Glutamate receptor interacting protein 1

Overview
NameGlutamate receptor interacting protein 1
Smed IDSMED30018509
Length (bp)4001
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor interacting protein 1 (SMED30018509) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor interacting protein 1 (SMED30018509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor interacting protein 1 (SMED30018509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor interacting protein 1 (SMED30018509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018509h1SMcG0014598 dd_Smed_v4_7659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018509h1SMcG0014598 dd_Smed_v4_7659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018509h1SMcG0014598 dd_Smed_v4_7659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30018509h1SMcG0014598 dd_Smed_v4_7659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30018509h1SMcG0000362 Contig4556newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30018509h1SMcG0000362 Contig4556uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30018509h1SMcG0014598 Contig4556newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30018509h1SMcG0014598 Contig4556uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:23841])

HSP 1 Score: 271.937 bits (694), Expect = 1.140e-74
Identity = 239/787 (30.37%), Postives = 379/787 (48.16%), Query Frame = 1
Query:  262 NKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSE----------VYVGSNSLRNINSNSCA------AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSP-NSTDLSIFSD 2544
             + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD+  IGD+I S+NGI  + L H EI++L+K+   ++ L ++YELP                 + K+ DV    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +   +    +A LR+   +    +EY VA+ D  A +  P++VEI K     LG+S+ T      +  +  I+ I+  SV DR G L  G  I +I     +  ++ +A + L S         I   +  + L   QS++ L   +    +K   S++L                    DP    C+                G +  R+++S   +      AFS    S L   S+  S   TM  + Q++ +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + +I+G+AT   ++++ N  L +A   +KVV+   ++V +    ++     F + L KK+S  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C + +AV +L+   D + ++I+K          T       +TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q     + +PL P  S  LS  SD
Sbjct:   35 RRQSIPEEFRGITVVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPR-------IISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTYVRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTVANASGPLMVEIVKTPGSALGISLTTTSLR--NKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLAS---------ISEKVRLEILPVPQSQRPL---RPSEAVKVQRSEQLHRW-----------------DPCVPSCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRTTMGRRRQRRRE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLCGDPLSGFGLQLQGGI-FATETLSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLEVEFDVAE---SVIPSSGTFHVKLPKKRSVELGITISS-ASRKRGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVS---YTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAIHLLQVAGETVTLKIKKQ-----LDRPLLPRKSGSLSETSD 755          

HSP 2 Score: 56.9954 bits (136), Expect = 2.691e-7
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3433 FGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKP 3651
            FG  VS+GL  KG ++  ++P+ PA R   L  +D ++QVN + T +  C   V L++++ + LEL+I  RKP
Sbjct:  953 FGFSVSDGLLEKGVYVHTVRPDGPAHR-GGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELII-SRKP 1023          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:23841])

HSP 1 Score: 271.937 bits (694), Expect = 1.181e-74
Identity = 239/787 (30.37%), Postives = 379/787 (48.16%), Query Frame = 1
Query:  262 NKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSE----------VYVGSNSLRNINSNSCA------AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSP-NSTDLSIFSD 2544
             + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD+  IGD+I S+NGI  + L H EI++L+K+   ++ L ++YELP                 + K+ DV    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +   +    +A LR+   +    +EY VA+ D  A +  P++VEI K     LG+S+ T      +  +  I+ I+  SV DR G L  G  I +I     +  ++ +A + L S         I   +  + L   QS++ L   +    +K   S++L                    DP    C+                G +  R+++S   +      AFS    S L   S+  S   TM  + Q++ +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + +I+G+AT   ++++ N  L +A   +KVV+   ++V +    ++     F + L KK+S  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C + +AV +L+   D + ++I+K          T       +TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q     + +PL P  S  LS  SD
Sbjct:   40 RRQSIPEEFRGITVVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPR-------IISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTYVRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTVANASGPLMVEIVKTPGSALGISLTTTSLR--NKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLAS---------ISEKVRLEILPVPQSQRPL---RPSEAVKVQRSEQLHRW-----------------DPCVPSCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRTTMGRRRQRRRE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLCGDPLSGFGLQLQGGI-FATETLSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLEVEFDVAE---SVIPSSGTFHVKLPKKRSVELGITISS-ASRKRGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVS---YTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAIHLLQVAGETVTLKIKKQ-----LDRPLLPRKSGSLSETSD 760          

HSP 2 Score: 56.9954 bits (136), Expect = 2.604e-7
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3433 FGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKP 3651
            FG  VS+GL  KG ++  ++P+ PA R   L  +D ++QVN + T +  C   V L++++ + LEL+I  RKP
Sbjct:  958 FGFSVSDGLLEKGVYVHTVRPDGPAHR-GGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELII-SRKP 1028          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:23841])

HSP 1 Score: 271.937 bits (694), Expect = 2.394e-74
Identity = 239/786 (30.41%), Postives = 379/786 (48.22%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSE----------VYVGSNSLRNINSNSCA------AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSP-NSTDLSIFSD 2544
            + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD+  IGD+I S+NGI  + L H EI++L+K+   ++ L ++YELP                 + K+ DV    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +   +    +A LR+   +    +EY VA+ D  A +  P++VEI K     LG+S+ T      +  +  I+ I+  SV DR G L  G  I +I     +  ++ +A + L S         I   +  + L   QS++ L   +    +K   S++L                    DP    C+                G +  R+++S   +      AFS    S L   S+  S   TM  + Q++ +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + +I+G+AT   ++++ N  L +A   +KVV+   ++V +    ++     F + L KK+S  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C + +AV +L+   D + ++I+K          T       +TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q     + +PL P  S  LS  SD
Sbjct:  133 RQSIPEEFRGITVVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPR-------IISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTYVRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTVANASGPLMVEIVKTPGSALGISLTTTSLR--NKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLAS---------ISEKVRLEILPVPQSQRPL---RPSEAVKVQRSEQLHRW-----------------DPCVPSCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRTTMGRRRQRRRE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLCGDPLSGFGLQLQGGI-FATETLSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLEVEFDVAE---SVIPSSGTFHVKLPKKRSVELGITISS-ASRKRGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVS---YTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAIHLLQVAGETVTLKIKKQ-----LDRPLLPRKSGSLSETSD 852          

HSP 2 Score: 56.9954 bits (136), Expect = 2.922e-7
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3433 FGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKP 3651
            FG  VS+GL  KG ++  ++P+ PA R   L  +D ++QVN + T +  C   V L++++ + LEL+I  RKP
Sbjct: 1050 FGFSVSDGLLEKGVYVHTVRPDGPAHR-GGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELII-SRKP 1120          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Match: GRIP1 (glutamate receptor interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:18708])

HSP 1 Score: 189.504 bits (480), Expect = 4.562e-48
Identity = 106/301 (35.22%), Postives = 176/301 (58.47%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   +  L IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 335          

HSP 2 Score: 139.043 bits (349), Expect = 1.959e-32
Identity = 101/318 (31.76%), Postives = 163/318 (51.26%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ +  L +++     +L    D    ++     F + L KK +  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P S+ LS   D
Sbjct:  467 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISSHLSDLGD 777          

HSP 3 Score: 87.0409 bits (214), Expect = 1.913e-16
Identity = 79/263 (30.04%), Postives = 128/263 (48.67%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     IF   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+       + I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATAS----GPLLVEVAKT-PGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 84.7297 bits (208), Expect = 9.829e-16
Identity = 75/283 (26.50%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK  +V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  483 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHNVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 752          

HSP 5 Score: 66.2402 bits (160), Expect = 4.765e-10
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ N  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  482 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHNVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 654          

HSP 6 Score: 62.7734 bits (151), Expect = 4.417e-9
Identity = 56/185 (30.27%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  161 TFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSMC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 7 Score: 62.3882 bits (150), Expect = 5.742e-9
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  956 ERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGD-LGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1084          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Match: GRIP1 (glutamate receptor interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:18708])

HSP 1 Score: 189.119 bits (479), Expect = 5.043e-48
Identity = 106/301 (35.22%), Postives = 176/301 (58.47%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   +  L IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 335          

HSP 2 Score: 139.043 bits (349), Expect = 2.027e-32
Identity = 101/318 (31.76%), Postives = 163/318 (51.26%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ +  L +++     +L    D    ++     F + L KK +  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P S+ LS   D
Sbjct:  415 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISSHLSDLGD 725          

HSP 3 Score: 86.6557 bits (213), Expect = 2.531e-16
Identity = 79/263 (30.04%), Postives = 128/263 (48.67%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     IF   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+       + I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 83.9593 bits (206), Expect = 1.624e-15
Identity = 75/283 (26.50%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK  +V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  431 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHNVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 700          

HSP 5 Score: 65.4698 bits (158), Expect = 6.380e-10
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ N  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  430 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHNVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 602          

HSP 6 Score: 62.7734 bits (151), Expect = 4.711e-9
Identity = 56/185 (30.27%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  161 TFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSMC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 7 Score: 62.3882 bits (150), Expect = 6.337e-9
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  889 ERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGD-LGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1017          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Match: lin-7 (pep chromosome:WBcel235:II:14346877:14348792:-1 gene:WBGene00002996.1 transcript:Y54G11A.10a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-7)

HSP 1 Score: 56.6102 bits (135), Expect = 1.495e-8
Identity = 26/78 (33.33%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDY 546
            + K ++ LG  V GG ++     I+ I PG +A+R      GD +I++NG++  + CH++ V L+KS+   + L+I Y
Sbjct:   95 LPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLKSAVGSVKLVIRY 172          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Match: lin-7 (pep chromosome:WBcel235:II:14347162:14348792:-1 gene:WBGene00002996.1 transcript:Y54G11A.10b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-7)

HSP 1 Score: 50.8322 bits (120), Expect = 1.562e-6
Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDY 546
            + K ++ LG  V GG ++     I+ I PG +A+R      GD +I++NG +  + CH++ V L+KS+   + L+I Y
Sbjct:   95 LPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLIAVNG-NVEAECHEKAVDLLKSAVGSVKLVIRY 171          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.9878 bits (123), Expect = 3.083e-6
Identity = 64/238 (26.89%), Postives = 109/238 (45.80%), Query Frame = 1
Query:  166 LKQKMACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISR-INVDIIKKDNETLGLTVSGGADRGETPV-IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV------DEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
            +   +  S +R +   LG      + N +PL    S Y +K S  I V +I+K     G  + GG +  +TP+ +  I  G  AE       GD I+ I+G +     H E V L++++     + +    P +T+  +   +  A  +   S DV      ++GFGFV      K+ S     TV  I+PGS A R GR+  GD++++     +  L+  + I+L+++    + LTI
Sbjct:  429 MSSAIPASRMRPSSTTLG----FATPNYIPL----SQYNQKPSDLITVSLIRKP-VGFGFRLLGGVE-SKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSAGPS--GSYDVLLHRNENDGFGFVLMSSQHKNGS-----TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 649          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.9878 bits (123), Expect = 3.202e-6
Identity = 64/238 (26.89%), Postives = 109/238 (45.80%), Query Frame = 1
Query:  166 LKQKMACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISR-INVDIIKKDNETLGLTVSGGADRGETPV-IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV------DEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
            +   +  S +R +   LG      + N +PL    S Y +K S  I V +I+K     G  + GG +  +TP+ +  I  G  AE       GD I+ I+G +     H E V L++++     + +    P +T+  +   +  A  +   S DV      ++GFGFV      K+ S     TV  I+PGS A R GR+  GD++++     +  L+  + I+L+++    + LTI
Sbjct:  482 MSSAIPASRMRPSSTTLG----FATPNYIPL----SQYNQKPSDLITVSLIRKP-VGFGFRLLGGVE-SKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSAGPS--GSYDVLLHRNENDGFGFVLMSSQHKNGS-----TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 702          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.9878 bits (123), Expect = 3.224e-6
Identity = 64/238 (26.89%), Postives = 109/238 (45.80%), Query Frame = 1
Query:  166 LKQKMACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISR-INVDIIKKDNETLGLTVSGGADRGETPV-IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV------DEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
            +   +  S +R +   LG      + N +PL    S Y +K S  I V +I+K     G  + GG +  +TP+ +  I  G  AE       GD I+ I+G +     H E V L++++     + +    P +T+  +   +  A  +   S DV      ++GFGFV      K+ S     TV  I+PGS A R GR+  GD++++     +  L+  + I+L+++    + LTI
Sbjct:  456 MSSAIPASRMRPSSTTLG----FATPNYIPL----SQYNQKPSDLITVSLIRKP-VGFGFRLLGGVE-SKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSAGPS--GSYDVLLHRNENDGFGFVLMSSQHKNGS-----TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 676          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Match: Grip (gene:FBgn0029830 transcript:FBtr0070865)

HSP 1 Score: 87.0409 bits (214), Expect = 9.651e-17
Identity = 85/310 (27.42%), Postives = 141/310 (45.48%), Query Frame = 1
Query:  334 LGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK----PKISLIIDYELPXXXXXXXX--XXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLR--EHRDKLT-LTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY----------------HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDK--------MTINDAIEALKSGQRERIKLRIIP 1164
            L +T +   D    PV+ ++ P  +   +D    GD +  I+GIST  L +Q++++++ +      P I + I+Y LPE T  Q    +  K A +T+ +        G   RGG         PL V H+RP     + GRIKPGD+++   N  +   T      +++   H    T LTIEY V+ V     S  P+++EI++ +N++LG+ +  Y                 +   +S   +I +I   S+ADRCG L +G  + +I D   +         MTI D      S  R   +++I+P
Sbjct:   92 LAITFAERNDLSYPPVVGSLNP--VGHAADFLAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDACPAI-VEIEYSLPECTVSQNSLCVTSKLAQITVERESGC---LGLTLRGG------ADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLLIEIERPMNDKLGLVLCNYTAAVPASGSGSSTPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDT-----STGRGYTQMQIMP 384          

HSP 2 Score: 65.0846 bits (157), Expect = 4.045e-10
Identity = 62/235 (26.38%), Postives = 102/235 (43.40%), Query Frame = 1
Query: 1753 LIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQ-------LLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQ-----NSSDSLTVRIXXXXXXXXXXXXX---------XXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQP--ILIDSINPASVASGVSKLSSGDQILSIN 2388
            L  GD +  IDG++TIG S  ++ N L         ++ E+    P+       L V   + +IT++++SG LG+ L+         PL+++ V P     + G I PGD LL +D   +   TLAEA  +++     +   +LT+            S                G+   +    +P    G     + + I++   + I SI PAS+A     LS GDQ+LSI+
Sbjct:  121 LAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDACPAIVEIEYSLPECTVSQNSLCVTSKLAQITVERESGCLGLTLRG----GADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLLIEIERPMNDKLGLVLCNYTAAVPASGSGSSTPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSID 351          

HSP 3 Score: 58.9214 bits (141), Expect = 3.067e-8
Identity = 40/154 (25.97%), Postives = 73/154 (47.40%), Query Frame = 1
Query: 3196 IDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAK-----RSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            I R  +  +G  +P +  + A ++ R  S  +  E+ KES   +          SGS K           +  + L +    + +G  VS+GL  +G FI+ I+   PA  C  L  +D I+QVN + T++  C   V LI+ + + +E+++++
Sbjct:  912 ILRSHDLANGSHLPQTQAIYAKVQRRPRSPSANTEASKESGSGNANGGGAVNGNSGSGKP---------RVFHVTLYKDKVYDDYGFSVSDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEMIMQR 1056          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Match: Grip (gene:FBgn0029830 transcript:FBtr0343413)

HSP 1 Score: 86.6557 bits (213), Expect = 1.193e-16
Identity = 85/331 (25.68%), Postives = 147/331 (44.41%), Query Frame = 1
Query:  268 SSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK----PKISLIIDYELPXXXXXXXX-XXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLR--EHRDKLT-LTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY----------------HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDK--------MTINDAIEALKSGQRERIKLRIIP 1164
            S +  E+ +      + ++   L +T +   D    PV+ ++ P  +   +D    GD +  I+GIST  L +Q++++++ +      P I + I+Y LPE        +  K A +T+ +        G   RGG         PL V H+RP     + GRIKPGD+++   N  +   T      +++   H    T LTIEY V+ V     S  P+++EI++ +N++LG+ +  Y                 +   +S   +I +I   S+ADRCG L +G  + +I D   +         MTI D      S  R   +++I+P
Sbjct:   70 SGLAPERGTTYATITLPRNALHLAITFAERNDLSYPPVVGSLNP--VGHAADFLAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDACPAI-VEIEYSLPECISQNSLCVTSKLAQITVERESGC---LGLTLRGG------ADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLLIEIERPMNDKLGLVLCNYTAAVPASGSGSSTPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDT-----STGRGYTQMQIMP 383          

HSP 2 Score: 60.077 bits (144), Expect = 1.639e-8
Identity = 25/84 (29.76%), Postives = 48/84 (57.14%), Query Frame = 1
Query: 3391 IMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +  + L +    + +G  VS+GL  +G FI+ I+   PA  C  L  +D I+QVN + T++  C   V LI+ + + +E+++++
Sbjct:  972 VFHVTLYKDKVYDDYGFSVSDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEMIMQR 1055          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Match: Grip (gene:FBgn0029830 transcript:FBtr0343414)

HSP 1 Score: 86.6557 bits (213), Expect = 1.193e-16
Identity = 85/331 (25.68%), Postives = 147/331 (44.41%), Query Frame = 1
Query:  268 SSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK----PKISLIIDYELPXXXXXXXX-XXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLR--EHRDKLT-LTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY----------------HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDK--------MTINDAIEALKSGQRERIKLRIIP 1164
            S +  E+ +      + ++   L +T +   D    PV+ ++ P  +   +D    GD +  I+GIST  L +Q++++++ +      P I + I+Y LPE        +  K A +T+ +        G   RGG         PL V H+RP     + GRIKPGD+++   N  +   T      +++   H    T LTIEY V+ V     S  P+++EI++ +N++LG+ +  Y                 +   +S   +I +I   S+ADRCG L +G  + +I D   +         MTI D      S  R   +++I+P
Sbjct:   70 SGLAPERGTTYATITLPRNALHLAITFAERNDLSYPPVVGSLNP--VGHAADFLAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDACPAI-VEIEYSLPECISQNSLCVTSKLAQITVERESGC---LGLTLRGG------ADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLLIEIERPMNDKLGLVLCNYTAAVPASGSGSSTPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDT-----STGRGYTQMQIMP 383          

HSP 2 Score: 60.077 bits (144), Expect = 1.639e-8
Identity = 25/84 (29.76%), Postives = 48/84 (57.14%), Query Frame = 1
Query: 3391 IMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +  + L +    + +G  VS+GL  +G FI+ I+   PA  C  L  +D I+QVN + T++  C   V LI+ + + +E+++++
Sbjct:  972 VFHVTLYKDKVYDDYGFSVSDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEMIMQR 1055          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Match: Magi (gene:FBgn0034590 transcript:FBtr0342874)

HSP 1 Score: 64.3142 bits (155), Expect = 7.805e-10
Identity = 49/177 (27.68%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  334 LGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLII-DYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
             G  + GG + G    + +I PG  A++      GD I+SI+GI+  +  H ++VSLV  S  + ++++I+     P   +     ++++    +  S   +EGFGFV         +     T+  + PGS ADR G +K GD+IV+    ++  ++  +V+ L++E    + LTI
Sbjct:  938 FGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFV----IISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTI 1110          

HSP 2 Score: 60.077 bits (144), Expect = 1.697e-8
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASV-DMSAVSGR----PIIVEIQKQVNERLGVSIATYHDNGTDSQIFY---IENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLRI 1158
            GFGF   GG  ++ S+   +TV HI PG  AD+D RI  GD+I+S     V + +   V++L+ E   R ++T+ +      +   + VS +    P  V + +  NE  G  I +       S  +Y   I  +  GS ADRCG L++G  I A+  +    M+  D +  +K SG   R+ + +
Sbjct:  937 GFGFRIVGG-TEEGSQ---VTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFVIIS------SSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGV 1112          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Match: Magi (gene:FBgn0034590 transcript:FBtr0071636)

HSP 1 Score: 64.3142 bits (155), Expect = 7.805e-10
Identity = 49/177 (27.68%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  334 LGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLII-DYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
             G  + GG + G    + +I PG  A++      GD I+SI+GI+  +  H ++VSLV  S  + ++++I+     P   +     ++++    +  S   +EGFGFV         +     T+  + PGS ADR G +K GD+IV+    ++  ++  +V+ L++E    + LTI
Sbjct:  938 FGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFV----IISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTI 1110          

HSP 2 Score: 60.077 bits (144), Expect = 1.697e-8
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASV-DMSAVSGR----PIIVEIQKQVNERLGVSIATYHDNGTDSQIFY---IENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLRI 1158
            GFGF   GG  ++ S+   +TV HI PG  AD+D RI  GD+I+S     V + +   V++L+ E   R ++T+ +      +   + VS +    P  V + +  NE  G  I +       S  +Y   I  +  GS ADRCG L++G  I A+  +    M+  D +  +K SG   R+ + +
Sbjct:  937 GFGFRIVGG-TEEGSQ---VTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFVIIS------SSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGV 1112          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Match: grip1 (glutamate receptor interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-041210-125])

HSP 1 Score: 195.667 bits (496), Expect = 3.553e-50
Identity = 109/301 (36.21%), Postives = 177/301 (58.80%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI  E      V++IKK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I S+NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  K   +TL K  +    FGFV RGG  +D +K RP+T+  IRPG  ADR+G IKPGD+++S    ++   +    +++L++   + TL IEY V+ +D  A +  P++VE+ K +   LG++++T      + Q+  I+ ++  S+ADRCG L  G  I ++     +  T+ +A + L S   E +K+ I+P+
Sbjct:   60 RQSIPDEFKGTSTVELIKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSGVMFKNVEVTLHKEGNT---FGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKSMGSSLGLALSTSMY--CNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASAS-EHVKMEILPH 354          

HSP 2 Score: 132.88 bits (333), Expect = 1.071e-30
Identity = 96/296 (32.43%), Postives = 154/296 (52.03%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVR-DPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H E  +V L  DS   FG  L+      TE L   P I +I  D PA  CG+L  GD I +I+G+ T   +L++  NQL+  + +      E+  D    ++     F + L K+ G  LGI + +  +R  G+ L+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN +SL+G  L++A+ +L    + V + + +Q
Sbjct:  480 HTETTEVTLISDSIMGFGIQLQGGV-FATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEE-TNQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKPGVELGITISSPSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIKKQ 767          

HSP 3 Score: 91.6633 bits (226), Expect = 4.428e-18
Identity = 82/286 (28.67%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRP---LTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+IA I P S AER  I  IGD I+SINGI T     +E   L++ S    K++L I++++                + LPK   V+ G    +       PS  +P   L +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  496 FGIQLQGGVFATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKPGVELGITISS-------PSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIK 765          

HSP 4 Score: 86.2705 bits (212), Expect = 1.914e-16
Identity = 73/263 (27.76%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIK+++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P+ I+ + PG  A R G I PGD LL++D   +   + AEA+ +L+      T+ I+    +  S +  S    G   V++ + +     G+ +S +     Q I+ID + PAS+A     L +GD ILS++G S+   TL +A ++L    + V++ +L
Sbjct:   97 PRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSGVMFKNVEVTLHKEGNTFGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAKSMGSS-LGLALSTSMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEIL 352          

HSP 5 Score: 67.0106 bits (162), Expect = 1.638e-10
Identity = 61/185 (32.97%), Postives = 88/185 (47.57%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  I+   PA   G +  GD + +IDG+   G S       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I KV P S A RCG +  GD +L++D   +E CTLAEA  LL ++S+ + + I
Sbjct:  180 TFGFVIRGGAHEDRNKSRPVT---ITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKSMGSSLGLALSTSM-YCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEI 351          

HSP 6 Score: 63.1586 bits (152), Expect = 2.654e-9
Identity = 43/160 (26.88%), Postives = 78/160 (48.75%), Query Frame = 1
Query: 3166 SKEHLNESRSI-DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++ HL    S  +R +N+        S  LP ++  +A +++  ++ IK                DI S + +   +  + L + +  E FG  VS+G+  KG +++ I+P  PA     L  YD ++Q+N + T +  C  VV LI++S N L+L+I +
Sbjct:  940 TRSHLGRQASFQERGSNKPQYSQANRSNTLPTDVGRKAFAMRRMKQEIK----------------DIMSPTPV--ELHKVSLLKDSDLEDFGFSVSDGVLEKGVYVNNIRPGGPA-EIGGLKPYDRLLQINHVRTRDFDCCLVVPLIAESGNKLDLVISR 1080          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Match: grip1 (glutamate receptor interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-041210-125])

HSP 1 Score: 195.667 bits (496), Expect = 4.192e-50
Identity = 109/301 (36.21%), Postives = 177/301 (58.80%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI  E      V++IKK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I S+NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  K   +TL K  +    FGFV RGG  +D +K RP+T+  IRPG  ADR+G IKPGD+++S    ++   +    +++L++   + TL IEY V+ +D  A +  P++VE+ K +   LG++++T      + Q+  I+ ++  S+ADRCG L  G  I ++     +  T+ +A + L S   E +K+ I+P+
Sbjct:   67 RQSIPDEFKGTSTVELIKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSGVMFKNVEVTLHKEGNT---FGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKSMGSSLGLALST--SMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASAS-EHVKMEILPH 361          

HSP 2 Score: 133.265 bits (334), Expect = 8.162e-31
Identity = 100/309 (32.36%), Postives = 161/309 (52.10%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS 2511
            H E  +V L  DS   FG  L+      TE L   P I +I  D PA  CG+L  GD I +I+G+ T   +L++ N  L +++   KV +   ++V +    ++     F + L K+ G  LGI + +  +R  G+ L+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN +SL+G  L++A+ +L    + V + + +Q  E    KP S
Sbjct:  487 HTETTEVTLISDSIMGFGIQLQGGV-FATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKPGVELGITISSPSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIKKQ-GELPSPKPPS 784          

HSP 3 Score: 91.6633 bits (226), Expect = 5.206e-18
Identity = 82/286 (28.67%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRP---LTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+IA I P S AER  I  IGD I+SINGI T     +E   L++ S    K++L I++++                + LPK   V+ G    +       PS  +P   L +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  503 FGIQLQGGVFATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKPGVELGITISS-------PSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIK 772          

HSP 4 Score: 86.2705 bits (212), Expect = 1.850e-16
Identity = 73/263 (27.76%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIK+++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P+ I+ + PG  A R G I PGD LL++D   +   + AEA+ +L+      T+ I+    +  S +  S    G   V++ + +     G+ +S +     Q I+ID + PAS+A     L +GD ILS++G S+   TL +A ++L    + V++ +L
Sbjct:  104 PRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSGVMFKNVEVTLHKEGNTFGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAKSMGSS-LGLALSTSMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEIL 359          

HSP 5 Score: 67.3958 bits (163), Expect = 1.321e-10
Identity = 61/185 (32.97%), Postives = 88/185 (47.57%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  I+   PA   G +  GD + +IDG+   G S       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I KV P S A RCG +  GD +L++D   +E CTLAEA  LL ++S+ + + I
Sbjct:  187 TFGFVIRGGAHEDRNKSRPVT---ITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKSMGSSLGLALSTSM-YCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEI 358          

HSP 6 Score: 63.1586 bits (152), Expect = 2.310e-9
Identity = 43/160 (26.88%), Postives = 78/160 (48.75%), Query Frame = 1
Query: 3166 SKEHLNESRSI-DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++ HL    S  +R +N+        S  LP ++  +A +++  ++ IK                DI S + +   +  + L + +  E FG  VS+G+  KG +++ I+P  PA     L  YD ++Q+N + T +  C  VV LI++S N L+L+I +
Sbjct:  960 TRSHLGRQASFQERGSNKPQYSQANRSNTLPTDVGRKAFAMRRMKQEIK----------------DIMSPTPV--ELHKVSLLKDSDLEDFGFSVSDGVLEKGVYVNNIRPGGPA-EIGGLKPYDRLLQINHVRTRDFDCCLVVPLIAESGNKLDLVISR 1100          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Match: grip1 (glutamate receptor interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-041210-125])

HSP 1 Score: 195.282 bits (495), Expect = 4.458e-50
Identity = 109/301 (36.21%), Postives = 177/301 (58.80%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI  E      V++IKK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I S+NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  K   +TL K  +    FGFV RGG  +D +K RP+T+  IRPG  ADR+G IKPGD+++S    ++   +    +++L++   + TL IEY V+ +D  A +  P++VE+ K +   LG++++T      + Q+  I+ ++  S+ADRCG L  G  I ++     +  T+ +A + L S   E +K+ I+P+
Sbjct:   67 RQSIPDEFKGTSTVELIKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSGVMFKNVEVTLHKEGNT---FGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKSMGSSLGLALST--SMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASAS-EHVKMEILPH 361          

HSP 2 Score: 132.88 bits (333), Expect = 9.323e-31
Identity = 100/309 (32.36%), Postives = 161/309 (52.10%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS 2511
            H E  +V L  DS   FG  L+      TE L   P I +I  D PA  CG+L  GD I +I+G+ T   +L++ N  L +++   KV +   ++V +    ++     F + L K+ G  LGI + +  +R  G+ L+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN +SL+G  L++A+ +L    + V + + +Q  E    KP S
Sbjct:  487 HTETTEVTLISDSIMGFGIQLQGGV-FATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKPGVELGITISSPSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIKKQ-GELPSPKPPS 784          

HSP 3 Score: 91.2781 bits (225), Expect = 5.354e-18
Identity = 82/286 (28.67%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRP---LTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+IA I P S AER  I  IGD I+SINGI T     +E   L++ S    K++L I++++                + LPK   V+ G    +       PS  +P   L +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  503 FGIQLQGGVFATETLSSPPLIAYIDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKPGVELGITISS-------PSSRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSNSLKGKPLSEAIHLLQMAGESVTLKIK 772          

HSP 4 Score: 86.2705 bits (212), Expect = 1.824e-16
Identity = 73/263 (27.76%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIK+++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P+ I+ + PG  A R G I PGD LL++D   +   + AEA+ +L+      T+ I+    +  S +  S    G   V++ + +     G+ +S +     Q I+ID + PAS+A     L +GD ILS++G S+   TL +A ++L    + V++ +L
Sbjct:  104 PRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSGVMFKNVEVTLHKEGNTFGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAKSMGSS-LGLALSTSMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEIL 359          

HSP 5 Score: 67.0106 bits (162), Expect = 1.409e-10
Identity = 61/185 (32.97%), Postives = 88/185 (47.57%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  I+   PA   G +  GD + +IDG+   G S       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I KV P S A RCG +  GD +L++D   +E CTLAEA  LL ++S+ + + I
Sbjct:  187 TFGFVIRGGAHEDRNKSRPVT---ITTIRPGGPADREGTIKPGDRLLSIDGIRLHGASHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKSMGSSLGLALSTSM-YCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASASEHVKMEI 358          

HSP 6 Score: 63.1586 bits (152), Expect = 2.361e-9
Identity = 43/160 (26.88%), Postives = 78/160 (48.75%), Query Frame = 1
Query: 3166 SKEHLNESRSI-DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++ HL    S  +R +N+        S  LP ++  +A +++  ++ IK                DI S + +   +  + L + +  E FG  VS+G+  KG +++ I+P  PA     L  YD ++Q+N + T +  C  VV LI++S N L+L+I +
Sbjct:  947 TRSHLGRQASFQERGSNKPQYSQANRSNTLPTDVGRKAFAMRRMKQEIK----------------DIMSPTPV--ELHKVSLLKDSDLEDFGFSVSDGVLEKGVYVNNIRPGGPA-EIGGLKPYDRLLQINHVRTRDFDCCLVVPLIAESGNKLDLVISR 1087          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Match: grip2b (glutamate receptor interacting protein 2b [Source:ZFIN;Acc:ZDB-GENE-070705-172])

HSP 1 Score: 184.496 bits (467), Expect = 1.044e-46
Identity = 116/318 (36.48%), Postives = 176/318 (55.35%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXA-SLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIP 1164
            GN + +  +N L    + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP          I +   + L K  +    FGFV RGG  +D  K RPL V H+RPG  ADR+G +K GD+I+S     +   T  + + +L +   +    IEY V+ +D    +  P++VEI K     LGV++ T  H N    Q   I+ I+ GSV DR G L +G  I +I    T+  ++ +A + L S   ++ KL I+P
Sbjct:   53 GNKDSTGPENSL-TSRRQSIPEELRGVTLVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPSAAPDSTSGVISKTIEICLQKEGN---SFGFVMRGGAHEDWHKSRPLVVTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNASGPLLVEIAKAPGASLGVTLTTALHRN---KQAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLAS-TSDQTKLEILP 362          

HSP 2 Score: 132.88 bits (333), Expect = 9.034e-31
Identity = 98/298 (32.89%), Postives = 156/298 (52.35%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L+K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A  +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  490 HTESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDVAE---SVVPSSGTFHVKLQKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSEDLVKLKIRKDEDNSDEQESSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 775          

HSP 3 Score: 83.5741 bits (205), Expect = 1.442e-15
Identity = 81/310 (26.13%), Postives = 143/310 (46.13%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHST 1236
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K+SL I++++                + L K   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++   +   ++ K N  E  L   +D  T
Sbjct:  506 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDV----AESVVPSSGTFHVKLQKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSEDLVKLKIRKDEDNSDEQESSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQADSPDEKNKENDLENDLSDNEDEMT 800          

HSP 4 Score: 75.8702 bits (185), Expect = 3.220e-13
Identity = 68/242 (28.10%), Postives = 112/242 (46.28%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRD--PDPQLLVEETIFEITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L+K+  S G  ++  A        PL+++ V PG  A R G +  GD +L++D   +   T ++A+ +L         +I+    +  S +  S    G   V++ +  P    G+ ++       Q I+ID I P SV      L  GD ILSI+G S    +L +A ++L    DQ ++ +L
Sbjct:  125 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPSAAPDSTSGVISKTIEICLQKEGNSFGFVMRGGAHEDWHKSRPLVVTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNAS----GPLLVEIAK-APGASLGVTLTTALHRNKQAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLASTSDQTKLEIL 361          

HSP 5 Score: 69.707 bits (169), Expect = 2.403e-11
Identity = 52/177 (29.38%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K++L IE+ VA  +    S     V++QK+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA + L+  + + +KL+I
Sbjct:  505 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDVA--ESVVPSSGTFHVKLQKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSE-DLVKLKI 675          

HSP 6 Score: 61.6178 bits (148), Expect = 7.359e-9
Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 1
Query: 3355 KDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +DI S + L  + +T+   +   ++ FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  993 QDILSPTPLELHKVTV--MKDPESDDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1085          

HSP 7 Score: 61.6178 bits (148), Expect = 7.808e-9
Identity = 50/183 (27.32%), Postives = 83/183 (45.36%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + H++   PA   G L  GD I ++DG+     +       L Q   + +   +  ++ +  V +    LLVE        K    SLG+ L   + R   + ++I K+ PGS   R G +  GD +L++D    E C+L EA  LL ++SD   + I
Sbjct:  189 SFGFVMRGGAHEDWHKSRPLV----VTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNASGPLLVE------IAKAPGASLGVTLTTALHRNK-QAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLASTSDQTKLEI 360          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Match: grip2b (glutamate receptor interacting protein 2b [Source:ZFIN;Acc:ZDB-GENE-070705-172])

HSP 1 Score: 182.57 bits (462), Expect = 4.247e-46
Identity = 109/289 (37.72%), Postives = 164/289 (56.75%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXA-SLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIP 1164
            V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP          I +   + L K  +    FGFV RGG  +D  K RPL V H+RPG  ADR+G +K GD+I+S     +   T  + + +L +   +    IEY V+ +D    +  P++VEI K     LGV++ T  H N    Q   I+ I+ GSV DR G L +G  I +I    T+  ++ +A + L S   ++ KL I+P
Sbjct:   48 VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPSAAPDSTSGVISKTIEICLQKEGN---SFGFVMRGGAHEDWHKSRPLVVTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNASGPLLVEIAKAPGASLGVTLTTALHRN---KQAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLAS-TSDQTKLEILP 329          

HSP 2 Score: 133.265 bits (334), Expect = 8.084e-31
Identity = 98/298 (32.89%), Postives = 156/298 (52.35%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L+K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A  +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  457 HTESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDVAE---SVVPSSGTFHVKLQKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSEDLVKLKIRKDEDNSDEQESSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 742          

HSP 3 Score: 83.5741 bits (205), Expect = 1.484e-15
Identity = 81/310 (26.13%), Postives = 143/310 (46.13%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHST 1236
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K+SL I++++                + L K   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++   +   ++ K N  E  L   +D  T
Sbjct:  473 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDV----AESVVPSSGTFHVKLQKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSEDLVKLKIRKDEDNSDEQESSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQADSPDEKNKENDLENDLSDNEDEMT 767          

HSP 4 Score: 75.8702 bits (185), Expect = 3.236e-13
Identity = 68/242 (28.10%), Postives = 112/242 (46.28%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L+K+  S G  ++  A        PL+++ V PG  A R G +  GD +L++D   +   T ++A+ +L         +I+    +  S +  S    G   V++ +  P    G+ ++       Q I+ID I P SV      L  GD ILSI+G S    +L +A ++L    DQ ++ +L
Sbjct:   92 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPSAAPDSTSGVISKTIEICLQKEGNSFGFVMRGGAHEDWHKSRPLVVTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNAS----GPLLVEIAKA-PGASLGVTLTTALHRNKQAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLASTSDQTKLEIL 328          

HSP 5 Score: 69.707 bits (169), Expect = 2.439e-11
Identity = 52/177 (29.38%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K++L IE+ VA  +    S     V++QK+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA + L+  + + +KL+I
Sbjct:  472 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRVLSINGIPTEDGTLEEANQLLRDAALANKVSLEIEFDVA--ESVVPSSGTFHVKLQKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAAQILQQSE-DLVKLKI 642          

HSP 6 Score: 61.6178 bits (148), Expect = 6.590e-9
Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 1
Query: 3355 KDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +DI S + L  + +T+   +   ++ FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  960 QDILSPTPLELHKVTV--MKDPESDDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1052          

HSP 7 Score: 61.6178 bits (148), Expect = 7.419e-9
Identity = 50/183 (27.32%), Postives = 83/183 (45.36%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + H++   PA   G L  GD I ++DG+     +       L Q   + +   +  ++ +  V +    LLVE        K    SLG+ L   + R   + ++I K+ PGS   R G +  GD +L++D    E C+L EA  LL ++SD   + I
Sbjct:  156 SFGFVMRGGAHEDWHKSRPLV----VTHVRPGGPADREGTLKSGDRILSVDGVVLHSATHSDALVVLTQCGQEALFQIEYDVSIMDSVTNASGPLLVE------IAKAPGASLGVTLTTALHRNK-QAIVIDKIKPGSVVDRSGALHVGDHILSIDGTSTEHCSLLEATQLLASTSDQTKLEI 327          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:100495373])

HSP 1 Score: 294.664 bits (753), Expect = 4.019e-82
Identity = 242/782 (30.95%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D  L +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+R G +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K  D+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T+ +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L   +   S   TMS + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GE L+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   26 GNKDPAGNDLAL-VSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PATPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGTLKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLAS-IIENVKLEILP-AHHSRLSLRPPETVKVQKSDHHHCW---------------------------DPCVNYCHTPHPGHCKTPTWNSTSNQEYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTAHPMSPRTTMSRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS-ASRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 744          

HSP 2 Score: 86.6557 bits (213), Expect = 1.992e-16
Identity = 79/291 (27.15%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +   L +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  474 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS---ASRKPGES--LIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQAERIFP 750          

HSP 3 Score: 67.781 bits (164), Expect = 1.155e-10
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H + +LS  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD I+QVN + T +  C   V L+S +   L+L+I +
Sbjct:  955 KEEVHDAQSLSTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDRILQVNHVRTRDFDCCLTVPLLSDAGGRLDLVISR 1050          

HSP 4 Score: 62.7734 bits (151), Expect = 4.448e-9
Identity = 54/180 (30.00%), Postives = 87/180 (48.33%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS       + ++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  474 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSASRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 648          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:100495373])

HSP 1 Score: 294.278 bits (752), Expect = 4.193e-82
Identity = 242/782 (30.95%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D L  +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+R G +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K  D+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T+ +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L   +   S   TMS + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GE L+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   22 GNKDPAGND-LALVSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PATPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGTLKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLAS-IIENVKLEILP-AHHSRLSLRPPETVKVQKSDHHHCW---------------------------DPCVNYCHTPHPGHCKTPTWNSTSNQEYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTAHPMSPRTTMSRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS--SRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 739          

HSP 2 Score: 86.6557 bits (213), Expect = 1.970e-16
Identity = 79/291 (27.15%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +   L +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  470 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS----SRKPGES--LIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQAERIFP 745          

HSP 3 Score: 68.1662 bits (165), Expect = 1.068e-10
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H + +LS  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD I+QVN + T +  C   V L+S +   L+L+I +
Sbjct:  950 KEEVHDAQSLSTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDRILQVNHVRTRDFDCCLTVPLLSDAGGRLDLVISR 1045          

HSP 4 Score: 59.6918 bits (143), Expect = 4.297e-8
Identity = 54/180 (30.00%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS +     + ++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  470 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSSRKP-GESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 643          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:100495373])

HSP 1 Score: 293.893 bits (751), Expect = 4.770e-82
Identity = 242/782 (30.95%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D L  +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+R G +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K  D+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T+ +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L   +   S   TMS + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GE L+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   15 GNKDPAGND-LALVSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PATPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGTLKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLAS-IIENVKLEILP-AHHSRLSLRPPETVKVQKSDHHHCW---------------------------DPCVNYCHTPHPGHCKTPTWNSTSNQEYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTAHPMSPRTTMSRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS--SRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 732          

HSP 2 Score: 86.6557 bits (213), Expect = 2.139e-16
Identity = 79/291 (27.15%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +   L +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  463 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS----SRKPGE--SLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQAERIFP 738          

HSP 3 Score: 68.1662 bits (165), Expect = 1.125e-10
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H + +LS  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD I+QVN + T +  C   V L+S +   L+L+I +
Sbjct:  928 KEEVHDAQSLSTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDRILQVNHVRTRDFDCCLTVPLLSDAGGRLDLVISR 1023          

HSP 4 Score: 59.6918 bits (143), Expect = 4.272e-8
Identity = 54/180 (30.00%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS +     + ++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  463 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSSRKP-GESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 636          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:100495373])

HSP 1 Score: 293.893 bits (751), Expect = 5.249e-82
Identity = 242/782 (30.95%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D L  +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+R G +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K  D+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T+ +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L   +   S   TMS + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GE L+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   21 GNKDPAGND-LALVSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PATPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGTLKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLAS-IIENVKLEILP-AHHSRLSLRPPETVKVQKSDHHHCW---------------------------DPCVNYCHTPHPGHCKTPTWNSTSNQEYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTAHPMSPRTTMSRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS-ASRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 739          

HSP 2 Score: 86.6557 bits (213), Expect = 2.295e-16
Identity = 79/291 (27.15%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +   L +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  469 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS---ASRKPGES--LIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQAERIFP 745          

HSP 3 Score: 68.1662 bits (165), Expect = 1.087e-10
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H + +LS  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD I+QVN + T +  C   V L+S +   L+L+I +
Sbjct:  950 KEEVHDAQSLSTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDRILQVNHVRTRDFDCCLTVPLLSDAGGRLDLVISR 1045          

HSP 4 Score: 62.7734 bits (151), Expect = 4.330e-9
Identity = 54/180 (30.00%), Postives = 87/180 (48.33%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS       + ++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  469 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSASRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 643          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Match: GRIP2 (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:100495373])

HSP 1 Score: 293.508 bits (750), Expect = 9.569e-82
Identity = 242/782 (30.95%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D L  +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+R G +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K  D+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T+ +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L   +   S   TMS + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GE L+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   26 GNKDPAGND-LALVSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PATPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGTLKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLAS-IIENVKLEILP-AHHSRLSLRPPETVKVQKSDHHHCW---------------------------DPCVNYCHTPHPGHCKTPTWNSTSNQEYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTAHPMSPRTTMSRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS--SRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 743          

HSP 2 Score: 86.6557 bits (213), Expect = 2.261e-16
Identity = 79/291 (27.15%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +   L +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  474 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS----SRKPGES--LIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQAERIFP 749          

HSP 3 Score: 68.1662 bits (165), Expect = 1.116e-10
Identity = 32/97 (32.99%), Postives = 58/97 (59.79%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H + +LS  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD I+QVN + T +  C   V L+S +   L+L+I +
Sbjct:  954 KEEVHDAQSLSTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDRILQVNHVRTRDFDCCLTVPLLSDAGGRLDLVISR 1049          

HSP 4 Score: 59.3066 bits (142), Expect = 5.271e-8
Identity = 54/180 (30.00%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS +     + ++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  474 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSSRKP-GESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 647          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Match: Grip1 (glutamate receptor interacting protein 1 [Source:MGI Symbol;Acc:MGI:1921303])

HSP 1 Score: 193.356 bits (490), Expect = 1.751e-49
Identity = 120/357 (33.61%), Postives = 200/357 (56.02%), Query Frame = 1
Query:  190 CIRANEKALGNHNCSKS-------DNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTM 1239
            C++A E+       +KS       D  L ++ + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+        +Q+  +L G  DH+ M
Sbjct:   11 CLQAEEQERDESPYTKSASQTKPPDGALAVR-RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH--------HQTRLALKG-PDHAAM 351          

HSP 2 Score: 141.739 bits (356), Expect = 2.060e-33
Identity = 99/307 (32.25%), Postives = 161/307 (52.44%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++   KV +   ++V +    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  415 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 711          

HSP 3 Score: 86.6557 bits (213), Expect = 1.534e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   79 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 334          

HSP 4 Score: 82.8037 bits (203), Expect = 2.319e-15
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  431 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 700          

HSP 5 Score: 64.3142 bits (155), Expect = 1.086e-9
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  142 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 333          

HSP 6 Score: 63.5438 bits (153), Expect = 2.194e-9
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  430 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 602          

HSP 7 Score: 63.1586 bits (152), Expect = 2.902e-9
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 3061 EATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            EAT++ GS +  +        + P  R  +  +   +E         R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  859 EATIMSGSTMSLNH-------EAPMARSQLGRQASFQE---------RSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1017          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Match: Grip1 (glutamate receptor interacting protein 1 [Source:MGI Symbol;Acc:MGI:1921303])

HSP 1 Score: 192.586 bits (488), Expect = 3.193e-49
Identity = 114/333 (34.23%), Postives = 190/333 (57.06%), Query Frame = 1
Query:  190 CIRANEKALGNHNCSKS-------DNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            C++A E+       +KS       D  L ++ + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   11 CLQAEEQERDESPYTKSASQTKPPDGALAVR-RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 336          

HSP 2 Score: 141.739 bits (356), Expect = 2.316e-33
Identity = 99/307 (32.25%), Postives = 161/307 (52.44%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++   KV +   ++V +    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  467 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 763          

HSP 3 Score: 86.6557 bits (213), Expect = 1.559e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   79 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 334          

HSP 4 Score: 83.1889 bits (204), Expect = 1.763e-15
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  483 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 752          

HSP 5 Score: 64.6994 bits (156), Expect = 9.310e-10
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  142 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 333          

HSP 6 Score: 63.929 bits (154), Expect = 1.628e-9
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  482 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 654          

HSP 7 Score: 63.1586 bits (152), Expect = 2.528e-9
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 3061 EATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            EAT++ GS +  +        + P  R  +  +   +E         R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  911 EATIMSGSTMSLNH-------EAPMARSQLGRQASFQE---------RSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1069          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Match: Grip1 (glutamate receptor interacting protein 1 [Source:MGI Symbol;Acc:MGI:1921303])

HSP 1 Score: 191.43 bits (485), Expect = 6.005e-49
Identity = 113/325 (34.77%), Postives = 187/325 (57.54%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTM 1239
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+        +Q+  +L G  DH+ M
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH--------HQTRLALKG-PDHAAM 350          

HSP 2 Score: 141.739 bits (356), Expect = 1.889e-33
Identity = 98/304 (32.24%), Postives = 157/304 (51.64%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++     +L    D    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  414 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 710          

HSP 3 Score: 87.0409 bits (214), Expect = 1.250e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 82.8037 bits (203), Expect = 2.279e-15
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  430 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 699          

HSP 5 Score: 64.3142 bits (155), Expect = 1.050e-9
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  141 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 6 Score: 63.5438 bits (153), Expect = 2.102e-9
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  429 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 601          

HSP 7 Score: 63.1586 bits (152), Expect = 2.533e-9
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 3061 EATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            EAT++ GS +  +        + P  R  +  +   +E         R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  858 EATIMSGSTMSLNH-------EAPMARSQLGRQASFQE---------RSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1016          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Match: Grip1 (glutamate receptor interacting protein 1 [Source:MGI Symbol;Acc:MGI:1921303])

HSP 1 Score: 191.43 bits (485), Expect = 6.951e-49
Identity = 113/325 (34.77%), Postives = 187/325 (57.54%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTM 1239
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+        +Q+  +L G  DH+ M
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH--------HQTRLALKG-PDHAAM 350          

HSP 2 Score: 141.739 bits (356), Expect = 2.011e-33
Identity = 98/304 (32.24%), Postives = 157/304 (51.64%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++     +L    D    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  414 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 710          

HSP 3 Score: 87.0409 bits (214), Expect = 1.207e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 82.8037 bits (203), Expect = 2.394e-15
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  430 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 699          

HSP 5 Score: 64.3142 bits (155), Expect = 1.091e-9
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  141 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 6 Score: 63.1586 bits (152), Expect = 2.241e-9
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  429 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 601          

HSP 7 Score: 62.3882 bits (150), Expect = 4.088e-9
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  903 ERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1031          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Match: Grip1 (glutamate receptor interacting protein 1 [Source:MGI Symbol;Acc:MGI:1921303])

HSP 1 Score: 190.66 bits (483), Expect = 1.151e-48
Identity = 110/312 (35.26%), Postives = 182/312 (58.33%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTM 1239
            V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+        +Q+  +L G  DH+ M
Sbjct:   27 VELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH--------HQTRLALKG-PDHAAM 323          

HSP 2 Score: 141.739 bits (356), Expect = 1.929e-33
Identity = 98/304 (32.24%), Postives = 157/304 (51.64%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++     +L    D    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  387 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 683          

HSP 3 Score: 87.0409 bits (214), Expect = 1.095e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   51 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAKT-PGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 306          

HSP 4 Score: 82.8037 bits (203), Expect = 2.428e-15
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  403 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 672          

HSP 5 Score: 64.3142 bits (155), Expect = 1.006e-9
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  114 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 305          

HSP 6 Score: 63.5438 bits (153), Expect = 2.120e-9
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  402 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 574          

HSP 7 Score: 63.1586 bits (152), Expect = 2.491e-9
Identity = 49/194 (25.26%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 3061 EATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            EAT++ GS +  +        + P  R  +  +   +E         R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  831 EATIMSGSTMSLNH-------EAPMARSQLGRQASFQE---------RSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 989          
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Match: sp|A8E0R9|GRIP2_XENLA (Glutamate receptor-interacting protein 2 OS=Xenopus laevis OX=8355 GN=grip2 PE=2 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 2.363e-81
Identity = 243/782 (31.07%), Postives = 384/782 (49.10%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCA---AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            GN + + +D  L +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP             +S  +PK+ ++    EG  FGFV RGG  +D  K R L V ++RPG  ADR+G +K GD+++      + ++T  + +++LR+   +    IEY VA +D    +  P++VEI K     LG+S++T  H N    Q+  I+ ++  SV DRCG L  G  I +I    T+  T  +A + L S   E +KL I+P  H  +L     E   V   DH                               DP    C+                ++ Y  S    N +S+S A    FS++  + L       S   TM+ + QK+    KS+ SL S+        +           H E  ++IL  D    FG  L+      TE L   P I  I+ D PA  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:   31 GNKDPAGNDLAL-VSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEVEYELP-------PGTPDNSSAIIPKTIEITLCKEGNSFGFVMRGGAHEDWHKSRALVVTYVRPGGPADREGTLKVGDRLLCVDGISLHNITHTDALSILRQCSQEGVFQIEYDVALMDTVTNASGPLLVEIAKTPGSTLGISLSTGTHRN---KQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTQMEATQLLAS-IIENVKLEILP-AHHSRLPLRPPETVKVQKSDHHHC---------------------------WDPCVNYCHTPHPGHCKTPTWNPTSNQDYCKSLVAANFSSSSVAGTPGFSSQNSNTLPRTVHPMSPRTTMNRRRQKRKD-HKSSLSLASSTVGPGGQII-----------HTESTEIILRGDPLNGFGIQLQGGI-FATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAE---SVVPSSGTFHVKLPKRKGVELGITISS--SRKPGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNISLKGKPLSEAIHLLQMAGETVTLKIKKQ 748          

HSP 2 Score: 90.5077 bits (223), Expect = 7.419e-17
Identity = 80/291 (27.49%), Postives = 138/291 (47.42%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSS--KPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKL-----RIIP 1164
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    +     + P +  PL +  I+ GSVA R G ++PGDK+++  N ++D+ + E+ + +LR+  D + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + IG  I AI ++      +++AI  L+ +G+   +K+     RI P
Sbjct:  479 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDV----AESVVPSSGTFHVKLPKRKGVELGITISS----SRKPGE--PLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIVISGLTKRGLAERTGAIHIGDRILAINNISLKGKPLSEAIHLLQMAGETVTLKIKKQTERIFP 754          

HSP 3 Score: 68.5514 bits (166), Expect = 3.592e-10
Identity = 31/97 (31.96%), Postives = 61/97 (62.89%), Query Frame = 1
Query: 3352 EKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++++H++ +L+  ++ + + +   T+ FG  VS+GL  KG +++ I+P  PA R + L  YD+I+QVN + T +  C   V L+S + + L+L+I +
Sbjct:  959 KEEVHNAQSLTTELLKVTVQKDMDTDDFGFSVSDGLLEKGVYVNMIRPGGPADR-SGLKTYDQILQVNHVRTRDFDCCLTVPLLSDAGDRLDLVISR 1054          

HSP 4 Score: 63.1586 bits (152), Expect = 1.877e-8
Identity = 55/180 (30.56%), Postives = 89/180 (49.44%), Query Frame = 1
Query: 1948 LGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
             GI LQ     T T   P LI  + P S A RCG +  GD LL+++    E  TL EA  LL++++ S  V ++    + +S   +S    G F V L +    +  GI IS +     +P++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  479 FGIQLQGGIFATETLSSPPLIRFIEPDSPAERCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVAESVVPSS----GTFHVKLPKRKGVE-LGITISSSRKP-GEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 652          
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q9C0E4|GRIP2_HUMAN (Glutamate receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=GRIP2 PE=1 SV=4)

HSP 1 Score: 271.937 bits (694), Expect = 5.474e-74
Identity = 239/787 (30.37%), Postives = 379/787 (48.16%), Query Frame = 1
Query:  262 NKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSE----------VYVGSNSLRNINSNSCA------AFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSP-NSTDLSIFSD 2544
             + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD+  IGD+I S+NGI  + L H EI++L+K+   ++ L ++YELP                 + K+ DV    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +   +    +A LR+   +    +EY VA+ D  A +  P++VEI K     LG+S+ T      +  +  I+ I+  SV DR G L  G  I +I     +  ++ +A + L S         I   +  + L   QS++ L   +    +K   S++L                    DP    C+                G +  R+++S   +      AFS    S L   S+  S   TM  + Q++ +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + +I+G+AT   ++++ N  L +A   +KVV+   ++V +    ++     F + L KK+S  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C + +AV +L+   D + ++I+K          T       +TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q     + +PL P  S  LS  SD
Sbjct:   35 RRQSIPEEFRGITVVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPR-------IISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTYVRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTVANASGPLMVEIVKTPGSALGISLTTTSLR--NKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLAS---------ISEKVRLEILPVPQSQRPL---RPSEAVKVQRSEQLHRW-----------------DPCVPSCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRTTMGRRRQRRRE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLCGDPLSGFGLQLQGGI-FATETLSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLEVEFDVAE---SVIPSSGTFHVKLPKKRSVELGITISS-ASRKRGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVS---YTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAIHLLQVAGETVTLKIKKQ-----LDRPLLPRKSGSLSETSD 755          

HSP 2 Score: 56.9954 bits (136), Expect = 1.292e-6
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3433 FGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKP 3651
            FG  VS+GL  KG ++  ++P+ PA R   L  +D ++QVN + T +  C   V L++++ + LEL+I  RKP
Sbjct:  953 FGFSVSDGLLEKGVYVHTVRPDGPAHR-GGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELII-SRKP 1023          
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q925T6|GRIP1_MOUSE (Glutamate receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Grip1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 8.436e-48
Identity = 107/301 (35.55%), Postives = 177/301 (58.80%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 335          

HSP 2 Score: 141.739 bits (356), Expect = 1.646e-32
Identity = 99/307 (32.25%), Postives = 161/307 (52.44%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++   KV +   ++V +    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P
Sbjct:  466 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSP 762          

HSP 3 Score: 87.0409 bits (214), Expect = 9.259e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAK-TPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 83.1889 bits (204), Expect = 1.339e-14
Identity = 75/283 (26.50%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  482 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 751          

HSP 5 Score: 64.6994 bits (156), Expect = 6.936e-9
Identity = 61/205 (29.76%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            + GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  141 VQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 6 Score: 63.5438 bits (153), Expect = 1.287e-8
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  481 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 653          

HSP 7 Score: 62.7734 bits (151), Expect = 2.643e-8
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  955 ERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-VGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1083          
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Match: sp|P97879|GRIP1_RAT (Glutamate receptor-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Grip1 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.069e-47
Identity = 107/301 (35.55%), Postives = 177/301 (58.80%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSIQGSSVMFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 335          

HSP 2 Score: 139.813 bits (351), Expect = 5.729e-32
Identity = 102/319 (31.97%), Postives = 167/319 (52.35%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEAN---KVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK----AETSVTKPLSPNSTDL 2529
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++   KV +   ++V +    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q     A +    P+  +S+DL
Sbjct:  466 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDSCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQPASSPKKLPIPSHSSDL 774          

HSP 3 Score: 87.0409 bits (214), Expect = 9.435e-16
Identity = 79/263 (30.04%), Postives = 129/263 (49.05%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+      T+ I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSIQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATAS----GPLLVEVAKT-PGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 82.4185 bits (202), Expect = 2.176e-14
Identity = 75/283 (26.50%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK   V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D  + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  482 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHSVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDSCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 751          

HSP 5 Score: 64.6994 bits (156), Expect = 5.404e-9
Identity = 62/205 (30.24%), Postives = 96/205 (46.83%), Query Frame = 1
Query: 1585 IDGSHLEELQVILSIDSHG-TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            I GS +    V +++   G TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   V     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  141 IQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSVC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 6 Score: 63.5438 bits (153), Expect = 1.282e-8
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ +  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  481 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDSCSMEDAVQILQQCE-DLVKLKI 653          

HSP 7 Score: 63.1586 bits (152), Expect = 1.753e-8
Identity = 44/160 (27.50%), Postives = 76/160 (47.50%), Query Frame = 1
Query: 3166 SKEHLNESRSIDRRTN-RVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++  L    S   R+N R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  928 ARSQLGRQASFQERSNSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGD-LGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1068          
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y3R0|GRIP1_HUMAN (Glutamate receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=GRIP1 PE=1 SV=3)

HSP 1 Score: 189.504 bits (480), Expect = 2.191e-47
Identity = 106/301 (35.22%), Postives = 176/301 (58.47%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPN 1167
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   +  L IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+
Sbjct:   41 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPH 335          

HSP 2 Score: 139.043 bits (349), Expect = 9.407e-32
Identity = 101/318 (31.76%), Postives = 163/318 (51.26%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ +  L +++     +L    D    ++     F + L KK +  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P S+ LS   D
Sbjct:  467 HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISSHLSDLGD 777          

HSP 3 Score: 87.0409 bits (214), Expect = 9.185e-16
Identity = 79/263 (30.04%), Postives = 128/263 (48.67%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIKA++G+       D+I + L     +VV+   YE+  P   +     IF   E+TL K+  + G  ++  A   R    P++I+ V PG  A R G I PGD LL++D   +   T AEA+ +L+       + I+    +  S +  S    G   V++ +  P    G+ ++ +     Q I+ID I  AS+A     L  GD ILSI+G S+   TL +A + L    DQV++ +L
Sbjct:   78 PRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATAS----GPLLVEVAKT-PGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEIL 333          

HSP 4 Score: 84.7297 bits (208), Expect = 4.720e-15
Identity = 75/283 (26.50%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + G     ET    P+I+ I   S AER  +  IGD +++INGI T     +E   L++ S    K++L I++++                + LPK  +V+   G        + P    PL +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + IG  I AI         +++AI  L+ +G+   +K++
Sbjct:  483 FGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKHNVE--LGITISSPSSRKPGD--PLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK 752          

HSP 5 Score: 66.2402 bits (160), Expect = 2.288e-9
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +G      +   P  + +I   S A+R G ++ GD++++      +  T E    LLR+     K+TL IE+ VA   +   S     V++ K+ N  LG++I++         +  I +I+ GSVA R G L++G  + AI ++R D  ++ DA++ L+  + + +KL+I
Sbjct:  482 GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEASQLLRDSSITSKVTLEIEFDVAESVIP--SSGTFHVKLPKKHNVELGITISSPSSRKPGDPLV-ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE-DLVKLKI 654          

HSP 6 Score: 62.7734 bits (151), Expect = 2.121e-8
Identity = 56/185 (30.27%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  ++   PA   G +  GD + ++DG+  +G +       L Q   +   LIE +  V+ S+     P   LLVE        K    SLG+ L   +     + ++I K+   S A RCG +  GD +L++D   +E CTLAEA   L N++D + + I
Sbjct:  161 TFGFVIRGGAHDDRNKSRPVV---ITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVMDSVATASGP---LLVE------VAKTPGASLGVALTTSMC-CNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEI 332          

HSP 7 Score: 62.3882 bits (150), Expect = 2.758e-8
Identity = 41/148 (27.70%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP+++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  956 ERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGD-LGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1084          
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Match: M3Z1E2 (Glutamate receptor interacting protein 1 OS=Mustela putorius furo OX=9669 GN=GRIP1 PE=4 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 6.399e-84
Identity = 236/811 (29.10%), Postives = 400/811 (49.32%), Query Frame = 1
Query:  154 NFSPLKQKMACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHF-------DQLKWNQSEKSLV---GIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSC--AAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            N+  + Q + C+    +            D  L ++ + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+          D +K  +S++ L       +H ++   +               +   +   + P  L  + S   + + SL ++N  +   + +S  P+  +            M  + +KKD   KS+ SL S+        +           H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++     +L    D    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P ++ LS   D
Sbjct:   49 NWMEINQTLHCTFADESPYTKSASQTKPPDGALAVR-RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGVDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDTVATASGPLLVEVAKTPGASLGVALTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLAWDSWAGNHCSLHTYHHPHTTHPDHCRVPALTGPKASPSNSPPALVSSFSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTM------------MRRRLKKKD--FKSSLSLASSTVGLAGQVV-----------HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPMASHLSDLGD 820          
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Match: A0A3Q7PZ66 (glutamate receptor-interacting protein 1 OS=Callorhinus ursinus OX=34884 GN=GRIP1 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 6.526e-83
Identity = 237/806 (29.40%), Postives = 402/806 (49.88%), Query Frame = 1
Query:  190 CIRANEKALGNHNCSKS-------DNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHF-------DQLKWNQSEKSLV---GIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSC--AAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            C++A E+       +KS       D  L ++ + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+          D +K  ++++ L       +H ++   +    +          +   +   + P  L  + S   + + SL ++N  +   + +S  P+  +            M  + +KKD   KS+ SL S+        +           H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L +++     +L    D    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P ++ LS   D
Sbjct:   11 CLQAEEQERDESPYTKSASQTKPPDGALAVR-RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPHHQTRLALKGPDHVKIQRTDRQLTWDSWASNHCSLHTYHHPHTIHPDHCRVPALTGPKAPPPNSPPALVSSLSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTM------------MRRRLKKKD--FKSSLSLASSTVGLAGQVV-----------HTETTEVVLTADPVTGFGIQLQGSV-FATETLTSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPIASHLSDLGD 777          

HSP 2 Score: 62.3882 bits (150), Expect = 9.726e-6
Identity = 41/148 (27.70%), Postives = 72/148 (48.65%), Query Frame = 1
Query: 3199 DRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +R ++R H      S  LP ++  ++ +L+  ++ IKE                I S + +   +  + L + +  E FG  V++GL  KG ++  I+P  P      L  YD ++QVN + T +  C  VV LI++S N L+L+I +
Sbjct:  941 ERSSSRPHYSQTTRSNTLPTDVGRKSVTLRKMKQEIKE----------------IMSPTPV--ELHKVTLYKSSDMEDFGFSVADGLLEKGVYVKNIRPAGPGD-LGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISR 1069          
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Match: A0A2Y9IU80 (glutamate receptor-interacting protein 1 OS=Enhydra lutris kenyoni OX=391180 GN=LOC111142185 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 7.013e-83
Identity = 232/777 (29.86%), Postives = 391/777 (50.32%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHF-------DQLKWNQSEKSLV---GIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSC--AAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLS-PNSTDLSIFSD 2544
            + SI +E      V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I ++NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  +   +TL K  +    FGFV RGG   D +K RP+ +  +RPG  ADR+G IKPGD+++S    ++   T    +++L++   + TL IEY V+ +D  A +  P++VE+ K     LGV++ T      + Q+  I+ I++ S+ADRCG L +G  I +I     +  T+ +A + L +   +++KL I+P+          D +K  +S++ L       +H ++   +                   +   + P  L  + S   + + SL ++N  +   + +S  P+  +            M  + +KKD   KS+ SL S+        +           H E  +V+L+ D    FG  L+      TE L   P I +I+ D PA  CGVL  GD + AI+G+ T   + ++ N  L ++   +KV +   ++V +    ++     F + L KK S  LGI + +  +R  G+PL+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q    S + P   P ++ LS   D
Sbjct:  117 RQSIPEEFKGSTVVELMKKEGTTLGLTVSGGVDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNT---FGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDTVATASGPLLVEVAKTPGASLGVTLTT--SMCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFL-ANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLAWDSWAGNHCSLHTYHHPHTTHPDHCRMPALKGPKAPPSNSPPALVSSFSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTM------------MRRRLKKKD--FKSSLSLASSTVGLAGQVV-----------HTETTEVVLTADPVTGFGIQLQGSV-FATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAE---SVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPMASHLSDLGD 852          
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Match: A0A091TCQ7 (Glutamate receptor-interacting protein 2 (Fragment) OS=Nestor notabilis OX=176057 GN=N333_08273 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.374e-82
Identity = 238/737 (32.29%), Postives = 373/737 (50.61%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKG--VNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP           + ++  +PK+ +V    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +  +T  + + +LR+   +    IEY V  +D  A +  P++VEI K     LG+++ T  H N    Q+  I+ I+  SV DRCG L +G  I +I    T+  ++ +A + L +   E +KL I+P +H  +L     E   V   DH       VN           +  T   N   G D     C        S+   N+    C   +  P+S     S   S   TM  + QKK +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + AI+G+AT   ++++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          T      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:    9 VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAVPEGSAGIIPKTIEVSLYKEGNSFGFVLRGGAHEDWHKSRPLVLTYVRPGGPADREGSLKIGDRLLSVDGIPLHSMTHADALNILRQCSQEALFQIEYDVTIMDTVANASGPLLVEIAKSPGSTLGITLTTAMHRN---KQVIVIDKIKPASVVDRCGALHVGDHILSIDGTSTEHCSLLEATQLL-AATSENVKLEILP-VHQSRLPLKPPETVKVQKSDHHHCWDPCVN---YCHTHHPGHCKTPTWNQTAGQD----YCKSLVAANFSSPTMNVQGFPCQNSNTLPRS-----SHPMSPRTTMLRRRQKKKE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLRGDPLNGFGLQLQGGI-FATETLSSPPLVRFIEPDSPAERCGLLQVGDRVLAINGIATEDGTMEEANQLLRDAALTNKVVLEIEFDVAE---SVIPSSGTFHVKLPKKRGVELGITISS-ASRKPGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDEDNSDEQETTGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 698          

HSP 2 Score: 65.4698 bits (158), Expect = 8.952e-7
Identity = 56/202 (27.72%), Postives = 94/202 (46.53%), Query Frame = 1
Query: 1882 PDPQLLVEETIFEITLKKQSGSLGINLQA--LVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQK 2481
            P  Q++  ET   +         G+ LQ     T T   P L+  + P S A RCG +  GD +LA++    E  T+ EA  LL++++  LT ++        + S    S  G F V L ++   +  GI IS       +P++I  I   SVA     L  GD++L+I+   L   ++  A+++L Q  D V++ + + +
Sbjct:  406 PGGQIVHTETTEVVLRGDPLNGFGLQLQGGIFATETLSSPPLVRFIEPDSPAERCGLLQVGDRVLAINGIATEDGTMEEANQLLRDAA--LTNKVVLEIEFDVAESVIPSS--GTFHVKLPKKRGVE-LGITISSASRKPGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILRQCEDLVKLKIRKDE 602          

HSP 3 Score: 63.5438 bits (153), Expect = 4.443e-6
Identity = 34/96 (35.42%), Postives = 57/96 (59.38%), Query Frame = 1
Query: 3355 KDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++I S + L  + MT  L +   +E FG  VS+GL  KG +++ ++P+ PA +C  L  YD ++QVN   T +  C   V LIS++ + L+L+I +
Sbjct:  918 QEIMSPTPLEFHKMT--LHKDPESEDFGFSVSDGLLEKGVYVNMVRPDGPADQCG-LKPYDRVLQVNRTRTRDFDCCLAVPLISEAGDKLDLVISR 1010          
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Match: A0A3Q0FZD7 (glutamate receptor-interacting protein 2 isoform X3 OS=Alligator sinensis OX=38654 GN=GRIP2 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 8.467e-82
Identity = 247/796 (31.03%), Postives = 390/796 (48.99%), Query Frame = 1
Query:  178 MACSC--IRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVD---EG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIAT-YHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNC---------------SEVYVGSNSLRNINSNSCAA--FSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            M C C  I     + G+ + S  +  L +  + SI +E      V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP           + +S  +PK+ +V    EG  FGFV RGG  +D  K RPL + ++RPG  ADR+G +K GD+++S     +  +T  + + +LR+   +    IEY V  +D  A +  P++VEI K     LG+++ T  H N    Q+  I+ I+  SV DRCG L +G  I +I    T+  ++ +A + L +   E +KL I+P +H  +L     E   V   DH                               DP    C+                S+ Y  S    N +S +  A  F  +  + L   S   S   TM  + QKK +  KS+ SL S+        +           H E  +V+L  D    FG  L+      TE L   P +  I+ D PA  CG+L  GD + +I+G+AT   ++++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + +  +R  GEPL+IS +  GS A R G + PGD LLA+D   ++ C++ +AV +L+   D + ++I+K          T      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:    1 MPCRCNNIDDGPYSKGSKDSSGMEAAL-VSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAAPESSSGIIPKTIEVSLYKEGNSFGFVLRGGAHEDWHKSRPLVLTYVRPGGPADREGSLKIGDRLLSVDGIPLHSVTHADALNILRQCSQEALFQIEYDVTIMDTVANASGPLLVEIAKTPGSTLGITLTTSTHRN---KQVIVIDKIKPASVVDRCGALHVGDHILSIDGTSTEHCSLLEATQLL-AATSENVKLEILP-VHQSRLPLKPPETVKVQKSDHHHC---------------------------WDPCVNYCHTHHPGHCKTPTWNQTSSQDYCKSLVAANFSSPTMNAQGFPCQNSNTLPRSSHPMSPRATMMRRRQKKKE-HKSSLSLASSTVGPGGQIV-----------HTETTEVVLRGDPLNGFGLQLQGGI-FATETLSSPPLVRFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALTNKVVLEIEFDVAE---SVIPSSGTFHVKLPKKRGVELGITISS-ASRKPGEPLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSMEDAVQILKQCEDLVKLKIRKDEDNSDEQETTGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 733          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Match: grip1 (glutamate receptor interacting protein 1 [Source:ZFIN;Acc:ZDB-GENE-041210-125])

HSP 1 Score: 194.126 bits (492), Expect = 6.990e-50
Identity = 116/324 (35.80%), Postives = 189/324 (58.33%), Query Frame = 1
Query:  241 DNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSL 1212
            D  L ++ +S   + K S I V+++KK+  TLGLTVSGG D+   P ++N+R G IA RSD   +GD+I S+NGI+ +   H EI+SL+K+   ++ L ++YELP  +     +  K   +TL K  +    FGFV RGG  +D +K RP+T+  IRPG  ADR+G IKPGD+++S    ++   +    +++L++   + TL IEY V+ +D  A +  P++VE+ K +   LGV+++T      + Q+  I+ ++  S+ADRCG L  G  I ++     +  T+ +A + L S   E +K+ I+P+ H  +L     E +L
Sbjct:   28 DGALAIRRQSIPDEFKGSSI-VELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSGVMFKNVEVTLHKEGNT---FGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGTSHAEAMSILKQCGQEATLLIEYDVSIMDSIATASGPLLVEVAKPLGSSLGVALSTSMY--CNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASAC-EHVKMEILPH-HQTRLALKGPEHAL 343          

HSP 2 Score: 132.88 bits (333), Expect = 7.665e-31
Identity = 97/305 (31.80%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVR-DPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKP 2505
            H E  +V L  DS   FG  L+      TE L   P I ++  D PA  CG+L  GD I +I+G+ T   +L++  NQL+  + +      E+  D    ++     F + L K+ G  LGI + +   R  G+ L+IS +  GS A R G +  GD LLA+D   ++ C++ +AV +LQ   D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I S+    +A     +  GD+IL+IN +SL+G  L++A+ +L    + V + + +Q    S  +P
Sbjct:  407 HTETTEVTLISDSVMGFGIQLQGGV-FATETLTSPPLIAYMDPDSPAERCGILQIGDRILSINGIPTEDSTLEE-TNQLLRDSTITSKVTLEIEFDVAESVIPSSGTFHVKLPKKPGVELGITISSPSNRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISSLTKGGLAERTGAIHVGDRILAINNNSLKGKPLSEAIHLLQMAGESVTLKIKKQGELVSPKQP 703          

HSP 3 Score: 89.7373 bits (221), Expect = 1.415e-17
Identity = 82/296 (27.70%), Postives = 139/296 (46.96%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRP---LTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
            V +I       G+ + GG    ET    P+IA + P S AER  I  IGD I+SINGI T     +E   L++ S    K++L I++++                + LPK   V+ G            PS  +P   L +  I+ GSVA R G ++ GDK+++  N ++D+ + E+ + +L++  D + L I     + D    SG  I     K+    LG++I+     GT+       I ++  G +A+R G + +G  I AI +       +++AI  L+ +G+   +K++
Sbjct:  413 VTLISDSVMGFGIQLQGGVFATETLTSPPLIAYMDPDSPAERCGILQIGDRILSINGIPTEDSTLEETNQLLRDSTITSKVTLEIEFDV----AESVIPSSGTFHVKLPKKPGVELGI-------TISSPSNRKPGDALIISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQETSGAIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISSLTKGGLAERTGAIHVGDRILAINNNSLKGKPLSEAIHLLQMAGESVTLKIK 692          

HSP 4 Score: 85.1149 bits (209), Expect = 3.978e-16
Identity = 74/263 (28.14%), Postives = 130/263 (49.43%), Query Frame = 1
Query: 1702 PQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEVRDPDPQLLVEETIF---EITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            P++ ++++   A     L  GDYIK+++G+       D+I + L     +VV+   YE+  P   +     +F   E+TL K+  + G  ++  A   R    P+ I+ + PG  A R G I PGD LL++D   +   + AEA+ +L+      T+ I+    +  S +  S    G   V++ + L     G+ +S +     Q I+ID + PAS+A     L +GD ILS++G S+   TL +A ++L    + V++ +L
Sbjct:   72 PRVSNLRQGGIAARSDQLNVGDYIKSVNGINLTKFRHDEIISLLKNVGERVVLEVEYEL--PPVSVQGSGVMFKNVEVTLHKEGNTFGFVIRGGAHEDRNKSRPVTITTIRPGGPADREGTIKPGDRLLSIDGIRLHGTSHAEAMSILKQCGQEATLLIEYDVSIMDSIATAS----GPLLVEVAKPLGSS-LGVALSTSMYCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASACEHVKMEIL 327          

HSP 5 Score: 63.5438 bits (153), Expect = 1.381e-9
Identity = 59/185 (31.89%), Postives = 87/185 (47.03%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRS-------LDQINNQ---LIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            TFGF ++  AH +    R V    I  I+   PA   G +  GD + +IDG+   G S       L Q   +   LIE +  ++ S+     P   LLVE        K    SLG+ L   +     + ++I KV P S A RCG +  GD +L++D   +E CTLAEA  LL ++ + + + I
Sbjct:  155 TFGFVIRGGAHEDRNKSRPVT---ITTIRPGGPADREGTIKPGDRLLSIDGIRLHGTSHAEAMSILKQCGQEATLLIEYDVSIMDSIATASGP---LLVE------VAKPLGSSLGVALSTSM-YCNKQVIIIDKVKPASIADRCGALHAGDHILSVDGTSMEYCTLAEATQLLASACEHVKMEI 326          

HSP 6 Score: 62.7734 bits (151), Expect = 2.415e-9
Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 1
Query: 3355 KDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            KDI S + +   +  + L +++  E FG  VS+GL  KG +++ I+P  PA     L  YD ++Q+N + T +  C  VV LI++S N L+L+I +
Sbjct:  909 KDIMSPNPV--ELHKVSLFKESDLEDFGFSVSDGLMEKGVYVNNIRPGGPA-EVGGLKPYDRLLQINHVRTRDFDCCLVVPLIAESGNKLDLVISR 1001          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:103034154])

HSP 1 Score: 179.489 bits (454), Expect = 2.839e-45
Identity = 114/325 (35.08%), Postives = 178/325 (54.77%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIH 1173
            GN + +  DN L  + +S      ++   V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP              S  + K+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K GD+I+S     +      + + +L +   +    IEY V+ +D    +  P++VEI K     LG+++ +  H N    Q+  I+ I+A SV DR G L +G  I +I    T+  ++ +A + L S   E  KL I+P  H
Sbjct:   25 GNKDSTGPDNSLTSRRQSIPELRGVTL--VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNASGPLLVEIAKSPGASLGITLTSASHRN---KQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLAS-TSEVAKLEILPAHH 336          

HSP 2 Score: 135.191 bits (339), Expect = 1.608e-31
Identity = 103/316 (32.59%), Postives = 163/316 (51.58%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLS 2532
            H+E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A+ +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q   T   K +     DLS
Sbjct:  461 HIESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQLDMTDEKKKIDDLENDLS 764          

HSP 3 Score: 84.3445 bits (207), Expect = 5.936e-16
Identity = 73/283 (25.80%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AE+  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+ + +L++  D + L I     + +    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI ++      +++AI  L+ +G+   +K++
Sbjct:  477 FGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDV----AESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIK 744          

HSP 4 Score: 69.707 bits (169), Expect = 2.145e-11
Identity = 64/242 (26.45%), Postives = 110/242 (45.45%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGE--PLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L K+  S G  ++        +  PL+++ V PG  A R G +  GD +L++D  P+     ++ + +L  S      +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID I  ASV      L  GD ILSI+G S    ++ +A ++L    +  ++ +L
Sbjct:   96 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPPAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNAS----GPLLVEIAKS-PGASLGITLTSASHRNKQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLASTSEVAKLEIL 332          

HSP 5 Score: 67.3958 bits (163), Expect = 9.211e-11
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A++ G ++ GD+++S      +  T E    LLR+    +K+TL IE+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA++ L+  + + +KL+I
Sbjct:  476 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSE-DLVKLKI 646          

HSP 6 Score: 60.4622 bits (145), Expect = 1.483e-8
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query: 3427 ESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  987 DDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1057          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:103034154])

HSP 1 Score: 179.489 bits (454), Expect = 2.968e-45
Identity = 114/325 (35.08%), Postives = 178/325 (54.77%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIH 1173
            GN + +  DN L  + +S      ++   V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP              S  + K+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K GD+I+S     +      + + +L +   +    IEY V+ +D    +  P++VEI K     LG+++ +  H N    Q+  I+ I+A SV DR G L +G  I +I    T+  ++ +A + L S   E  KL I+P  H
Sbjct:   22 GNKDSTGPDNSLTSRRQSIPELRGVTL--VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNASGPLLVEIAKSPGASLGITLTSASHRN---KQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLAS-TSEVAKLEILPAHH 333          

HSP 2 Score: 135.191 bits (339), Expect = 1.617e-31
Identity = 103/316 (32.59%), Postives = 163/316 (51.58%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLS 2532
            H+E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A+ +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q   T   K +     DLS
Sbjct:  458 HIESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQLDMTDEKKKIDDLENDLS 761          

HSP 3 Score: 84.3445 bits (207), Expect = 7.453e-16
Identity = 73/283 (25.80%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AE+  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+ + +L++  D + L I     + +    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI ++      +++AI  L+ +G+   +K++
Sbjct:  474 FGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDV----AESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIK 741          

HSP 4 Score: 69.3218 bits (168), Expect = 2.518e-11
Identity = 64/242 (26.45%), Postives = 110/242 (45.45%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGE--PLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L K+  S G  ++        +  PL+++ V PG  A R G +  GD +L++D  P+     ++ + +L  S      +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID I  ASV      L  GD ILSI+G S    ++ +A ++L    +  ++ +L
Sbjct:   93 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPPAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNAS----GPLLVEIAKS-PGASLGITLTSASHRNKQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLASTSEVAKLEIL 329          

HSP 5 Score: 67.3958 bits (163), Expect = 1.099e-10
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A++ G ++ GD+++S      +  T E    LLR+    +K+TL IE+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA++ L+  + + +KL+I
Sbjct:  473 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSE-DLVKLKI 643          

HSP 6 Score: 60.4622 bits (145), Expect = 1.533e-8
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query: 3427 ESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  984 DDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1054          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:103034154])

HSP 1 Score: 179.489 bits (454), Expect = 3.200e-45
Identity = 114/325 (35.08%), Postives = 178/325 (54.77%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIH 1173
            GN + +  DN L  + +S      ++   V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP              S  + K+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K GD+I+S     +      + + +L +   +    IEY V+ +D    +  P++VEI K     LG+++ +  H N    Q+  I+ I+A SV DR G L +G  I +I    T+  ++ +A + L S   E  KL I+P  H
Sbjct:   21 GNKDSTGPDNSLTSRRQSIPELRGVTL--VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNASGPLLVEIAKSPGASLGITLTSASHRN---KQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLAS-TSEVAKLEILPAHH 332          

HSP 2 Score: 135.191 bits (339), Expect = 1.561e-31
Identity = 103/316 (32.59%), Postives = 163/316 (51.58%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLS 2532
            H+E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A+ +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q   T   K +     DLS
Sbjct:  457 HIESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQLDMTDEKKKIDDLENDLS 760          

HSP 3 Score: 84.3445 bits (207), Expect = 7.325e-16
Identity = 73/283 (25.80%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AE+  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+ + +L++  D + L I     + +    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI ++      +++AI  L+ +G+   +K++
Sbjct:  473 FGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDV----AESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIK 740          

HSP 4 Score: 69.707 bits (169), Expect = 2.273e-11
Identity = 64/242 (26.45%), Postives = 110/242 (45.45%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGE--PLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L K+  S G  ++        +  PL+++ V PG  A R G +  GD +L++D  P+     ++ + +L  S      +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID I  ASV      L  GD ILSI+G S    ++ +A ++L    +  ++ +L
Sbjct:   92 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPPAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNAS----GPLLVEIAKS-PGASLGITLTSASHRNKQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLASTSEVAKLEIL 328          

HSP 5 Score: 67.3958 bits (163), Expect = 1.072e-10
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A++ G ++ GD+++S      +  T E    LLR+    +K+TL IE+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA++ L+  + + +KL+I
Sbjct:  472 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSE-DLVKLKI 642          

HSP 6 Score: 60.4622 bits (145), Expect = 1.519e-8
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query: 3427 ESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  983 DDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1053          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:103034154])

HSP 1 Score: 179.489 bits (454), Expect = 3.296e-45
Identity = 114/325 (35.08%), Postives = 178/325 (54.77%), Query Frame = 1
Query:  217 GNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIH 1173
            GN + +  DN L  + +S      ++   V++IKK+  TLGLT+SGG D+   P ++N+RPG +A RSD   +GD+I S+NGI+ + L H EI+SL+K+   ++ L ++YELP              S  + K+ ++    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G +K GD+I+S     +      + + +L +   +    IEY V+ +D    +  P++VEI K     LG+++ +  H N    Q+  I+ I+A SV DR G L +G  I +I    T+  ++ +A + L S   E  KL I+P  H
Sbjct:   26 GNKDSTGPDNSLTSRRQSIPELRGVTL--VELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNVGDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELP-------PAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNASGPLLVEIAKSPGASLGITLTSASHRN---KQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLAS-TSEVAKLEILPAHH 337          

HSP 2 Score: 135.191 bits (339), Expect = 1.894e-31
Identity = 103/316 (32.59%), Postives = 163/316 (51.58%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLS 2532
            H+E  +V L  D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKV +   ++V +    ++     F + L K+ G  LGI + A  ++  GEPL+IS +  GS A R G + PGD LLA+D   +E C++ +A+ +LQ S D + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q   T   K +     DLS
Sbjct:  462 HIESSEVTLRGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGEPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIKKQLDMTDEKKKIDDLENDLS 765          

HSP 3 Score: 83.9593 bits (206), Expect = 8.923e-16
Identity = 73/283 (25.80%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSK--PKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AE+  +  +GD ++SINGI T     +E   L++ +    K++L I++++                + LPK   V+ G    A     K P +  PL +  I+ GS+A R G ++PGDK+++  N ++++ + E+ + +L++  D + L I     + +    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI ++      +++AI  L+ +G+   +K++
Sbjct:  478 FGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDV----AESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGE--PLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSEDLVKLKIRKDEDNSNEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPIIISGLTKRGLAERTGAIHVGDRILAINNVSLKGKPLSEAIHLLQMAGETVTLKIK 745          

HSP 4 Score: 69.3218 bits (168), Expect = 2.542e-11
Identity = 64/242 (26.45%), Postives = 110/242 (45.45%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGE--PLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       D+I + L     +VV+   YE+    PD    V     EI L K+  S G  ++        +  PL+++ V PG  A R G +  GD +L++D  P+     ++ + +L  S      +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID I  ASV      L  GD ILSI+G S    ++ +A ++L    +  ++ +L
Sbjct:   97 GDYIKSVNGINLTKLRHDEIISLLKNVGERVVLEVEYELPPAAPDSTSGVISKTIEICLHKEGTSFGFVMRGGSHEDWHKTRPLVVTYVRPGGPADREGTLKAGDRILSVDGVPLHSACHSDGLTVLAQSGQEALFQIEYDVSIMDTVTNAS----GPLLVEIAKS-PGASLGITLTSASHRNKQVIVIDKIKAASVVDRSGALHVGDHILSIDGTSTEHCSVLEATQLLASTSEVAKLEIL 333          

HSP 5 Score: 67.0106 bits (162), Expect = 1.198e-10
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A++ G ++ GD+++S      +  T E    LLR+    +K+TL IE+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  ++ DA++ L+  + + +KL+I
Sbjct:  477 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAEKCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVTLEIEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---EPLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSMEDAMQILQQSE-DLVKLKI 647          

HSP 6 Score: 60.077 bits (144), Expect = 1.547e-8
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query: 3427 ESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + FG  VS+G   KG +++ I+P  PA R A L  YD I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  988 DDFGFSVSDGFLEKGVYVNMIRPEGPADR-AGLKPYDRILQVNHVRTRDFDCCLAVPLITEAGDKLELVISR 1058          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001444.1 (pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1 gene:ENSPMAG00000001288.1 transcript:ENSPMAT00000001444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 2.839e-31
Identity = 101/312 (32.37%), Postives = 162/312 (51.92%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLAT--IGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNST 2523
            H E + + L+ D    FG  L+      T+       I +I+ D PA  CG+L  GD I +++G+ T  +G SL +++  L E   V   SL    D    ++     F +TL K+ G  LGI + +   R   EPL+I+++  GS A R G + PGD LLA++   +E  ++ E VH+LQ S D + ++++K          +       ++V+L+R     P GI ISGTD+  D PILI S+ P  +A     +  GDQIL+I+G SL+G  L++A+ +L +  + V + + ++ A     +P S NS 
Sbjct:  336 HTESVALHLASDGGPGFGLHLQGG-TFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVNGIPTAELG-SLAEVSQYLHEQALVGSASLEVEFDVAESVIPSSGTFHVTLPKKKGVELGITITSPTHRKPSEPLVITEIKKGSVAHRLGTLEPGDRLLAINHTRLETSSVDETVHILQQSDDFVKLKVRKDEDNSDEQEASGAIS---YSVELRRH--GGPLGITISGTDEPTD-PILIASLTPDGLAERTGAIHVGDQILAIDGMSLKGKPLSEAIALLQRAGEIVALKIKKRTA----GQPQSANSA 635          

HSP 2 Score: 100.523 bits (249), Expect = 1.307e-21
Identity = 57/181 (31.49%), Postives = 98/181 (54.14%), Query Frame = 1
Query:  637 FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDA---IEALKSGQRERIKLRIIPNI 1170
            FGFV RGG   D  K RP+ V H+R G  ADRDG +K GD++++     V  L+      +L++      + +EY V+ ++    +  P++VEI+K     LG+S++   ++    QI  I+ I   S+A+RCG L +G  I ++     ++M++ +A   +    S   + IKL I+P++
Sbjct:   23 FGFVVRGGVQSDKKKSRPIVVSHVRQGGPADRDGTLKAGDRLLAVEGIPVQGLSLCEASVVLKQSGQDARVLVEYDVSVMESVQNATGPLLVEIRKTSGANLGISLS--KESCGMKQIVVIDKIRPASIAERCGALHVGDRILSVDGSGVEQMSVEEASVLLACSGSSGGDGIKLEILPSL 201          

HSP 3 Score: 68.9366 bits (167), Expect = 6.707e-12
Identity = 75/289 (25.95%), Postives = 135/289 (46.71%), Query Frame = 1
Query:  334 LGLTVSGGADR----GETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVS-------LVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGR-PIIVEIQKQVNERLGVSIATYHDNGTD--SQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEAL-KSGQRERIKLR 1155
             GL + GG       G   +I  I P S AER  +   GD I+S+NGI T+ L     VS       LV S+    SL +++++                +TLPK   V+   G        + PS+  PL +  I+ GSVA R G ++PGD++++  + +++  + +  + +L++  D + L +     + D    SG     VE+++     LG++I+     GTD  +    I ++    +A+R G + +G  I AI  +      +++AI  L ++G+   +K++
Sbjct:  352 FGLHLQGGTFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVNGIPTAELGSLAEVSQYLHEQALVGSA----SLEVEFDV----AESVIPSSGTFHVTLPKKKGVE--LGITITSPTHRKPSE--PLVITEIKKGSVAHRLGTLEPGDRLLAINHTRLETSSVDETVHILQQSDDFVKLKVRKDEDNSDEQEASGAISYSVELRRHGGP-LGITIS-----GTDEPTDPILIASLTPDGLAERTGAIHVGDQILAIDGMSLKGKPLSEAIALLQRAGEIVALKIK 622          

HSP 4 Score: 62.3882 bits (150), Expect = 6.037e-10
Identity = 53/186 (28.49%), Postives = 91/186 (48.92%), Query Frame = 1
Query: 1885 DPQLLVEETIFEITLKKQSGSLGINLQALVT--RTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKML 2436
            D   +V +TI EI L K   S G  ++  V   +    P+++S V  G  A R G +  GD LLA++  P++  +L EA  +L+ S     V ++    + +S    +    G   V++++       GI +S     + Q ++ID I PAS+A     L  GD+ILS++G  +   ++ +A  +L
Sbjct:    3 DGTSVVHKTI-EIALHKDGNSFGFVVRGGVQSDKKKSRPIVVSHVRQGGPADRDGTLKAGDRLLAVEGIPVQGLSLCEASVVLKQSGQDARVLVEYDVSVMESVQNAT----GPLLVEIRKTSGAN-LGISLSKESCGMKQIVVIDKIRPASIAERCGALHVGDRILSVDGSGVEQMSVEEASVLL 182          

HSP 5 Score: 56.225 bits (134), Expect = 5.281e-8
Identity = 53/190 (27.89%), Postives = 88/190 (46.32%), Query Frame = 1
Query:  598 SLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHL-TPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            S+ L  + D   GFG   +GG         PL + +I P S A+R G ++PGD+I+S        L +   V   L E       +L +E+ VA   +   S     V + K+    LG++I T   +   S+   I  I+ GSVA R G L+ G  + AI   R +  ++++ +  L+    + +KL++
Sbjct:  339 SVALHLASDGGPGFGLHLQGGTFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVNGIPTAELGSLAEVSQYLHEQALVGSASLEVEFDVAESVIP--SSGTFHVTLPKKKGVELGITI-TSPTHRKPSEPLVITEIKKGSVAHRLGTLEPGDRLLAINHTRLETSSVDETVHILQQSD-DFVKLKV 524          

HSP 6 Score: 50.447 bits (119), Expect = 3.042e-6
Identity = 41/175 (23.43%), Postives = 77/175 (44.00%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGAD----RGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVM-HIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALL 822
            + KD  + G  V GG      +    V++++R G  A+R      GD ++++ GI    L   E   ++K S     ++++Y++     +Q         +   K+   + G          K+   M+ + V+  IRP S+A+R G +  GD+I+S     V+ ++ E    LL
Sbjct:   16 LHKDGNSFGFVVRGGVQSDKKKSRPIVVSHVRQGGPADRDGTLKAGDRLLAVEGIPVQGLSLCEASVVLKQSGQDARVLVEYDVSVMESVQNATGPLLVEIR--KTSGANLGISL------SKESCGMKQIVVIDKIRPASIAERCGALHVGDRILSVDGSGVEQMSVEEASVLL 182          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010851.1 (pep scaffold:Pmarinus_7.0:GL477227:46102:76179:-1 gene:ENSPMAG00000009830.1 transcript:ENSPMAT00000010851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 1.423e-27
Identity = 98/311 (31.51%), Postives = 153/311 (49.20%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNH---PTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPN 2517
            H E ++V+L  D  G+ G       +     T   +  P      R R    CGVL  GD + A+ G+ T   +LD+++  L EA     T L    D    ++     F + L K+ G  LGI + +   R  G+PL+IS V  GS A R G + PGD LLA+D   ++ C++ +A H+L+   + + ++I+K         GT       +TV+LKR     P GI ISGT++  D PI+I  +    +A     +  GDQIL+IN   L+G  L++A+++L    + V + + R+ AE     PL P+
Sbjct:  315 HAEVMEVVLYGDGLGSLGVHGAGEGDGVAGTTRGTILSPTAVCAARCR----CGVLQMGDRLLAVGGVPTEEATLDEVHQLLREAAAGGRTRLQVEFDVAESVVPSSGTFHVKLPKRRGVELGITISSPAYRKAGDPLVISDVKKGSVAHRTGTLEPGDQLLAIDGVRLDHCSMEDAAHILRQGDELVRLKIRKDDDNSDELEGTGAIS---YTVELKRY--GGPLGITISGTEEPFD-PIIISGLTSGGLAERTGAIHIGDQILAINAVGLKGKPLSEAIRLLQTAGETVTLRI-RKLAEREC--PLPPS 612          

HSP 2 Score: 87.0409 bits (214), Expect = 1.881e-17
Identity = 59/199 (29.65%), Postives = 99/199 (49.75%), Query Frame = 1
Query:  637 FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHF-------DQLKWNQSEKSL 1212
            FGFV RGG  +   K RP+ V  +RPG  ADR+G +K GD++++     +  ++    +A+LRE   + TL IEY V+ +D    +  P++VE+ K       + ++             I+ I   SVA+RCG L  G  I +I     +  ++ +A + L S   + ++L I+P           +Q+K  +SE+ L
Sbjct:   19 FGFVIRGGAHEQRHKSRPILVTCVRPGGPADREGTLKAGDRLLNVDGMSLHGVSHAEALAILRECGQEATLQIEYDVSIMDSVTNASGPLLVEVAK--TPGSSLGVSLSSPGHLHKPTIIIDKIRPASVAERCGALHAGDQILSIDGTGMEHCSLLEATQLLASAT-DNVRLEILPIRQARLALKGPEQVKVQKSERHL 214          

HSP 3 Score: 68.1662 bits (165), Expect = 1.002e-11
Identity = 62/194 (31.96%), Postives = 98/194 (50.52%), Query Frame = 1
Query: 1897 LVEETIFEITLKKQSGSLGINLQ--ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            ++ +TI EITL K+  S G  ++  A   R    P+L++ V PG  A R G +  GD LL +D   +   + AEA+ +L+      T++I+    +  S +  S    G   V++ +  P    G+ +S         I+ID I PASVA     L +GDQILSI+G  +   +L +A ++L    D VR+ +L
Sbjct:    3 VIAKTI-EITLYKEGNSFGFVIRGGAHEQRHKSRPILVTCVRPGGPADREGTLKAGDRLLNVDGMSLHGVSHAEALAILRECGQEATLQIEYDVSIMDSVTNAS----GPLLVEVAKT-PGSSLGVSLSSPGHLHKPTIIIDKIRPASVAERCGALHAGDQILSIDGTGMEHCSLLEATQLLASATDNVRLEIL 190          

HSP 4 Score: 65.4698 bits (158), Expect = 7.680e-11
Identity = 59/253 (23.32%), Postives = 118/253 (46.64%), Query Frame = 1
Query:  415 RSDIFLIGDHIISINGISTSSLCHQEIVSLVK--SSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVD-MSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            R  +  +GD ++++ G+ T      E+  L++  ++  +  L +++++                + LPK   V+ G   ++   Y K      PL +  ++ GSVA R G ++PGD++++    ++DH + E+   +LR+  + + L I     + D +         VE+ K+    LG++I     +GT+       I  + +G +A+R G + IG  I AI  +      +++AI  L++   E + LRI
Sbjct:  362 RCGVLQMGDRLLAVGGVPTEEATLDEVHQLLREAAAGGRTRLQVEFDV----AESVVPSSGTFHVKLPKRRGVELGI-TISSPAYRKAGD---PLVISDVKKGSVAHRTGTLEPGDQLLAIDGVRLDHCSMEDAAHILRQGDELVRLKIRKDDDNSDELEGTGAISYTVEL-KRYGGPLGITI-----SGTEEPFDPIIISGLTSGGLAERTGAIHIGDQILAINAVGLKGKPLSEAIRLLQTAG-ETVTLRI 599          

HSP 5 Score: 61.2326 bits (147), Expect = 1.728e-9
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 3415 KTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            K   E FG  VS+GL   G FI+A++P  PA     L  YD ++QVN + T +  C  +V LI++  + LE+++ +
Sbjct:  856 KEEGEDFGFSVSDGLVEHGVFINAVRPGGPAECSGLLRTYDRVLQVNDIHTRDYDCCLLVPLIAECGDTLEVVVSR 931          

HSP 6 Score: 54.299 bits (129), Expect = 1.846e-7
Identity = 57/199 (28.64%), Postives = 90/199 (45.23%), Query Frame = 1
Query: 1897 LVEETIFEITLKKQS-GSLGINLQ------ALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISG-TDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITV 2469
            +V   + E+ L     GSLG++        A  TR T    ++S     +A  RCG +  GD LLA+   P E+ TL E   LL+ ++     R++    + +S   +S    G F V L +    +  GI IS         P++I  +   SVA     L  GDQ+L+I+G  L   ++  A  +L Q  + VR+ +
Sbjct:  313 VVHAEVMEVVLYGDGLGSLGVHGAGEGDGVAGTTRGT----ILSPTAVCAARCRCGVLQMGDRLLAVGGVPTEEATLDEVHQLLREAAAGGRTRLQVEFDVAESVVPSS----GTFHVKLPKRRGVE-LGITISSPAYRKAGDPLVISDVKKGSVAHRTGTLEPGDQLLAIDGVRLDHCSMEDAAHILRQGDELVRLKI 502          

HSP 7 Score: 51.9878 bits (123), Expect = 1.152e-6
Identity = 39/185 (21.08%), Postives = 82/185 (44.32%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGAD----RGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
            + K+  + G  + GGA     +    ++  +RPG  A+R      GD +++++G+S   + H E +++++    + +L I+Y++     +          +       +      ++  G+   P+    + +  IRP SVA+R G +  GD+I+S     ++H +      LL    D + L I
Sbjct:   12 LYKEGNSFGFVIRGGAHEQRHKSRPILVTCVRPGGPADREGTLKAGDRLLNVDGMSLHGVSHAEALAILRECGQEATLQIEYDVSIMDSVTNASGPLLVEVAKTPGSSLGV---SLSSPGHLHKPT----IIIDKIRPASVAERCGALHAGDQILSIDGTGMEHCSLLEATQLLASATDNVRLEI 189          

HSP 8 Score: 50.0618 bits (118), Expect = 3.525e-6
Identity = 52/187 (27.81%), Postives = 82/187 (43.85%), Query Frame = 1
Query: 1642 TFGFTLK--AHCNHPTER--LVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIG----------RSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++  AH      R  LV C     ++   PA   G L  GD +  +DG++  G          R   Q     IE +  ++ S+     P   LLVE       + K  GS      +         ++I K+ P S A RCG +  GD +L++D   +E C+L EA  LL +++D++ + I
Sbjct:   18 SFGFVIRGGAHEQRHKSRPILVTC-----VRPGGPADREGTLKAGDRLLNVDGMSLHGVSHAEALAILRECGQEATLQIEYDVSIMDSVTNASGP---LLVE-------VAKTPGSSLGVSLSSPGHLHKPTIIIDKIRPASVAERCGALHAGDQILSIDGTGMEHCSLLEATQLLASATDNVRLEI 189          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001894.1 (pep scaffold:Pmarinus_7.0:GL482309:11063:22203:-1 gene:ENSPMAG00000001715.1 transcript:ENSPMAT00000001894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 7.301e-22
Identity = 67/188 (35.64%), Postives = 107/188 (56.91%), Query Frame = 1
Query: 1912 IFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAA-SRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITV 2469
            IF + L KK+S  LGI + +   R+ GEPL+I+ +  GS A  R G + PGD LLA+D+  +E  ++A+A  +L+   D + ++I+K         G        +TV+LKR     P GI ISGT++ +D PI I  + P+ +A     +  GDQIL+IN  SL+   LT+A+++L +  + V + +
Sbjct:   13 IFHVKLPKKRSVELGITISSPSRRSFGEPLVITDIRKGSVAHRRIGTLEPGDRLLAIDQVHLENASMADAAQVLRQCEDLVKLKIRKDDDGANDEGGAIS-----YTVELKRY--GGPLGITISGTEEPLD-PITISGLTPSGLAERTGAIHVGDQILAINNVSLKAKGLTEAIQLLQRSSETVALKI 192          

HSP 2 Score: 67.0106 bits (162), Expect = 1.829e-11
Identity = 37/105 (35.24%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 3328 NTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            NT  R  + +     S+ S  +  + L +    E FG  +S+GL  KG F+SA++   PAS    L  YD I+QVN + T N  C  VV L++ S++ L+LL+ +
Sbjct:  395 NTQDRQPTREKTEDMSSASMQLHKLMLYKDRDGEDFGFSLSDGLLEKGVFVSAVRQAGPAS-IGGLQQYDRILQVNQVHTRNADCCLVVPLVAASDDCLQLLVGR 498          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001892.1 (pep scaffold:Pmarinus_7.0:GL482309:11063:22203:-1 gene:ENSPMAG00000001715.1 transcript:ENSPMAT00000001892.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.042e-21
Identity = 67/188 (35.64%), Postives = 107/188 (56.91%), Query Frame = 1
Query: 1912 IFEITL-KKQSGSLGINLQALVTRTTGEPLLISKVLPGSAA-SRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITV 2469
            IF + L KK+S  LGI + +   R+ GEPL+I+ +  GS A  R G + PGD LLA+D+  +E  ++A+A  +L+   D + ++I+K         G        +TV+LKR     P GI ISGT++ +D PI I  + P+ +A     +  GDQIL+IN  SL+   LT+A+++L +  + V + +
Sbjct:   13 IFHVKLPKKRSVELGITISSPSRRSFGEPLVITDIRKGSVAHRRIGTLEPGDRLLAIDQVHLENASMADAAQVLRQCEDLVKLKIRKDDDGANDEGGAIS-----YTVELKRY--GGPLGITISGTEEPLD-PITISGLTPSGLAERTGAIHVGDQILAINNVSLKAKGLTEAIQLLQRSSETVALKI 192          

HSP 2 Score: 67.0106 bits (162), Expect = 1.748e-11
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 3307 KESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            +  +L  NT  R  + +     S+ S  +  + L +    E FG  +S+GL  KG F+SA++   PAS    L  YD I+QVN + T N  C  VV L++ S++ L+LL+ +
Sbjct:  402 RSYSLPRNTQDRQPTREKTEDMSSASMQLHKLMLYKDRDGEDFGFSLSDGLLEKGVFVSAVRQAGPAS-IGGLQQYDRILQVNQVHTRNADCCLVVPLVAASDDCLQLLVGR 512          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005746.1 (pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 gene:ENSPMAG00000005206.1 transcript:ENSPMAT00000005746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 8.277e-9
Identity = 76/309 (24.60%), Postives = 128/309 (41.42%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADR-GETPV-IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQE-IVSLVKSSKPKISLII-----DYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVE----IQKQVNER-------------------LGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQR 1137
            VD+ K +   LG +V G   + G   + I  I   SI  R      GD I++ING+       QE  V L++++   + L++     D E P         + +   L    S     GFG V         ++   + V  I PG VADRDGR+  GD+I+S G+  V     E VI++LR+   ++ L + +      + A    P + +    +   V+E                    LG+++ +  DN        + ++  GS+A+R G + +   I A+  +    ++  DA+  L S  R
Sbjct:   93 VDLDKPEGVGLGFSVMGVRSKNGHNGIFIKAIHADSIVGRWARLQEGDQILAINGMPLDERVSQEQAVRLLQTTTGPVQLVVARFSHDTETPPTEVGGGLEQTESIELVTTGSG---MGFGIVG--------NRATGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLVAHGEPGEQLPATP-SPALAQTPPYLPPVVDEEGVDDDVEVYDVELTKGGHGLGINLTSTGDNTG----IVVRSMVPGSLAERDGRIGVDDQIVAVDGIFIGALSSTDALSLLCSTGR 385          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 61.2326 bits (147), Expect = 6.002e-10
Identity = 45/158 (28.48%), Postives = 81/158 (51.27%), Query Frame = 1
Query: 1996 LLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGT--DDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRI 2463
            L I  + PG+ A +CG +  GD LL ++ + +   T A A+ +L+N+   + + + +     +        D  VFTV+LK++      GI +SG    + ID    +  + P  VA+   ++  GD++LS+NG S +G T  + + +L   P +VR+
Sbjct:   24 LYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKKDPDR--------DSDVFTVELKKDSKGS-LGIHVSGGVGTNCID----VRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRL 168          

HSP 2 Score: 60.077 bits (144), Expect = 1.597e-9
Identity = 71/293 (24.23%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  310 IIKKDNETLGLTVSGGADRGETPV----IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGY---CKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLRE--HRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVN-ERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            ++ K+++ +GL V GG D   TP+    I +I+PG+ AE+      GD ++ +N      + H   + ++K++ P + L +  +        K+        T+    D     G    GG    C D        V H+ P  VA +DGRI+ GD+++S        LT + V+ LL+    R +L            +      P + EI  +     LG S+    D+       YI+ +   S + R G L+IG  +  +       MT  +A+EA+++     I +R+
Sbjct:    1 MLLKEDQGIGLMVIGGLD---TPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARK--------KDPDRDSDVFTVELKKDSKGSLGIHVSGGVGTNCID--------VRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSGGNGKAFKEILQKTPPEPSVKEITLEKGPSGLGFSVGGGRDSLYGDTPIYIKYVFKDSASSRSG-LEIGDEVLEVNGRHMRGMTNVEALEAIRALPYGAIVIRV 273          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 55.0694 bits (131), Expect = 2.764e-8
Identity = 41/187 (21.93%), Postives = 90/187 (48.13%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGADRGETP-----VIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGF-VARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTI 855
            +++    LG +++GG D           I  + PG  A +     + D I+S+NG +T  + HQ+ V  +K++  +++L+ + +        +     +  + L K     +G GF +A G   +       + +  I  G  A +DGR++ GDKI+S     ++ ++ E+ + +L+  ++++T+ +
Sbjct:    9 LERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLVREKK--------RGNAPTREEIVLIKGS---KGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVV 184          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Match: EDO47722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN6])

HSP 1 Score: 54.6842 bits (130), Expect = 3.198e-8
Identity = 25/78 (32.05%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  313 IKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDY 546
            + K +E LG  V GG ++     I+ I PG +A+R      GD ++S+NG+S     H++ V L+K ++  + L++ Y
Sbjct:   95 LPKTDEGLGFNVMGGREQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVVKY 172          

HSP 2 Score: 52.373 bits (124), Expect = 1.859e-7
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  601 LTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYS 864
            + LPK+D   EG GF   GG  ++     P+ +  I PG VADR G +K GD+++S     V+    E  + LL+E +  + L ++Y+
Sbjct:   93 VELPKTD---EGLGFNVMGGREQN----SPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVVKYT 173          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Match: EDO27081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA90])

HSP 1 Score: 48.1358 bits (113), Expect = 9.836e-7
Identity = 24/76 (31.58%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRP-LTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIE 858
            GFGF  RGG         P + +  +R    A  DGR+KPGD+I++  + ++D+++ E  +   R   D ++L +E
Sbjct:   14 GFGFNIRGGIDHPHIGCDPGIFITTVRADGAAGNDGRLKPGDRILAVNSTRLDNVSHEQAVRAFRVSEDYVSLLVE 89          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Match: EDO34828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC4])

HSP 1 Score: 48.9062 bits (115), Expect = 1.464e-6
Identity = 25/78 (32.05%), Postives = 46/78 (58.97%), Query Frame = 1
Query: 1900 VEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQN 2133
             EE  FE+ L K    LG++L       +G P+ I +++PG +A+ CG +   D++L ++ K +++ T  EA+ +L+N
Sbjct:   37 AEEQPFEVHLIKGPQGLGMSLTG---GESGGPIYIKRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSILRN 111          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:101157934])

HSP 1 Score: 187.963 bits (476), Expect = 2.964e-48
Identity = 113/310 (36.45%), Postives = 178/310 (57.42%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLV 1215
            V+++KK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP              S  + K+ D+    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G ++PGD+++S     + +      +++L +   +    IEY V  +D    +  P++VEI K     LG+++ +  H N    Q+  I+ ++ GSVADRCG L  G  + +I    T+  T+ +A + L S   E +KL I+P+ H  +L   Q + +LV
Sbjct:   26 VELVKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELP-------PTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVEIAKSPGATLGITLTSASHRN---KQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLAS-TTELVKLEILPS-HQTRLTGKQHDTALV 323          

HSP 2 Score: 125.561 bits (314), Expect = 1.318e-28
Identity = 97/298 (32.55%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H+E  +VIL+ D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + A  ++  GE L+IS +  GS A R G + PGD LLA+D   +E C+  +A  +LQ   + + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  387 HVETSEVILTGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 672          

HSP 3 Score: 77.411 bits (189), Expect = 8.200e-14
Identity = 71/281 (25.27%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +     ++++ E                 + LPK   V+ G    A     K P +   L +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  + + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++
Sbjct:  403 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEF--DVAESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGES--LIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIK 670          

HSP 4 Score: 76.6406 bits (187), Expect = 1.474e-13
Identity = 66/242 (27.27%), Postives = 112/242 (46.28%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRT--TGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL 2472
            GDYIK+++G+       ++I + L     +V++   YE+    PD    V     +I L K+  S G  ++           PL+++ V PG  A R G + PGD LL++D  P+      EA+ +L   S     +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID + P SVA     L  GD +LSI+G S    T+ +A ++L    + V++ +L
Sbjct:   70 GDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELPPTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNAS----GPLLVEIAKS-PGATLGITLTSASHRNKQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEIL 306          

HSP 5 Score: 64.3142 bits (155), Expect = 7.970e-10
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDG--LATIGRS-----LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + +++   PA   G L  GD + ++DG  L   G +     L Q + + +   +  +T +  V +    LLVE        K    +LGI L +   R   + ++I +V PGS A RCG + PGD LL++D    E CT+ EA  LL ++++ + + I
Sbjct:  134 SFGFVMRGGTHEDWHKSRPLV----VTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVE------IAKSPGATLGITLTSASHRNK-QVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEI 305          

HSP 6 Score: 62.7734 bits (151), Expect = 2.443e-9
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K+ L +E+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  +  DA + L+  + E +KL+I
Sbjct:  402 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---ESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCE-ELVKLKI 572          

HSP 7 Score: 59.3066 bits (142), Expect = 3.115e-8
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 1
Query: 3361 IHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            I SS +   +   + + +   ++ FG  VS+G   KG +++ ++P  PA R A L  +D I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct:  804 IVSSFSTVVSFFQVTVIKDPESDDFGFSVSDGFLEKGVYVNMVRPEGPADR-AGLRSFDRILQVNHVRTRDFDCCLAVPLITEAGDRLELVISR 896          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:101157934])

HSP 1 Score: 188.734 bits (478), Expect = 5.191e-48
Identity = 114/315 (36.19%), Postives = 178/315 (56.51%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDH 1230
            V+++KK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP              S  + K+ D+    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G ++PGD+++S     + +      +++L +   +    IEY V  +D    +  P++VEI K     LG+++ +  H N    Q+  I+ ++ GSVADRCG L  G  + +I    T+  T+ +A + L S   E +KL I+P+ H  +L   Q +   V   DH
Sbjct:   52 VELVKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELP-------PTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVEIAKSPGATLGITLTSASHRN---KQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLAS-TTELVKLEILPS-HQTRLTGKQHDTVKVQKSDH 354          

HSP 2 Score: 125.946 bits (315), Expect = 1.145e-28
Identity = 97/298 (32.55%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H+E  +VIL+ D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + A  ++  GE L+IS +  GS A R G + PGD LLA+D   +E C+  +A  +LQ   + + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  465 HVETSEVILTGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 750          

HSP 3 Score: 79.337 bits (194), Expect = 2.535e-14
Identity = 71/281 (25.27%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +     ++++ E                 + LPK   V+ G    A     K P +   L +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  + + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++
Sbjct:  481 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEF--DVAESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGES--LIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIK 748          

HSP 4 Score: 78.1814 bits (191), Expect = 5.816e-14
Identity = 72/269 (26.77%), Postives = 120/269 (44.61%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRT--TGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL---------RQKAETSVTKPLSPNSTD 2526
            GDYIK+++G+       ++I + L     +V++   YE+    PD    V     +I L K+  S G  ++           PL+++ V PG  A R G + PGD LL++D  P+      EA+ +L   S     +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID + P SVA     L  GD +LSI+G S    T+ +A ++L    + V++ +L         +Q     V K   P+S D
Sbjct:   96 GDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELPPTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNAS----GPLLVEIAKS-PGATLGITLTSASHRNKQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEILPSHQTRLTGKQHDTVKVQKSDHPHSWD 359          

HSP 5 Score: 65.0846 bits (157), Expect = 5.503e-10
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDG--LATIGRS-----LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + +++   PA   G L  GD + ++DG  L   G +     L Q + + +   +  +T +  V +    LLVE        K    +LGI L +   R   + ++I +V PGS A RCG + PGD LL++D    E CT+ EA  LL ++++ + + I
Sbjct:  160 SFGFVMRGGTHEDWHKSRPLV----VTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVE------IAKSPGATLGITLTSASHRNK-QVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEI 331          

HSP 6 Score: 63.929 bits (154), Expect = 1.350e-9
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K+ L +E+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  +  DA + L+  + E +KL+I
Sbjct:  480 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---ESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCE-ELVKLKI 650          

HSP 7 Score: 58.5362 bits (140), Expect = 5.404e-8
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3424 TESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++ FG  VS+G   KG +++ ++P  PA R A L  +D I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct: 1058 SDDFGFSVSDGFLEKGVYVNMVRPEGPADR-AGLRSFDRILQVNHVRTRDFDCCLAVPLITEAGDRLELVISR 1129          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:101157934])

HSP 1 Score: 188.734 bits (478), Expect = 5.282e-48
Identity = 114/315 (36.19%), Postives = 178/315 (56.51%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDH 1230
            V+++KK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP              S  + K+ D+    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G ++PGD+++S     + +      +++L +   +    IEY V  +D    +  P++VEI K     LG+++ +  H N    Q+  I+ ++ GSVADRCG L  G  + +I    T+  T+ +A + L S   E +KL I+P+ H  +L   Q +   V   DH
Sbjct:   52 VELVKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELP-------PTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVEIAKSPGATLGITLTSASHRN---KQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLAS-TTELVKLEILPS-HQTRLTGKQHDTVKVQKSDH 354          

HSP 2 Score: 126.331 bits (316), Expect = 9.824e-29
Identity = 97/298 (32.55%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H+E  +VIL+ D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + A  ++  GE L+IS +  GS A R G + PGD LLA+D   +E C+  +A  +LQ   + + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  465 HVETSEVILTGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 750          

HSP 3 Score: 78.9518 bits (193), Expect = 2.690e-14
Identity = 71/281 (25.27%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +     ++++ E                 + LPK   V+ G    A     K P +   L +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  + + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++
Sbjct:  481 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEF--DVAESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGES--LIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIK 748          

HSP 4 Score: 78.1814 bits (191), Expect = 5.622e-14
Identity = 72/269 (26.77%), Postives = 120/269 (44.61%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRT--TGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL---------RQKAETSVTKPLSPNSTD 2526
            GDYIK+++G+       ++I + L     +V++   YE+    PD    V     +I L K+  S G  ++           PL+++ V PG  A R G + PGD LL++D  P+      EA+ +L   S     +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID + P SVA     L  GD +LSI+G S    T+ +A ++L    + V++ +L         +Q     V K   P+S D
Sbjct:   96 GDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELPPTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNAS----GPLLVEIAKS-PGATLGITLTSASHRNKQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEILPSHQTRLTGKQHDTVKVQKSDHPHSWD 359          

HSP 5 Score: 65.0846 bits (157), Expect = 5.275e-10
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDG--LATIGRS-----LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + +++   PA   G L  GD + ++DG  L   G +     L Q + + +   +  +T +  V +    LLVE        K    +LGI L +   R   + ++I +V PGS A RCG + PGD LL++D    E CT+ EA  LL ++++ + + I
Sbjct:  160 SFGFVMRGGTHEDWHKSRPLV----VTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVE------IAKSPGATLGITLTSASHRNK-QVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEI 331          

HSP 6 Score: 63.5438 bits (153), Expect = 1.373e-9
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K+ L +E+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  +  DA + L+  + E +KL+I
Sbjct:  480 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---ESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCE-ELVKLKI 650          

HSP 7 Score: 58.5362 bits (140), Expect = 5.404e-8
Identity = 27/81 (33.33%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 3400 IRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + + +   ++ FG  VS+G   KG +++ ++P  PA R A L  +D I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct: 1050 VTVIKDPESDDFGFSVSDGFLEKGVYVNMVRPEGPADR-AGLRSFDRILQVNHVRTRDFDCCLAVPLITEAGDRLELVISR 1129          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:101157934])

HSP 1 Score: 188.734 bits (478), Expect = 5.519e-48
Identity = 114/315 (36.19%), Postives = 178/315 (56.51%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDH 1230
            V+++KK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP              S  + K+ D+    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G ++PGD+++S     + +      +++L +   +    IEY V  +D    +  P++VEI K     LG+++ +  H N    Q+  I+ ++ GSVADRCG L  G  + +I    T+  T+ +A + L S   E +KL I+P+ H  +L   Q +   V   DH
Sbjct:   80 VELVKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELP-------PTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVEIAKSPGATLGITLTSASHRN---KQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLAS-TTELVKLEILPS-HQTRLTGKQHDTVKVQKSDH 382          

HSP 2 Score: 126.331 bits (316), Expect = 9.958e-29
Identity = 97/298 (32.55%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H+E  +VIL+ D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + A  ++  GE L+IS +  GS A R G + PGD LLA+D   +E C+  +A  +LQ   + + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  493 HVETSEVILTGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 778          

HSP 3 Score: 79.337 bits (194), Expect = 2.559e-14
Identity = 71/281 (25.27%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +     ++++ E                 + LPK   V+ G    A     K P +   L +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  + + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++
Sbjct:  509 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEF--DVAESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGES--LIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIK 776          

HSP 4 Score: 78.1814 bits (191), Expect = 5.627e-14
Identity = 72/269 (26.77%), Postives = 120/269 (44.61%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRT--TGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL---------RQKAETSVTKPLSPNSTD 2526
            GDYIK+++G+       ++I + L     +V++   YE+    PD    V     +I L K+  S G  ++           PL+++ V PG  A R G + PGD LL++D  P+      EA+ +L   S     +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID + P SVA     L  GD +LSI+G S    T+ +A ++L    + V++ +L         +Q     V K   P+S D
Sbjct:  124 GDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELPPTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNAS----GPLLVEIAKS-PGATLGITLTSASHRNKQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEILPSHQTRLTGKQHDTVKVQKSDHPHSWD 387          

HSP 5 Score: 65.0846 bits (157), Expect = 5.782e-10
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDG--LATIGRS-----LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + +++   PA   G L  GD + ++DG  L   G +     L Q + + +   +  +T +  V +    LLVE        K    +LGI L +   R   + ++I +V PGS A RCG + PGD LL++D    E CT+ EA  LL ++++ + + I
Sbjct:  188 SFGFVMRGGTHEDWHKSRPLV----VTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVE------IAKSPGATLGITLTSASHRNK-QVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEI 359          

HSP 6 Score: 63.929 bits (154), Expect = 1.314e-9
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREH--RDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K+ L +E+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  +  DA + L+  + E +KL+I
Sbjct:  508 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---ESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCE-ELVKLKI 678          

HSP 7 Score: 58.5362 bits (140), Expect = 5.256e-8
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 3424 TESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            ++ FG  VS+G   KG +++ ++P  PA R A L  +D I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct: 1086 SDDFGFSVSDGFLEKGVYVNMVRPEGPADR-AGLRSFDRILQVNHVRTRDFDCCLAVPLITEAGDRLELVISR 1157          
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Match: grip2b (glutamate receptor interacting protein 2 [Source:NCBI gene;Acc:101157934])

HSP 1 Score: 188.348 bits (477), Expect = 5.920e-48
Identity = 114/315 (36.19%), Postives = 178/315 (56.51%), Query Frame = 1
Query:  304 VDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDV---DEG--FGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATY-HDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDH 1230
            V+++KK+  TLGLT+SGG D+   P ++N+RPG +A RSD   IGD+I S+NGI+ + L H+EI+SL+K+   ++ L ++YELP              S  + K+ D+    EG  FGFV RGG  +D  K RPL V ++RPG  ADR+G ++PGD+++S     + +      +++L +   +    IEY V  +D    +  P++VEI K     LG+++ +  H N    Q+  I+ ++ GSVADRCG L  G  + +I    T+  T+ +A + L S   E +KL I+P+ H  +L   Q +   V   DH
Sbjct:   49 VELVKKEGSTLGLTISGGTDKDGKPRVSNLRPGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELP-------PTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVEIAKSPGATLGITLTSASHRN---KQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLAS-TTELVKLEILPS-HQTRLTGKQHDTVKVQKSDH 351          

HSP 2 Score: 125.946 bits (315), Expect = 1.213e-28
Identity = 97/298 (32.55%), Postives = 155/298 (52.01%), Query Frame = 1
Query: 1597 HLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEA---NKVVITSLYEVRDPDPQLLVEETIFEITLKKQSG-SLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQ 2478
            H+E  +VIL+ D    FG  L+      TE L   P I  I+ D  A  CG+L  GD + +I+G+ T   +L++ N  L +A   NKVV+   ++V +    ++     F + L K+ G  LGI + A  ++  GE L+IS +  GS A R G + PGD LLA+D   +E C+  +A  +LQ   + + ++I+K          +      ++TV+LKR     P GI ISGT++  D PI I  +    +A     +  GD+IL+IN  SL+G  L++A+ +L    + V + + +Q
Sbjct:  462 HVETSEVILTGDPLNGFGVQLQGGI-FATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVAE---SVVPSSGTFHVKLPKKRGVELGITISA--SKKPGESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSI---IYTVELKRY--GGPLGITISGTEEPFD-PITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIKKQ 747          

HSP 3 Score: 78.9518 bits (193), Expect = 2.949e-14
Identity = 71/281 (25.27%), Postives = 129/281 (45.91%), Query Frame = 1
Query:  334 LGLTVSGGADRGET----PVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQI--FYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALK-SGQRERIKLR 1155
             G+ + GG    ET    P+I  I P S AER  +  +GD ++SINGI T     +E   L++ +     ++++ E                 + LPK   V+ G    A     K P +   L +  I+ GS+A R G ++PGDK+++  N ++++ + E+   +L++  + + L I     + D    SG  I     K+    LG++I+     GT+       I  +    +A+R G + +G  I AI  +      +++AI  L+ +G+   +K++
Sbjct:  478 FGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEF--DVAESVVPSSGTFHVKLPKKRGVELGITISA----SKKPGES--LIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCEELVKLKIRKDEDNSDEQETSGSIIYTVELKRYGGPLGITIS-----GTEEPFDPITISGLTKRGLAERTGAIHVGDRILAINSVSLKGKPLSEAIHLLQMAGETVTLKIK 745          

HSP 4 Score: 77.7962 bits (190), Expect = 6.767e-14
Identity = 72/269 (26.77%), Postives = 120/269 (44.61%), Query Frame = 1
Query: 1762 GDYIKAIDGLATIGRSLDQINNQLIE-ANKVVITSLYEV--RDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRT--TGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVL---------RQKAETSVTKPLSPNSTD 2526
            GDYIK+++G+       ++I + L     +V++   YE+    PD    V     +I L K+  S G  ++           PL+++ V PG  A R G + PGD LL++D  P+      EA+ +L   S     +I+    +  + +  S    G   V++ +  P    GI ++       Q I+ID + P SVA     L  GD +LSI+G S    T+ +A ++L    + V++ +L         +Q     V K   P+S D
Sbjct:   93 GDYIKSVNGINLTKLRHEEIISLLKNVGERVLLEVEYELPPTAPDSTSGVISKTIDICLHKEGNSFGFVMRGGTHEDWHKSRPLVVTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNAS----GPLLVEIAKS-PGATLGITLTSASHRNKQVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEILPSHQTRLTGKQHDTVKVQKSDHPHSWD 356          

HSP 5 Score: 64.6994 bits (156), Expect = 6.138e-10
Identity = 53/183 (28.96%), Postives = 89/183 (48.63%), Query Frame = 1
Query: 1642 TFGFTLKAHCN---HPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDG--LATIGRS-----LDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRI 2160
            +FGF ++   +   H +  LV    + +++   PA   G L  GD + ++DG  L   G +     L Q + + +   +  +T +  V +    LLVE        K    +LGI L +   R   + ++I +V PGS A RCG + PGD LL++D    E CT+ EA  LL ++++ + + I
Sbjct:  157 SFGFVMRGGTHEDWHKSRPLV----VTYVRPGGPADREGTLRPGDRLLSVDGVPLHNAGHNEALSVLGQCSQEALFQIEYDVTIMDTVTNASGPLLVE------IAKSPGATLGITLTSASHRNK-QVIVIDRVKPGSVADRCGALHPGDHLLSIDGTSTEHCTVLEATQLLASTTELVKLEI 328          

HSP 6 Score: 63.5438 bits (153), Expect = 1.360e-9
Identity = 51/177 (28.81%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  634 GFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHR--DKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRI 1158
            GFG   +GG     +   P  +  I P S A+R G ++ GD+++S      +  T E    LLR+    +K+ L +E+ VA  +    S     V++ K+    LG++I+     G   +   I +I+ GS+A R G L+ G  + AI ++R +  +  DA + L+  + E +KL+I
Sbjct:  477 GFGVQLQGGIFATETLSAPPLIRFIEPDSSAERCGLLQVGDRLLSINGIPTEDGTLEEANQLLRDAALTNKVVLEVEFDVA--ESVVPSSGTFHVKLPKKRGVELGITISASKKPG---ESLIISDIKKGSMAHRTGTLEPGDKLLAIDNIRLENCSKEDAEQILQQCE-ELVKLKI 647          

HSP 7 Score: 58.5362 bits (140), Expect = 5.492e-8
Identity = 27/81 (33.33%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 3400 IRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRK 3642
            + + +   ++ FG  VS+G   KG +++ ++P  PA R A L  +D I+QVN + T +  C   V LI+++ + LEL+I +
Sbjct: 1047 VTVIKDPESDDFGFSVSDGFLEKGVYVNMVRPEGPADR-AGLRSFDRILQVNHVRTRDFDCCLAVPLITEAGDRLELVISR 1126          
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Match: SMESG000009125.1 (SMESG000009125.1)

HSP 1 Score: 2204.48 bits (5711), Expect = 0.000e+0
Identity = 1221/1221 (100.00%), Postives = 1221/1221 (100.00%), Query Frame = 1
Query:  178 MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKXXXXXXXXXXXXXXXFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPXXXXXXXXXXXXXXXXXXXXQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPAXXXXXXXXXXGTKDKSLFLKNPTRKEFSICEEATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPXXXXXXXXXXNSINKQNPNXXXXXXXXXXXXVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT 3840
            MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPEKTEIQKEIKIKQASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLTDDTNINTSNTNSLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFSNVKSHKKSSLKSVQQVSIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIKKGSPLPKSSSGTSQSDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKSNTRSLNRSDNRNRSFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPISIMTNTSITTTTESDSSDSQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPASIDSNSSSASGTKDKSLFLKNPTRKEFSICEEATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPVVVTTESTSSNSINKQNPNRKLEKRSSSLRRVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT
Sbjct:    1 MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPEKTEIQKEIKIKQASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLTDDTNINTSNTNSLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFSNVKSHKKSSLKSVQQVSIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIKKGSPLPKSSSGTSQSDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKSNTRSLNRSDNRNRSFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPISIMTNTSITTTTESDSSDSQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPASIDSNSSSASGTKDKSLFLKNPTRKEFSICEEATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPVVVTTESTSSNSINKQNPNRKLEKRSSSLRRVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT 1221          
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Match: SMESG000009125.1 (SMESG000009125.1)

HSP 1 Score: 2095.86 bits (5429), Expect = 0.000e+0
Identity = 1176/1221 (96.31%), Postives = 1178/1221 (96.48%), Query Frame = 1
Query:  178 MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLXXXXXXXXXXXXXLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFXXXXXXXXXXXXXXXXXXIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKXXXXXXXXXXXXXXXFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPXXXXXXXXXXXXXXXXXXXXQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPAXXXXXXXXXXGTKDKSLFLKNPTRKEFSICEEATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPXXXXXXXXXXNSINKQNPNXXXXXXXXXXXXVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT 3840
            MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPEKTEIQKEIKIKQASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLTDDTNINTSNTNSLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFSNVKSHKKSSLKSVQQVSIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIKKGSPLPKSSSGTSQSDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKSNTRSLNRSDNRNRSFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPISIMTNTSITTTTESDSSDSQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPASIDS                                       + +   DSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPVVVTTESTSSNSINKQNPNRKLEKRSSSLRRVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT
Sbjct:    1 MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIIDYELPEKTEIQKEIKIKQASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQVNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQDLRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQDHSTMKGVNSKELLSLTDDTNINTSNTNSLVGSDPLDLQCNCSEVYVGSNSLRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSLFSNVKSHKKSSLKSVQQVSIDGSHLEELQVILSIDSHGTFGFTLKAHCNHPTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINNQLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDSLTVRIKKGSPLPKSSSGTSQSDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKSNTRSLNRSDNRNRSFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRIESEPPEAVWNTNIKSNISEPGSSYLEPISIMTNTSITTTTESDSSDSQNTAHSLFTKHRPLIRNNPHKDLNHSLLSHQPASIDS---------------------------------------NSSSASDSIQCPGCREAIENEWRSKEHLNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIRKRKPVVVTTESTSSNSINKQNPNRKLEKRSSSLRRVPPKESCVHVTMNESLKMVNSSHNMKSSSFKT 1182          
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Match: SMESG000026494.1 (SMESG000026494.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.287e-8
Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 1
Query: 3361 IHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSP-KGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIR 3639
            IH S  + R+   + L R +P E FG  +   ++P +   I  I P S A +C  L+L D I+ VNG STE +   DV+ +I  S+ N+E+ +R
Sbjct:  426 IHGSLKVDRDCRNVLLTR-SPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 518          

HSP 2 Score: 56.9954 bits (136), Expect = 9.198e-8
Identity = 53/184 (28.80%), Postives = 83/184 (45.11%), Query Frame = 1
Query: 1936 QSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDS------LTVRIXXXXXXXXXXXXXXXXDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITV 2469
            +S + G   + +     G  + I  ++P     +CG I  GD+++ ++    EK T +E V LL  ++ S      LTVR K          G+ + D     V L R  P + +G VI    +   +P  I  INP SVA    +L  GD+IL++NG S  G      +K++      + ITV
Sbjct:  337 RSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR-KSRHEPHSGIHGSLKVDRDCRNVLLTRS-PEEEFGFVIVSAVNPT-EPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 517          

HSP 3 Score: 54.6842 bits (130), Expect = 4.704e-7
Identity = 55/210 (26.19%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  277 YQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLV----KSSKPKISLIID---YELPXXXXXXXXXXXXXASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMS 885
            Y      ++V + +   +  G  + GGA+ G    I  I P    ++  +   GD II IN  ST    H E+V+L+    KS+  K++L +    +E         ++     ++ L +S +  E FGFV       +P++  P  +  I PGSVA++   +  GD+I++      + L  ++VI +++ H D   L IE +V   D++
Sbjct:  324 YSHPPETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVDRDCRNVLLTRSPE--EEFGFVIVSAV--NPTE--PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIK-HSD---LNIEITVRDGDIN 523          

HSP 4 Score: 51.9878 bits (123), Expect = 3.469e-6
Identity = 41/128 (32.03%), Postives = 63/128 (49.22%), Query Frame = 1
Query: 3289 STQESIKESTLFDNTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGI----GVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENN----LELLIRKRK 3648
            S Q      T ++  +K++ + K  H   T+S     ++L R +PT+ FG     G  EG      +I AI PN P  +C  +N  D II +N  STE    S+VVTL+ ++  +    L L +RK +
Sbjct:  303 SQQPDFIPDTFYE--SKKTNTIKYSHPPETVS-----VQLTR-SPTKGFGFRLMGGAEEGCQ---VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR 419          
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.383e-8
Identity = 58/234 (24.79%), Postives = 100/234 (42.74%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPV---IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIID----------------YELPXXXXXXXXXXXXXASLTLPKSDDVD---------EGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDM 882
            KS++  ++    +V + + +NE  G  +     R  + V   I  +   S A++  +  +GD I+S+NG S S + H++IV  +K+    ++L I                 YE  ++    +             S DVD         +GFGF  RGG  +D +KM PL V+ I     A +DGR+K GDKI+         +T    I +++     + L +  S  +  +
Sbjct: 1141 KSNLTPQRRIPFDVTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGG--QDFNKM-PLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRRSAGASQL 1371          
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.495e-8
Identity = 58/234 (24.79%), Postives = 100/234 (42.74%), Query Frame = 1
Query:  265 KSSIYQEKISRINVDIIKKDNETLGLTVSGGADRGETPV---IANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLVKSSKPKISLIID----------------YELPXXXXXXXXXXXXXASLTLPKSDDVD---------EGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDM 882
            KS++  ++    +V + + +NE  G  +     R  + V   I  +   S A++  +  +GD I+S+NG S S + H++IV  +K+    ++L I                 YE  ++    +             S DVD         +GFGF  RGG  +D +KM PL V+ I     A +DGR+K GDKI+         +T    I +++     + L +  S  +  +
Sbjct: 1141 KSNLTPQRRIPFDVTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGG--QDFNKM-PLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRRSAGASQL 1371          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIP21.140e-7430.37glutamate receptor interacting protein 2 [Source:H... [more]
GRIP21.181e-7430.37glutamate receptor interacting protein 2 [Source:H... [more]
GRIP22.394e-7430.41glutamate receptor interacting protein 2 [Source:H... [more]
GRIP14.562e-4835.22glutamate receptor interacting protein 1 [Source:H... [more]
GRIP15.043e-4835.22glutamate receptor interacting protein 1 [Source:H... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-71.495e-833.33pep chromosome:WBcel235:II:14346877:14348792:-1 ge... [more]
lin-71.562e-633.33pep chromosome:WBcel235:II:14347162:14348792:-1 ge... [more]
magi-13.083e-626.89MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-13.202e-626.89MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-13.224e-626.89MAGI (Membrane Associated Guanylate kinase Inverte... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grip9.651e-1727.42gene:FBgn0029830 transcript:FBtr0070865[more]
Grip1.193e-1625.68gene:FBgn0029830 transcript:FBtr0343413[more]
Grip1.193e-1625.68gene:FBgn0029830 transcript:FBtr0343414[more]
Magi7.805e-1027.68gene:FBgn0034590 transcript:FBtr0342874[more]
Magi7.805e-1027.68gene:FBgn0034590 transcript:FBtr0071636[more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grip13.553e-5036.21glutamate receptor interacting protein 1 [Source:Z... [more]
grip14.192e-5036.21glutamate receptor interacting protein 1 [Source:Z... [more]
grip14.458e-5036.21glutamate receptor interacting protein 1 [Source:Z... [more]
grip2b1.044e-4636.48glutamate receptor interacting protein 2b [Source:... [more]
grip2b4.247e-4637.72glutamate receptor interacting protein 2b [Source:... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIP24.019e-8230.95glutamate receptor interacting protein 2 [Source:N... [more]
GRIP24.193e-8230.95glutamate receptor interacting protein 2 [Source:N... [more]
GRIP24.770e-8230.95glutamate receptor interacting protein 2 [Source:N... [more]
GRIP25.249e-8230.95glutamate receptor interacting protein 2 [Source:N... [more]
GRIP29.569e-8230.95glutamate receptor interacting protein 2 [Source:N... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grip11.751e-4933.61glutamate receptor interacting protein 1 [Source:M... [more]
Grip13.193e-4934.23glutamate receptor interacting protein 1 [Source:M... [more]
Grip16.005e-4934.77glutamate receptor interacting protein 1 [Source:M... [more]
Grip16.951e-4934.77glutamate receptor interacting protein 1 [Source:M... [more]
Grip11.151e-4835.26glutamate receptor interacting protein 1 [Source:M... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8E0R9|GRIP2_XENLA2.363e-8131.07Glutamate receptor-interacting protein 2 OS=Xenopu... [more]
sp|Q9C0E4|GRIP2_HUMAN5.474e-7430.37Glutamate receptor-interacting protein 2 OS=Homo s... [more]
sp|Q925T6|GRIP1_MOUSE8.436e-4835.55Glutamate receptor-interacting protein 1 OS=Mus mu... [more]
sp|P97879|GRIP1_RAT1.069e-4735.55Glutamate receptor-interacting protein 1 OS=Rattus... [more]
sp|Q9Y3R0|GRIP1_HUMAN2.191e-4735.22Glutamate receptor-interacting protein 1 OS=Homo s... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M3Z1E26.399e-8429.10Glutamate receptor interacting protein 1 OS=Mustel... [more]
A0A3Q7PZ666.526e-8329.40glutamate receptor-interacting protein 1 OS=Callor... [more]
A0A2Y9IU807.013e-8329.86glutamate receptor-interacting protein 1 OS=Enhydr... [more]
A0A091TCQ72.374e-8232.29Glutamate receptor-interacting protein 2 (Fragment... [more]
A0A3Q0FZD78.467e-8231.03glutamate receptor-interacting protein 2 isoform X... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grip16.990e-5035.80glutamate receptor interacting protein 1 [Source:Z... [more]
grip2b2.839e-4535.08glutamate receptor interacting protein 2 [Source:N... [more]
grip2b2.968e-4535.08glutamate receptor interacting protein 2 [Source:N... [more]
grip2b3.200e-4535.08glutamate receptor interacting protein 2 [Source:N... [more]
grip2b3.296e-4535.08glutamate receptor interacting protein 2 [Source:N... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001444.12.839e-3132.37pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1... [more]
ENSPMAT00000010851.11.423e-2731.51pep scaffold:Pmarinus_7.0:GL477227:46102:76179:-1 ... [more]
ENSPMAT00000001894.17.301e-2235.64pep scaffold:Pmarinus_7.0:GL482309:11063:22203:-1 ... [more]
ENSPMAT00000001892.11.042e-2135.64pep scaffold:Pmarinus_7.0:GL482309:11063:22203:-1 ... [more]
ENSPMAT00000005746.18.277e-924.60pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 g... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456246.002e-1028.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460592.764e-821.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477223.198e-832.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270819.836e-731.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348281.464e-632.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grip2b2.964e-4836.45glutamate receptor interacting protein 2 [Source:N... [more]
grip2b5.191e-4836.19glutamate receptor interacting protein 2 [Source:N... [more]
grip2b5.282e-4836.19glutamate receptor interacting protein 2 [Source:N... [more]
grip2b5.519e-4836.19glutamate receptor interacting protein 2 [Source:N... [more]
grip2b5.920e-4836.19glutamate receptor interacting protein 2 [Source:N... [more]
back to top
BLAST of Glutamate receptor interacting protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009125.10.000e+0100.00SMESG000009125.1[more]
SMESG000009125.10.000e+096.31SMESG000009125.1[more]
SMESG000026494.11.287e-836.17SMESG000026494.1[more]
SMESG000030959.11.383e-824.79SMESG000030959.1[more]
SMESG000030959.11.495e-824.79SMESG000030959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018509 ID=SMED30018509|Name=Glutamate receptor interacting protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4001bp
TAAATTAATTTTCATTATTTTTTCCTCATAAATTTTATCAGGCTGCCTTT
CAACATGTCAGTAAAATGCTTTAATATTTAGCAAATGAAATGTTATCAAG
ATATGGAATGATTTGTTTTTTTTATTTATTTATTTAACTCGTGGAATTAT
TTTAATTTCTCTCCATTGAAACAAAAAATGGCTTGTAGTTGCATTAGAGC
TAATGAAAAAGCTTTGGGCAATCATAACTGTTCCAAATCCGATAATCTCC
TACCTCTCAAAAACAAATCAAGTATTTATCAAGAGAAAATCAGTCGTATT
AATGTGGACATCATAAAGAAAGATAATGAAACTCTAGGATTGACTGTCTC
TGGGGGCGCCGATCGCGGAGAAACTCCCGTAATTGCAAATATTCGTCCAG
GATCAATTGCAGAAAGAAGTGATATTTTTCTTATTGGAGATCACATCATA
TCTATCAATGGAATCTCAACATCCTCGCTTTGCCATCAAGAAATTGTTAG
CTTGGTGAAATCATCTAAACCAAAAATATCTTTAATCATTGACTATGAAT
TACCCGAGAAAACTGAAATACAGAAAGAAATAAAAATTAAGCAAGCATCT
TTAACTTTGCCTAAATCGGATGATGTTGATGAAGGTTTTGGATTTGTTGC
TAGAGGAGGATATTGTAAGGATCCGTCAAAAATGCGCCCGTTAACAGTCA
TGCATATAAGACCTGGCTCTGTGGCTGATAGAGACGGCCGCATAAAGCCT
GGAGACAAAATCGTATCGTTCGGAAACTGTAAAGTCGATCATTTAACTCC
AGAAAACGTTATAGCTCTTCTTAGAGAACATCGAGATAAATTGACACTTA
CAATCGAATACAGTGTTGCATCTGTCGACATGTCGGCAGTATCTGGAAGG
CCGATTATTGTCGAAATACAAAAACAAGTTAATGAACGTCTTGGAGTCTC
AATAGCAACTTATCATGACAATGGAACTGATTCCCAAATTTTTTATATCG
AAAATATCGAAGCGGGTTCTGTGGCAGACAGATGTGGTGTTTTGCAAATT
GGTCAAATAATTACTGCTATTCAAGACCTTCGTACAGATAAAATGACAAT
AAATGATGCAATCGAAGCATTGAAAAGTGGCCAAAGAGAAAGAATAAAGT
TGAGGATTATTCCAAATATACACTTTGATCAACTAAAATGGAATCAGTCG
GAAAAGTCTTTGGTTGGTATTCAAGACCACTCCACAATGAAAGGAGTCAA
TTCAAAAGAGCTTTTAAGTCTTACTGATGATACCAATATAAATACTTCTA
ATACTAATTCGTTGGTCGGTTCAGATCCACTAGATTTACAATGCAACTGC
TCAGAAGTTTATGTAGGTTCCAATTCCTTGCGTAACATAAATTCAAATTC
GTGTGCCGCGTTTTCCAATCGTCCAAAATCAGTTTTAGGATTAGATTCAG
AACATTTTTCTTTTTCACAAACTATGTCGATGAAAGATCAGAAAAAAGAT
CAATTGTCAAAAAGTGCCACCTCTTTGTTTTCCAATGTTAAATCTCATAA
AAAGTCATCTCTCAAATCCGTTCAGCAGGTCTCAATTGATGGATCGCATC
TCGAAGAGTTGCAAGTTATTCTTTCTATTGATAGTCATGGAACATTCGGA
TTTACGTTAAAGGCTCACTGTAATCATCCGACAGAACGATTAGTTCAATG
TCCACAGATTGATCACATTCAACGGGATAGGCCAGCCTATTTGTGTGGTG
TTTTAATAGAAGGTGATTATATTAAAGCGATAGATGGTCTAGCCACAATC
GGACGGTCATTGGATCAAATAAACAATCAACTGATAGAAGCCAATAAAGT
GGTCATCACTAGTTTGTATGAAGTAAGAGATCCAGATCCCCAATTATTAG
TGGAAGAGACAATTTTCGAGATAACCTTGAAAAAGCAAAGTGGTAGTTTA
GGCATAAATCTTCAAGCCCTTGTCACAAGAACAACTGGTGAGCCTTTGTT
GATAAGTAAAGTGTTACCTGGAAGCGCAGCTAGTAGATGTGGTTGCATTG
CTCCTGGAGATCTCTTATTAGCACTCGACAAGAAACCCATAGAAAAATGT
ACATTAGCAGAAGCAGTGCATCTATTGCAGAATTCTTCCGATTCTCTTAC
TGTTAGAATTAAAAAGGGCTCTCCTCTGCCAAAGTCCAGTTCCGGAACTA
GTCAATCAGATTTTGGCGTTTTTACGGTTGACTTAAAACGTGAATTGCCT
TGTCAACCCTGGGGCATTGTTATATCGGGAACTGATGACTCGATAGATCA
ACCTATTCTCATCGACTCGATTAATCCGGCTTCGGTTGCTTCCGGTGTAT
CAAAACTGTCGTCTGGAGATCAAATATTGAGCATTAACGGACACAGCTTA
CGTGGATACACCTTGACTCAAGCAATGAAAATGTTGCATCAATATCCTGA
TCAGGTTCGTATTACTGTGTTGCGTCAGAAAGCTGAAACATCAGTTACCA
AACCGTTGTCACCTAACAGTACGGATTTGTCTATTTTTTCAGATAAATAT
AAACCAAAATCAAACACGAGATCATTAAACCGATCAGATAATCGAAACAG
ATCTTTCCATAAGTCATTAGACAGTGACAAGGTTGTACTGAATTCTATGA
CTCTTCCTCCAATGAAGAACAATGGGGGCTTCAATACAACTGCTCCCCAT
CAAAGTCACAATTTTTCGACAAGAATAGAATCAGAACCACCAGAAGCGGT
TTGGAATACAAACATCAAATCGAATATCTCTGAACCCGGTTCATCTTATC
TTGAACCGATATCAATTATGACAAACACTTCAATAACGACGACAACAGAA
TCTGATTCTTCCGACTCTCAAAATACTGCCCATTCTCTGTTTACAAAACA
CAGACCATTGATACGCAATAATCCCCACAAAGACTTAAATCATTCCTTAC
TTTCTCATCAACCGGCTTCTATTGACTCTAATAGTTCATCGGCTTCAGGT
ACTAAAGATAAGTCTTTATTTTTGAAAAATCCAACGAGAAAAGAATTTTC
AATTTGCGAGGAAGCAACTGTTATTGAAGGAAGTGAAGTTGACTTTTCTC
AAACTGATATTTTAGATTCTATACAATGTCCTGGATGTCGAGAAGCCATA
GAAAATGAATGGAGAAGCAAAGAACACTTAAATGAGTCACGTTCAATTGA
CAGGAGAACAAATAGGGTTCACGGAGGAGCCATTCCAATGTCTGTTAATC
TTCCGGCAAACATGAAGAATAGAGCTGATTCACTCAAATCAACTCAGGAA
TCAATTAAAGAATCCACTTTATTTGACAATACAGCTAAAAGATCTGGCTC
AGAAAAAGATATTCATTCGTCAAGCACGTTGTCTAGAAATATTATGACAA
TAAGATTGTGTCGCAAAACTCCTACTGAATCCTTTGGCATCGGTGTATCA
GAAGGGTTATCACCAAAAGGTACATTTATTAGTGCCATAAAACCTAACTC
ACCTGCCTCACGATGTGCAAGCCTAAATCTATATGATGAAATAATTCAGG
TCAATGGTCTTTCTACCGAAAACATGCGTTGCAGCGACGTCGTAACCTTA
ATAAGCCAATCAGAAAACAATTTAGAGCTGTTGATTCGGAAACGTAAACC
AGTCGTCGTAACGACCGAATCAACGTCATCCAATTCAATAAACAAACAAA
ATCCCAATCGGAAATTGGAAAAACGTTCATCCTCATTGCGGCGTGTACCC
CCTAAAGAAAGTTGTGTTCATGTGACAATGAACGAGTCATTGAAAATGGT
CAATAGTTCTCATAATATGAAATCTTCCAGTTTCAAAACATAGAGATCCC
CCATTAATAAACAAAACGATGAAAGAAATTTTTTTCAGAAAAAAAAATCA
AGCAAACTAATCAAAGAGAAAAGCATTTTATTTTTGAAAATGGAAGTATT
ATATTGAAATAATAGAGTATTGAAAATGACTTGTTTTTAGTTTTGTTCGA
G
back to top

protein sequence of SMED30018509-orf-1

>SMED30018509-orf-1 ID=SMED30018509-orf-1|Name=SMED30018509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1222bp
MACSCIRANEKALGNHNCSKSDNLLPLKNKSSIYQEKISRINVDIIKKDN
ETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSS
LCHQEIVSLVKSSKPKISLIIDYELPEKTEIQKEIKIKQASLTLPKSDDV
DEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGN
CKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMSAVSGRPIIVEIQKQ
VNERLGVSIATYHDNGTDSQIFYIENIEAGSVADRCGVLQIGQIITAIQD
LRTDKMTINDAIEALKSGQRERIKLRIIPNIHFDQLKWNQSEKSLVGIQD
HSTMKGVNSKELLSLTDDTNINTSNTNSLVGSDPLDLQCNCSEVYVGSNS
LRNINSNSCAAFSNRPKSVLGLDSEHFSFSQTMSMKDQKKDQLSKSATSL
FSNVKSHKKSSLKSVQQVSIDGSHLEELQVILSIDSHGTFGFTLKAHCNH
PTERLVQCPQIDHIQRDRPAYLCGVLIEGDYIKAIDGLATIGRSLDQINN
QLIEANKVVITSLYEVRDPDPQLLVEETIFEITLKKQSGSLGINLQALVT
RTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLL
QNSSDSLTVRIKKGSPLPKSSSGTSQSDFGVFTVDLKRELPCQPWGIVIS
GTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAM
KMLHQYPDQVRITVLRQKAETSVTKPLSPNSTDLSIFSDKYKPKSNTRSL
NRSDNRNRSFHKSLDSDKVVLNSMTLPPMKNNGGFNTTAPHQSHNFSTRI
ESEPPEAVWNTNIKSNISEPGSSYLEPISIMTNTSITTTTESDSSDSQNT
AHSLFTKHRPLIRNNPHKDLNHSLLSHQPASIDSNSSSASGTKDKSLFLK
NPTRKEFSICEEATVIEGSEVDFSQTDILDSIQCPGCREAIENEWRSKEH
LNESRSIDRRTNRVHGGAIPMSVNLPANMKNRADSLKSTQESIKESTLFD
NTAKRSGSEKDIHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSPKGTF
ISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLE
LLIRKRKPVVVTTESTSSNSINKQNPNRKLEKRSSSLRRVPPKESCVHVT
MNESLKMVNSSHNMKSSSFKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0009967positive regulation of signal transduction
GO:0007399nervous system development
GO:0015031protein transport
GO:0016358dendrite development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR041489PDZ_6
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005102signaling receptor binding
GO:0030159receptor signaling complex scaffold activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005886plasma membrane
GO:0012505endomembrane system
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030054cell junction
GO:0043025neuronal cell body
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 1084..1157
e-value: 1.5E-12
score: 57.7
coord: 51..125
e-value: 8.2E-13
score: 58.6
coord: 253..331
e-value: 1.6E-9
score: 47.7
coord: 693..768
e-value: 2.7E-13
score: 60.2
coord: 589..665
e-value: 1.7E-15
score: 67.5
coord: 152..230
e-value: 5.1E-14
score: 62.6
coord: 488..566
e-value: 0.009
score: 25.2
IPR001478PDZ domainPFAMPF00595PDZcoord: 45..121
e-value: 5.6E-11
score: 42.6
coord: 581..661
e-value: 4.0E-11
score: 43.1
coord: 684..764
e-value: 1.3E-11
score: 44.7
coord: 150..227
e-value: 7.9E-10
score: 39.0
coord: 1082..1154
e-value: 7.8E-9
score: 35.8
IPR001478PDZ domainPROSITEPS50106PDZcoord: 244..317
score: 12.787
IPR001478PDZ domainPROSITEPS50106PDZcoord: 141..230
score: 14.737
IPR001478PDZ domainPROSITEPS50106PDZcoord: 581..665
score: 16.727
IPR001478PDZ domainPROSITEPS50106PDZcoord: 683..768
score: 16.888
IPR001478PDZ domainPROSITEPS50106PDZcoord: 42..125
score: 17.833
IPR001478PDZ domainPROSITEPS50106PDZcoord: 479..567
score: 9.31
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1074..1157
score: 15.823
IPR041489PDZ domain 6PFAMPF17820PDZ_6coord: 274..327
e-value: 1.4E-6
score: 28.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 570..670
e-value: 1.3E-18
score: 68.8
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 140..231
e-value: 5.6E-17
score: 63.7
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 671..782
e-value: 5.7E-21
score: 76.3
coord: 232..343
e-value: 8.7E-19
score: 69.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1066..1157
e-value: 1.5E-20
score: 75.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 473..568
e-value: 1.9E-8
score: 36.4
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 28..139
e-value: 9.7E-19
score: 69.4
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 231..341
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 668..777
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 35..128
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 568..667
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 143..228
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 460..559
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1041..1157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 795..815
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1035..1053
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 784..816
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1163..1194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1035..1065
NoneNo IPR availablePANTHERPTHR46227FAMILY NOT NAMEDcoord: 30..1171
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 143..227
e-value: 6.19239E-15
score: 69.1326
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 477..561
e-value: 1.57191E-5
score: 42.1687
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 579..662
e-value: 2.6215E-14
score: 67.2066
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1072..1154
e-value: 9.69678E-15
score: 68.3622
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 43..121
e-value: 6.20983E-19
score: 80.3034
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 242..328
e-value: 2.95991E-9
score: 52.9543
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 681..765
e-value: 2.86677E-15
score: 69.903