von Willebrand factor A domain-containing protein 3B

Overview
Namevon Willebrand factor A domain-containing protein 3B
Smed IDSMED30018511
Length (bp)2684
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of von Willebrand factor A domain-containing protein 3B (SMED30018511) t-SNE clustered cells

Violin plots show distribution of expression levels for von Willebrand factor A domain-containing protein 3B (SMED30018511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of von Willebrand factor A domain-containing protein 3B (SMED30018511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for von Willebrand factor A domain-containing protein 3B (SMED30018511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018511SMESG000009195.1 SmedASXL_015593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018511SMESG000009195.1 dd_Smed_v4_10837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018511SMESG000009195.1 dd_Smed_v4_10837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018511SMESG000009195.1 dd_Smed_v4_10837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018511SMESG000009195.1 dd_Smed_v6_10837_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018511SMESG000009195.1 dd_Smed_v4_10837_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 61.2326 bits (147), Expect = 2.235e-9
Identity = 41/164 (25.00%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG + E  V    D SGSM  Y    +  L+  +++ L  K    FN++ F  S   +    V+       + ++W+     +  T IL A++K+F  F D+  +YL+TDG  +   + +L  +  + + R +  +   S    D  A++FL  + + T G
Sbjct:   51 RRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQL-RKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-SFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVK-VHTISLNCSDRAAVEFLRKLASFTGG 211          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 60.4622 bits (145), Expect = 1.554e-8
Identity = 41/164 (25.00%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG + E  V    D SGSM  Y    +  L+  +++ L  K    FN++ F  S   +    V+       + ++W+     +  T IL A++K+F  F D+  +YL+TDG  +   + +L  +  + + R +  +   S    D  A++FL  + + T G
Sbjct:  949 RRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQL-RKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-SFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVK-VHTISLNCSDRAAVEFLRKLASFTGG 1109          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Zebrafish
Match: si:dkey-8l13.5 (si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-349])

HSP 1 Score: 52.373 bits (124), Expect = 2.368e-6
Identity = 46/219 (21.00%), Postives = 91/219 (41.55%), Query Frame = 3
Query:  138 RNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFED-FPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKS 791
            +N++F  D S  M       +  +++ L     S     FNII F+     ++SR + C  D + + + W++     S  D   A+  +F D     V+L+T    +     L      ++  RP++   ++ +   +    DFL+ + + T GS  ++ +   G VE V   +  +    ++++ ++      MD   +  Y   C  C  S P + S
Sbjct:   22 KNISFVLDCSEGMSGVLGAVKNLIIQTLLTKA-SLRDSLFNIISFSYKATPWSSRMLPCSPDVVYEALSWIHTLQTSSGRDFHTALALAFSDPACHSVHLVTSSVPDNPTQCLASLSTMVT--RPVHTFYISDKTSINSDTSDFLQCLSSTTRGSCYIMALNSAGGVEEVS--LLHSTDDSIQKTTYAEDTLHSMDFNQVPYY--NCTSCVCSIPYWCS 233          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Xenopus
Match: ENSXETT00000049307.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:109671931:109699265:1 gene:ENSXETG00000020946.1 transcript:ENSXETT00000049307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.431e-6
Identity = 38/138 (27.54%), Postives = 66/138 (47.83%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP-DVVYLITDGFINKERATLLGNLPHISKGRPINCI 521
            + +FG I E  V    D S SM       +E + + + + L  K+   FN + F+S V  + SR     +D + +   W+ +    S T+ L A+  +F D   + +YL+TDG  ++   T+L  + +  K  PI+ I
Sbjct:  462 RELFGTILEDRVYILIDTSHSMKDKLFLVKEKMFQLIEEQL--KHKLMFNFVKFDSKVEAWKSRLAKVTEDTLQEASCWVKELQVGSSTNTLRALQVAFNDSSTEAIYLLTDGRPDQPAETILAQV-NFQKSVPIHTI 596          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 68.1662 bits (165), Expect = 4.953e-11
Identity = 43/164 (26.22%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG I ERNV    D SGSM  +    +  L+  +++  L K+  +FN++ F   +  +    V+  +      ++W+     +  T +LAA+ K+F  F DV  +YL+TDG  +   + +L  +    K R +  +   S    D  A +FL ++ +++ G
Sbjct:  913 RRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQ-LRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-SFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVK-VHTISLTSADRTATEFLRELASLSGG 1073          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 68.1662 bits (165), Expect = 4.953e-11
Identity = 43/164 (26.22%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG I ERNV    D SGSM  +    +  L+  +++  L K+  +FN++ F   +  +    V+  +      ++W+     +  T +LAA+ K+F  F DV  +YL+TDG  +   + +L  +    K R +  +   S    D  A +FL ++ +++ G
Sbjct:  913 RRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQ-LRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-SFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVK-VHTISLTSADRTATEFLRELASLSGG 1073          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 68.1662 bits (165), Expect = 4.953e-11
Identity = 43/164 (26.22%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG I ERNV    D SGSM  +    +  L+  +++  L K+  +FN++ F   +  +    V+  +      ++W+     +  T +LAA+ K+F  F DV  +YL+TDG  +   + +L  +    K R +  +   S    D  A +FL ++ +++ G
Sbjct:  913 RRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQ-LRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-SFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVK-VHTISLTSADRTATEFLRELASLSGG 1073          
BLAST of von Willebrand factor A domain-containing protein 3B vs. UniProt/SwissProt
Match: sp|Q3UVV9|VWA3A_MOUSE (von Willebrand factor A domain-containing protein 3A OS=Mus musculus OX=10090 GN=Vwa3a PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.465e-10
Identity = 43/164 (26.22%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG I ERNV    D SGSM  +    +  L+  +++  L K+  +FN++ F   +  +    V+  +      ++W+     +  T +LAA+ K+F  F DV  +YL+TDG  +   + +L  +    K R +  +   S    D  A +FL ++ +++ G
Sbjct:  913 RRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQ-LRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-SFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVK-VHTISLTSADRTATEFLRELASLSGG 1073          
BLAST of von Willebrand factor A domain-containing protein 3B vs. UniProt/SwissProt
Match: sp|A6NCI4|VWA3A_HUMAN (von Willebrand factor A domain-containing protein 3A OS=Homo sapiens OX=9606 GN=VWA3A PE=2 SV=3)

HSP 1 Score: 60.4622 bits (145), Expect = 7.465e-8
Identity = 41/164 (25.00%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            + +FG + E  V    D SGSM  Y    +  L+  +++ L  K    FN++ F  S   +    V+       + ++W+     +  T IL A++K+F  F D+  +YL+TDG  +   + +L  +  + + R +  +   S    D  A++FL  + + T G
Sbjct:  949 RRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQL-RKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-SFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVK-VHTISLNCSDRAAVEFLRKLASFTGG 1109          
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Match: A0A210Q6Z3 (von Willebrand factor A domain-containing protein 3B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07029 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.203e-45
Identity = 135/431 (31.32%), Postives = 213/431 (49.42%), Query Frame = 3
Query:   96 SLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP-DVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDP---MSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYH--SMWKDFRDSREFVCNQK-YLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKF-----DVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRS 1352
            ++K + TIFGE  E+NVTFC D SGSM++     +EHL+E L K         FNII FNS V Q+A + V C  + +     W+ + S ++ T+ L A++ + ED   + VYL+TDG  ++    +L  + +  +GRPI+CI + ++   D  A++FLED+   + GS  +V +   G VE V P IY A              HE +            K C ++     +L+ DP   ++  P ++ F S     G      +P+ H  W              W     +Y+  + W  +R +R ++ +Q+  +D   N+  S AAG +LI+++VLA    D    YLGKV  Q+  + FLV F       Y+E    Q T + +++DYE+ KRH+I  +D VL P +     +   +VIEG+E R 
Sbjct:    4 NIKGIPTIFGETFEKNVTFCVDTSGSMFKGLGVVKEHLVETLLKHARKSQPTSFNIIEFNSEVTQWADKMVKCSAETVEVAAEWVKRLSAKTGTNTLDALLTALEDRGCESVYLVTDGLPDQHPVDILDQVTNAVRGRPIHCIYLCAEDAMDTSAIEFLEDLSVESYGSFHIVSLTQHGCVERVTP-IYRA-----------DHAHERIVRTINGTLHNHGKQCSVA----TTLKVDPEESLALTPRVSSFNSYPGFPG------NPYGHLAWGH------------WFMQPHRYYFPNGWSQYRPARGWLKSQESMMDHIENSGVSPAAGALLISKKVLARRI-DDGYFYLGKVKSQILGDKFLVAFGPSKPGKYKE-TTYQDTFVYDLVDYEDAKRHTINTSDKVLAPWEPQGERFGPGVVIEGHEKRG 398          
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Match: A0A2T7P673 (VWFA domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11513 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.918e-45
Identity = 145/467 (31.05%), Postives = 228/467 (48.82%), Query Frame = 3
Query:  108 VKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP-DVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSG-VRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDP---MSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAIS-SVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDV-----YEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENI 1475
            + TIFGE+ ER+VTFC D SGSM+   H  +E L+E L K  L +    FNII FNS V Q+A + V C  + +     W+ K S ++ T+ L A++ +F+D     VYL+TDG  +     +L  +   +KGRPI+CI ++ +   D  A++FLED+   + GSL +  +   G VE + PI      SG V R+  +           +R  F   K C ++     +LQ DP   ++  P  + F       G H P+  P   W+  +FW   G  P   +      + S W  +R ++ ++  Q  L +   A+  S AAG +LI++ VLA    D    Y+GKV  Q+    FL+ F       Y E    Q T + +I+DY + +RH+I   D VL P +     +   +VI+G E R  I     +D ++ V      +E  +  ++A++I + + E I
Sbjct:   37 LPTIFGEVVERDVTFCIDTSGSMFNCIHVVKEQLIETLMKHALREGDTTFNIIEFNSEVTQWADKMVACTPETVKVAAEWIRKLSAKTGTNTLDALLTAFQDRSCQAVYLVTDGLPDNFIEDILDTVIEAAKGRPIHCIYLSGE-KADATAVEFLEDLAVESFGSLHIATLTTHGCVERISPIYRSEHASGRVIRTVNN----------TLRPNF---KTCSVT----TTLQIDPDEILANTPRTSYFGQ-----GYHTPYVPP---WWRHRFW-GLGFDPFRYY------FPSTWSRYRPAKSWLKFQDKLLEPPEAVGMSPAAGSLLIDKIVLARRISD-GYFYMGKVQSQILDEKFLIAFGPCKHGKYRE-TTYQDTFVFDIVDYCDAQRHTIITGDHVLAPWEPEGERFGPGIVIDGQEKRQAIGP---EDREITVAFSNGRTEKVVM-DRAIWIPEPVYERI 464          
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Match: K1QR88 (von Willebrand factor A domain-containing protein 3B OS=Crassostrea gigas OX=29159 GN=CGI_10014264 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.651e-42
Identity = 141/457 (30.85%), Postives = 221/457 (48.36%), Query Frame = 3
Query:   24 MSSINIDENLEDFTTNINLSGLRTSL--------KLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP-DVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQ-KYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFD--VYEEFDDA--QQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRS 1352
            ++ IN  E   + +T++NL  ++T +        K + TIFGE+ ERNVTFC D SGSMY+     +EHL+E L K     N   FNII FNS V Q+A + V C  + +     W+ K S ++ T+   A++ +  D   + VY++TDG  ++    +L  +      RPI+CI + S+   D V+++FLED+   + GS  +V +   G VE + P IY A  +           HE +            K C +S     +L  DP   L  + P +S   + G   P   P  + YW   W++    P   +      Y   W  +R +R ++  Q + +    N+  S AAG +LI ++VLA    D    Y+G V  Q+  + FLV F    + ++++   Q T + +IIDYE+ KRH+I+  D VL   +     +   +VIEG E R 
Sbjct:    9 LNEINYPEG--NISTDLNLLLVKTKMAVPLIPKIKGIPTIFGEVLERNVTFCIDTSGSMYKGLDVVKEHLVETLLKQANKPNCM-FNIIEFNSEVTQWADKMVKCTPETVAVAATWVKKLSAKTGTNTQGALLTALSDRNCEAVYIVTDGLPDQHPQDILDQVGLAGHNRPIHCIYLCSEDNTDQVSIEFLEDLAVESFGSFHIVTLTVHGCVERITP-IYRADHA-----------HERIIRTMNGTIHNSTKNCGVS----TTLLVDPEESL-RLTPRVS---LLGHPHPVPDPLGYPYW-DTWKNWFFHPYRYY------YPHGWSRYRPARGWLKAQDQMMSSMENSSVSPAAGALLIGKKVLARRIDD-GYFYIGTVQSQILSDKFLVAFGPCKHGKYNETKYQDTFIFDIIDYEDAKRHTIQTGDRVLATWEPEGERFCPGVVIEGQEKRQ 434          
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Match: R7T3K9 (VWFA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223654 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.239e-42
Identity = 177/724 (24.45%), Postives = 317/724 (43.78%), Query Frame = 3
Query:  114 TIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP-DVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYK-----SLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWP-----QFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQK-YLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFD--VYEEFDDA--QQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHS-----ERSSSDTLPVSDPKLKIHCNLDQNPCNVCC---GYFDQPKNFI-------RIPSPIEIGKVKTLDEINEEISRNKSKMKS---------DNRIEVDKTEQ----------GNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFS-----HSKYSRKEAFTETDLNYCILKILXXXXXXXXXXXXXEQWKYWGKKPIPDVIDPPSTEPYQ 2120
            T+FG + E+NVTFC D SGSM +Y    ++HL+E L +  +  +   FNI+ F++ V  ++ + V C    +     W+ +   ++ T+ + A++ +F D   D V LITDG  ++  + +L N+ + ++ RP++C  + S   P+  A +FL+ +   T GS  ++   D G +E + P IY A  +  R                     ++     I P N+K     +  G+   + P   P++  +P+        HPF H+ WP     QF+                   S +  +R +R  + ++K +LD   N      AG++++  +VLA  + D    Y+GKV  QL  N FLV+F    + ++ D   Q+T +++I+ YE+  RH++   D VL P +     Y   +V+EG E R      P  D KL V T  +     I  N+A++I   L E I     +   +R++     AD  E+ + + E        +     E   S  LP ++  + I   + QNP  V      Y  +P+  I        I    E+ K +  +++  +I+R+K   +            R ++  T Q          GN+ ++ +++D  +L+ +    D+     DDL  S      S    K   T +  +Y   +        + + + +  WKYW + P P++++P    P++
Sbjct:   54 TMFGRLREKNVTFCVDTSGSMIKYLEAVKQHLIEFLQQKAIEDSQGSFNILEFSTRVTLWSDKMVQCTPQTVAVASDWIQRLVPQTGTNTMEALLSAFSDANCDAVCLITDGLPDQNPSDVLDNVVYTAQNRPVHCYYVQSG-SPESKATEFLQSLAMDTYGSFHIITAADSGLIERISP-IYRAEATAER--------------------VIRTTDNNIYPSNHKVCTVGTRLGEIARFQP--GPYVVHEPL--------HPFCHYPWPFRFYYQFYNPL----------------SQFSRYRTARSMLAHEKEFLDTMINVCP--GAGVLVVGSKVLARRHDD-GLFYVGKVNSQLLSNKFLVEFGPCKHGKYLDTSYQETFIHDIVSYEDALRHAVLAGDRVLAPWEPEGERYGPGVVVEGQERRGASGGTP--DQKL-VVTFFNGKTADIPLNRAMWIPNELYERIAFEVHLPSHVRRDF----ADQDEYPEETLEGYPASGTGAYPTRYETVDSHWLPNNNRPV-IERGIYQNPYYVPMYPIYYKFKPQRSIVKSEEVAEIIPGTELTKAQLKEKVMAQITRHKVNEEVKETEETKLLSKREQLQDTAQLTKKSVTFTEGNTSDLEAEFDSGDLDMR----DSGRGSGDDLYLSDVEGYESGNDDKSTQTRSAYSYTPRR--------SRSTSKRPPWKYWSRDPSPNLLEPMHYGPHR 706          
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Match: V3ZVM7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236029 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.888e-38
Identity = 129/460 (28.04%), Postives = 214/460 (46.52%), Query Frame = 3
Query:  117 IFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQK-FNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPD--VVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPM--SYL------PVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFD--VYEEFDDA--QQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFI 1451
            IF  + E +VTFC D SGSMY   H  +E L+EAL+K +   +G   FNI+ FNS + Q++ + V C  + +    +W+++ S ++ T+ + A++ +F D P+   VYL+TDG  ++    +L ++ ++   RP++C+ +  +   D+ A +FLED+   T GS  +  I   G++E + P+                 EH     +     F K K C +S     +L  DP+  +YL      PVI P++   P+ G         Y +Y P +W    P+               W   +D        K LD+      S AAG +LI + VLA   +D    Y G V  Q+  N FLV F    + ++ D   Q+T +++I+DY + KR ++   D VL P +     +   +VI+G E R         D K       +     ++P+ A++I
Sbjct:   23 IFDNVVEESVTFCVDTSGSMYNCLHVVKEQLVEALYKHVKHSSGSPLFNIVEFNSQITQWSDKMVKCTPETVAVASKWIDELSAKTGTNTMDALLIAFGD-PECKAVYLVTDGLPDQNPEEILDHVGYVDNDRPVHCVYLMGE-KADESATEFLEDLAIETYGSFFIASITTKGAIEKLTPVF--------------KAEHSNYLKSTDNNLFSKIKQCNVS----TTLAADPIESAYLNSRLVSPVINPYVFP-PVQG---------YRYYHPSYWSRYRPA-------------KGWLKMQD--------KLLDEAQALEMSPAAGALLIGKEVLARRNED-GYFYSGSVQSQIYENKFLVAFGPCKHGKYKDTTYQETMVHDILDYVDAKRRTVVTGDKVLSPWEPEGDKFGPGVVIDGFEKRESEG----PDDKGITVAFSNGKTEKVAPDTAVWI 426          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Cavefish
Match: si:dkey-8l13.5 (chromosome 18 C11orf16 homolog [Source:NCBI gene;Acc:103047275])

HSP 1 Score: 55.4546 bits (132), Expect = 2.516e-7
Identity = 42/187 (22.46%), Postives = 82/187 (43.85%), Query Frame = 3
Query:   87 LRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFED-FPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVV 644
            + +S  ++  + G+  +RNVT   D S +M       +  +++ L      +N   FNII F+  V  ++   V C  D + + + W++  +     D+L A+  +F D     V+L+T+   +     L  +       RP++   +  +   D   LDFL+ + + T GS   + +    + E V
Sbjct:    1 MDSSRGVIPVLMGK--DRNVTLILDTSEAMTAVLGTVKNLIVQTLLAKASLRN-SLFNIITFSYKVTPWSDHMVPCAPDTVYEALGWIHTLTTSPGKDLLTALTTAFSDPACQSVHLVTNSLPDNPENCL--SALSTCGTRPVHTFHIAEKQALDSDTLDFLKCLTSATRGSCYRLNLNSGSTAEQV 182          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Nematostella
Match: EDO41655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3S3])

HSP 1 Score: 116.701 bits (291), Expect = 5.247e-30
Identity = 63/164 (38.41%), Postives = 91/164 (55.49%), Query Frame = 3
Query:  114 TIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSF-EDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSL 602
            TIFG I ERNV F  D SGSMY      REHL+E LF    S     FN+I FN  V ++A R V C    +     W+NK    + T+ + A+++++ +D    +YL+TDG  ++    ++ N+  + KGRPI+ I +      D  A++FLED+   TNGSL
Sbjct:   14 TIFGNILERNVVFLLDTSGSMYHCLDVVREHLIEILFFRATSGRDTMFNVIEFNEEVTKWADRMVQCTPRTVSVASEWINKLQCGTSTNTMGALLEAYDDDGMQAIYLVTDGMPDQRPGIIMENVRKLHKGRPIHAIYLCGA-KADVAAVEFLEDLAKETNGSL 176          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 853/853 (100.00%), Postives = 853/853 (100.00%), Query Frame = 3
Query:   24 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILXXXXXXXXXXXXXEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS 2582
            MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILNKNQKNNNNANNKEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS
Sbjct:    1 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILNKNQKNNNNANNKEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS 853          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 1726.07 bits (4469), Expect = 0.000e+0
Identity = 851/853 (99.77%), Postives = 851/853 (99.77%), Query Frame = 3
Query:   24 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILXXXXXXXXXXXXXEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS 2582
            MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKC  CYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILNKNQKNNNNANNKEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS
Sbjct:    1 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKC--CYISPPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWESTGPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGIILINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLNEIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPIQDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTENIEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCNVCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVDKTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFTETDLNYCILKILNKNQKNNNNANNKEQWKYWGKKPIPDVIDPPSTEPYQNPQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHVPSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDSVKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQKLTS 851          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 477.248 bits (1227), Expect = 1.430e-163
Identity = 236/248 (95.16%), Postives = 239/248 (96.37%), Query Frame = 3
Query:   24 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCY 767
            MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMD     +  +KC  C+
Sbjct:    1 MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATLLGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKDLGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMD----PQNPIKCAICF 244          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Match: SMESG000022332.1 (SMESG000022332.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.654e-10
Identity = 53/172 (30.81%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMY----RYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDV--VYLITDGFINKERATLLGNLPHISKGR----PINCIMMTSQIPPDDVALDFLEDVVTITNG 596
            K IFG ITE +V    D SGSM         + +  + E LFK  +S     +NII FNS + +F  R V   + +    I W         TD   A++ + ED P +  +YL+TDG  +     +L N+ +I   R    PI+ I    +   D+ A +FL+ +  ++NG
Sbjct:  502 KRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKIS-----YNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLED-PRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCE---DESANEFLKRLARMSNG 664          

HSP 2 Score: 50.8322 bits (120), Expect = 5.033e-6
Identity = 35/131 (26.72%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  111 KTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFE--------DFPDVVYLITDGFINKERATLLG 479
            + IFG I ER V    D S S  +Y  H  + L   + + L +K+  KFNII F++++  F +      + N+ D   W+   +     ++L A+   FE        D+   +YL T G  +++   L+ 
Sbjct:   57 RRIFGTIIERKVILILDLSISNIKYLVHILQSLKILIQQQLKAKD--KFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMA 185          
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Match: SMESG000064517.1 (SMESG000064517.1)

HSP 1 Score: 50.0618 bits (118), Expect = 8.333e-6
Identity = 32/139 (23.02%), Postives = 64/139 (46.04%), Query Frame = 3
Query:  108 VKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFED--FPDVVYLITDGFINKERATLLGNLPHISKGRPINC 518
            ++TIF  ++ RN  +C + S + +    + + H++  L       +  KFN+I FNS V ++      C  + I     W+     E   + L A++ + ++    ++ +++T    N+E   +L    +I  GR I C
Sbjct:    4 IETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGALVSALKEPLNCNICFIVTQ-HPNQEIKEILDLFAYI--GRKIPC 139          
The following BLAST results are available for this feature:
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
VWA3A2.235e-925.00von Willebrand factor A domain containing 3A [Sour... [more]
VWA3A1.554e-825.00von Willebrand factor A domain containing 3A [Sour... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-8l13.52.368e-621.00si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-34... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000049307.11.431e-627.54pep primary_assembly:Xenopus_tropicalis_v9.1:2:109... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Vwa3a4.953e-1126.22von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3a4.953e-1126.22von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3a4.953e-1126.22von Willebrand factor A domain containing 3A [Sour... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3UVV9|VWA3A_MOUSE3.465e-1026.22von Willebrand factor A domain-containing protein ... [more]
sp|A6NCI4|VWA3A_HUMAN7.465e-825.00von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q6Z33.203e-4531.32von Willebrand factor A domain-containing protein ... [more]
A0A2T7P6733.918e-4531.05VWFA domain-containing protein OS=Pomacea canalicu... [more]
K1QR882.651e-4230.85von Willebrand factor A domain-containing protein ... [more]
R7T3K96.239e-4224.45VWFA domain-containing protein OS=Capitella teleta... [more]
V3ZVM73.888e-3828.04Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-8l13.52.516e-722.46chromosome 18 C11orf16 homolog [Source:NCBI gene;A... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416555.247e-3038.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009195.10.000e+0100.00SMESG000009195.1[more]
SMESG000009195.10.000e+099.77SMESG000009195.1[more]
SMESG000009195.11.430e-16395.16SMESG000009195.1[more]
SMESG000022332.11.654e-1030.81SMESG000022332.1[more]
SMESG000064517.18.333e-623.02SMESG000064517.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018511 ID=SMED30018511|Name=von Willebrand factor A domain-containing protein 3B|organism=Schmidtea mediterranea sexual|type=transcript|length=2684bp
CATATATTAGCTAAATCCAAAAAATGTCCTCTATAAATATTGATGAAAAT
TTAGAGGATTTTACAACTAATATAAATCTTTCAGGACTTCGAACATCTCT
TAAATTAGTTAAGACAATTTTTGGTGAGATAACTGAAAGAAATGTTACAT
TTTGTTTTGATTATTCTGGAAGTATGTATAGATATTTTCATCATTTTCGA
GAGCATTTGTTAGAAGCTTTGTTTAAAATGCTTTTATCTAAAAATGGTCA
AAAATTTAACATTATATTATTTAATTCTTCGGTTCATCAATTTGCCAGTA
GACATGTTGACTGTGTACAGGACAATATAGTTGATGTGATTAGATGGATG
AATAAACCTTCCTATGAGTCTAAAACGGATATATTGGCTGCAATAATTAA
ATCATTTGAAGATTTCCCAGATGTAGTATATTTAATTACTGATGGTTTCA
TAAACAAAGAAAGGGCAACATTATTGGGTAATCTTCCACATATATCGAAA
GGCAGACCAATCAACTGTATAATGATGACTTCACAAATTCCTCCAGATGA
CGTTGCTTTGGATTTTTTAGAGGATGTTGTTACCATAACTAATGGCTCGT
TAAGCGTTGTTTTAATTAAGGATCTTGGGTCAGTAGAAGTAGTAATGCCA
ATTATTTATGAAGCACGTCCATCAGGAGTTCGAAGGTCGAAATTCTCACC
CTTTGAGCATGAAGAAATGGATTTGGCTGCAATGAGAAAATATTTTGTAA
AATGTAAAGGTTGTTATATTTCTCCCCCAAATTACAAATCACTGCAAGGC
GATCCGATGTCTTATTTGCCGGTAATCGCACCGTTTATAAGTAAAGATCC
CATTAGCGGTATACATTGTCCATTTTATCATCCGTTCTATCATTGGTATT
GGCCTCAATTCTGGGAAAGTACTGGACCTAGTCCTACGTTACTTTGGGCG
AAAAACGATCCCCAATATCATTCAATGTGGAAAGATTTCAGGGACAGTCG
GGAATTTGTTTGCAATCAGAAATATTTGGATAAATACAATAATGCTATCA
GTTCTGTAGCTGCCGGTATTATTCTTATAAACAGGAGAGTTCTGGCGTTT
AATTATCAAGATAAAAATAAAATTTACCTTGGTAAAGTATTTGATCAGCT
AACTCCGAATCACTTTCTTGTCAAATTTGATGTTTATGAGGAGTTTGATG
ATGCACAACAAACCAATTTAAATGAAATCATAGATTACGAAGAACAGAAA
CGTCATTCTATTAAGATAAATGATTTCGTTCTTGTTCCAGTAGACAAAAC
AATTGGACCATATGAAATTGCACTTGTTATCGAAGGGAATGAAACCAGAT
CTGGAATCAATTTAATACCAATTCAAGATTCAAAATTGAAAGTGAAAACT
CTTGAGTCGAATTCCGAGATAACAATTTCTCCTAATCAAGCTCTCTTTAT
TTCAAAGTTTCTCAAAGAAAACATTATTTGTCGCAAAGCTATATTGGATA
GCTTGAGAAAAAACACAGAAAATATTGAAGCCGACTCAGCAGAATTTAAA
CAAAATTCGAATGAAGTTAAATCTCAGAAAAAAGAACATTCTGAAAGAAG
TTCATCGGATACTCTTCCCGTGTCTGATCCAAAACTCAAAATTCATTGCA
ATCTTGATCAAAATCCATGCAATGTTTGTTGTGGTTATTTTGATCAACCG
AAAAATTTTATACGAATTCCTTCACCTATTGAGATTGGAAAGGTTAAAAC
TTTGGATGAAATCAACGAGGAAATATCCCGAAATAAGTCTAAAATGAAAA
GTGACAATCGTATAGAAGTTGATAAAACAGAGCAAGGAAATTCGGATAAC
ATTTCAAGTGATTATGATGAGGATAATTTGGAATGTAAAATATATTCGGA
TGATACATATAATTTCGATTCAGACGATTTGGACTTTTCACATTCTAAAT
ATTCCAGAAAGGAAGCTTTTACTGAAACTGATTTAAATTATTGTATCTTG
AAAATATTAAATAAAAATCAAAAAAATAATAATAATGCGAACAATAAAGA
GCAGTGGAAATATTGGGGCAAGAAACCGATTCCTGATGTGATTGATCCAC
CCAGCACGGAACCATATCAAAATCCACAAAATTGGGGTGGCTGTCCAATG
CCCAAAACAACTTTAAATCCAGTGGAGTGGCCTACGACTACATTTCAAAC
AATAAATCCTCATGTTGTTACTGATTACTCGCCAAATAAAATGTATCAGG
TATTCAATCATGAGTCTCACGTACCGTCACGTTTGCCCAAAAGAGATAAA
TCTGTTGGTACAATAAAACCAATTCGTCCTGAAGAACTCTCTCAATTCCG
TTATGAAAATAAATTTAAATACATGCAAGGTGGCTATCCAAAGCTCCAAA
TTAAATACCCGAATGTCGATTCAGTTAAGCCACTGCTAACGTCGTGGTCT
ATATTGGATCCTAAGAACAAAATGGATCAAACAAAAAAATGTATACGATC
CATAGAGAAGAGCAGAATAAATGCACAAATGCAAAGAGACGAAGCTAATT
ATTTAAATTTCATTCATCAAAAACTGACTTCTTGATAAAAAGAACATTTT
GAATAACTATATCCCTGAGATTATTTCAGTATATCATAAGCTCTATTTTT
ATTTCTTTTGAATTGCTTATAATAAAATTCTTGT
back to top

protein sequence of SMED30018511-orf-1

>SMED30018511-orf-1 ID=SMED30018511-orf-1|Name=SMED30018511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=854bp
MSSINIDENLEDFTTNINLSGLRTSLKLVKTIFGEITERNVTFCFDYSGS
MYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQD
NIVDVIRWMNKPSYESKTDILAAIIKSFEDFPDVVYLITDGFINKERATL
LGNLPHISKGRPINCIMMTSQIPPDDVALDFLEDVVTITNGSLSVVLIKD
LGSVEVVMPIIYEARPSGVRRSKFSPFEHEEMDLAAMRKYFVKCKGCYIS
PPNYKSLQGDPMSYLPVIAPFISKDPISGIHCPFYHPFYHWYWPQFWEST
GPSPTLLWAKNDPQYHSMWKDFRDSREFVCNQKYLDKYNNAISSVAAGII
LINRRVLAFNYQDKNKIYLGKVFDQLTPNHFLVKFDVYEEFDDAQQTNLN
EIIDYEEQKRHSIKINDFVLVPVDKTIGPYEIALVIEGNETRSGINLIPI
QDSKLKVKTLESNSEITISPNQALFISKFLKENIICRKAILDSLRKNTEN
IEADSAEFKQNSNEVKSQKKEHSERSSSDTLPVSDPKLKIHCNLDQNPCN
VCCGYFDQPKNFIRIPSPIEIGKVKTLDEINEEISRNKSKMKSDNRIEVD
KTEQGNSDNISSDYDEDNLECKIYSDDTYNFDSDDLDFSHSKYSRKEAFT
ETDLNYCILKILNKNQKNNNNANNKEQWKYWGKKPIPDVIDPPSTEPYQN
PQNWGGCPMPKTTLNPVEWPTTTFQTINPHVVTDYSPNKMYQVFNHESHV
PSRLPKRDKSVGTIKPIRPEELSQFRYENKFKYMQGGYPKLQIKYPNVDS
VKPLLTSWSILDPKNKMDQTKKCIRSIEKSRINAQMQRDEANYLNFIHQK
LTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR032770DUF4537
IPR002035VWF_A
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 491..511
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..532
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 513..528
NoneNo IPR availablePANTHERPTHR14343FAMILY NOT NAMEDcoord: 30..229
NoneNo IPR availablePANTHERPTHR14343:SF5coord: 344..509
NoneNo IPR availablePANTHERPTHR14343FAMILY NOT NAMEDcoord: 344..509
NoneNo IPR availablePANTHERPTHR14343:SF5coord: 30..229
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 38..207
e-value: 3.3E-9
score: 39.0
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 39..193
IPR032770Domain of unknown function DUF4537PFAMPF15057DUF4537coord: 353..478
e-value: 1.1E-8
score: 35.1