|type=transcript|length=1757bp
CTTTAATTAAATTATCAAATTACTTATTTTATATTTCATAAATTAATATG
AACTCTATCTAATATTTATACGAGTAAATTGAAATATTATATTTATATTT
TGGAAATTTTTATTAATGAACCTGTGCATTTGATTTGTTATTTCTCTCTT
TGATACATTTTAAAATATTGTTTTTTATTAATATGAGTGATGATCTGATA
AAAAATTGTAATACTGGAATTAAGAAAACTAGCAATAATATAGAAGCTGA
AAAGAAACAAGATACAATTATAACAATCCAAACACTAAAAAATGTTTTAA
AAAATGAGCATGATGACGCTAATAATTTGAATACCGAAAAATCTAATGAA
TCTAAAGATATTGCCGATAAATCTGAAAAGTTTTTAGAATTTTTAAAAAG
TCAAGAAACTCAATTAAAATTAGCCTTTAAACAAATGGATCGTAATCACG
ATAATAAAATTGACTCCAAAGAAATTCAAGAAACTATGGCTGATTTAGGA
ATAATTATTGGAATTAAAGAAGCTGAACAATTATTATCCCGTGTTGATCT
GGATCATAATCTGGCAATCGATTATGATGAATGGAAAACATTTTTGTTGC
AATCGAGTGCCCGAAGTTTACAAGACATTATTAAATATTGGAGAAAGTCT
TGTGCAATTGATATTGGTGAAAATATGACAATTCCTGATGATTTTAGTGT
TCAAGAAAAAATGACTGGAATCGCTTGGAAAACTCTTGTAGCTGGAGGAG
TTGCTGGGTGTGTTTCAAGGACAACTACTGCTCCTTTGGATCGAATTAAA
GTCACAATGCAAGCTCATGGTGCCAAAGTAGCTAATCTCGGTATAATAAA
TACAATTAAAAGCATGATAAGTGAAGGTGGGGTTTCATCTCTATGGCGTG
GAAATGGCGTTAGCTGTTTTAAAATTGGACCTGAATCAGCGATTAAATTT
CTGTCATATGAAGTTTATAAAAAATTTGTTTGCCGCATAACTAACAACAC
AACTGGAGATGTAACATTAATGGAAAGATTTTACGCTGGAGCACTAGCTG
GAGCTACTTCACAAAATTTAATTTTCCCGATGGAGGTTCTAAAAACCAGA
ATGACTCTCCGTAAAAGTGGTCAATATTCATCAATATATGATTGTGCTAA
AAATGTCTACAGAACAGAAGGATTTCAAGTGTTTTTTCGTGGTTATGTTC
CAAATCTTTTAGGAATCTTGCCTTATGCAGGAATCGATCTTGCACTTTTC
GAAACATTCAAAAATATTTATTTAAAATCAAATAATGAAACATCTCAATT
ACAAATTCCTGTTTACGTTTCTCTTTTATCCGGAGCAACGAGTTCTGTTT
GTGGTCAATTTGCCACATATCCATTGGCATTGGTGAGAACAAAATTACAA
GCTATTCCTATGGTAAGCTATCAGTCAACAGTTAATCAATTTGAATCATT
CGCAATTCAGTCTGATTCACAGAAGATTACGATGGTCTCTGTTTTTAGAA
GCATCAAGAAACAGGAAGGATTTTTTGGCTTTTACAGAGGTATTGGACCA
AACACGTTGAAAGTAATTCCAGCTGTGAGCATTTCATATGCAGTATTTGA
TCAGACGAGACATTTACTGGGCATTGGATAATCCTTTGGCCAATCAAATA
TACCTAAATATATACTTGATTGGACAAAGGATTGTCCAATCAAGTATATA
AATAAATAAATGTATATTTGGCATTGGGTAATCCTTTGTTCAATCAAATA
GATTTAC
back to top

protein sequence of SMED30018526-orf-1

>SMED30018526-orf-1 ID=SMED30018526-orf-1|Name=SMED30018526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MSDDLIKNCNTGIKKTSNNIEAEKKQDTIITIQTLKNVLKNEHDDANNLN
TEKSNESKDIADKSEKFLEFLKSQETQLKLAFKQMDRNHDNKIDSKEIQE
TMADLGIIIGIKEAEQLLSRVDLDHNLAIDYDEWKTFLLQSSARSLQDII
KYWRKSCAIDIGENMTIPDDFSVQEKMTGIAWKTLVAGGVAGCVSRTTTA
PLDRIKVTMQAHGAKVANLGIINTIKSMISEGGVSSLWRGNGVSCFKIGP
ESAIKFLSYEVYKKFVCRITNNTTGDVTLMERFYAGALAGATSQNLIFPM
EVLKTRMTLRKSGQYSSIYDCAKNVYRTEGFQVFFRGYVPNLLGILPYAG
IDLALFETFKNIYLKSNNETSQLQIPVYVSLLSGATSSVCGQFATYPLAL
VRTKLQAIPMVSYQSTVNQFESFAIQSDSQKITMVSVFRSIKKQEGFFGF
YRGIGPNTLKVIPAVSISYAVFDQTRHLLGIG*
back to top
Aliases
The feature 'slc25a-22' has the following synonyms
Synonym
slc25a-22
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000087proximal tubule
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002167Graves_DC
IPR002067Mit_carrier
IPR002048EF_hand_dom
IPR023395Mt_carrier_dom_sf
IPR011992EF-hand-dom_pair
IPR018108Mitochondrial_sb/sol_carrier
IPR018247EF_Hand_1_Ca_BS
Vocabulary: cellular component
TermDefinition
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 32..56
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 89..163
e-value: 2.3E-16
score: 61.4
NoneNo IPR availablePANTHERPTHR24089:SF196CALCIUM-BINDING MITOCHONDRIAL CARRIER PROTEIN SCAMC-3coord: 30..481
NoneNo IPR availablePANTHERPTHR24089FAMILY NOT NAMEDcoord: 30..481
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 335..353
score: 33.13
coord: 292..310
score: 23.38
coord: 197..211
score: 43.93
coord: 240..260
score: 27.95
coord: 384..406
score: 27.23
coord: 184..197
score: 46.49
IPR002167Graves disease carrier proteinPRINTSPR00928GRAVESDCcoord: 201..221
score: 52.38
coord: 176..196
score: 26.19
coord: 315..336
score: 31.82
IPR002048EF-hand domainSMARTSM00054efh_1coord: 77..105
e-value: 0.013
score: 24.7
coord: 113..141
e-value: 6.5
score: 11.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 109..144
score: 8.99
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 73..108
score: 12.617
IPR002048EF-hand domainCDDcd00051EFhcoord: 77..138
e-value: 1.71554E-9
score: 51.7797
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 276..366
e-value: 2.3E-22
score: 78.7
coord: 375..479
e-value: 8.4E-20
score: 70.5
coord: 182..266
e-value: 5.8E-22
score: 77.4
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 179..265
score: 18.887
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 375..478
score: 17.986
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 277..362
score: 25.13
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 174..481
e-value: 8.2E-79
score: 266.3
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 182..474
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 86..98
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 25..154