slc35b-3

Overview
Nameslc35b-3 (AKN21643.1)
Smed IDSMED30018508
Length (bp)1074
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35b-3 (SMED30018508) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35b-3 (SMED30018508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35b-3 (SMED30018508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35b-3 (SMED30018508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30018508SMESG000064878.1 SmedASXL_005456SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30018508SMESG000064878.1 dd_Smed_v4_7777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30018508SMESG000064878.1 dd_Smed_v4_7777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30018508SMESG000064878.1 dd_Smed_v4_7777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35b-3 vs. Ensembl Human
Match: SLC35B1 (solute carrier family 35 member B1 [Source:HGNC Symbol;Acc:HGNC:20798])

HSP 1 Score: 234.572 bits (597), Expect = 1.886e-74
Identity = 151/289 (52.25%), Postives = 195/289 (67.47%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARV-DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAK 318          
BLAST of slc35b-3 vs. Ensembl Human
Match: SLC35B1 (solute carrier family 35 member B1 [Source:HGNC Symbol;Acc:HGNC:20798])

HSP 1 Score: 234.187 bits (596), Expect = 7.539e-74
Identity = 151/289 (52.25%), Postives = 195/289 (67.47%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   69 QEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARV-DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAK 355          
BLAST of slc35b-3 vs. Ensembl Human
Match: SLC35B1 (solute carrier family 35 member B1 [Source:HGNC Symbol;Acc:HGNC:20798])

HSP 1 Score: 198.364 bits (503), Expect = 1.158e-61
Identity = 114/215 (53.02%), Postives = 146/215 (67.91%), Query Frame = 3
Query:  270 SRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMN 914
             R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++
Sbjct:   13 DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPIS 226          
BLAST of slc35b-3 vs. Ensembl Human
Match: SLC35B1 (solute carrier family 35 member B1 [Source:HGNC Symbol;Acc:HGNC:20798])

HSP 1 Score: 146.362 bits (368), Expect = 3.696e-41
Identity = 104/218 (47.71%), Postives = 139/218 (63.76%), Query Frame = 3
Query:  141 TKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSA 788
            T+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSA
Sbjct:   39 TRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARV-DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSA 254          
BLAST of slc35b-3 vs. Ensembl Human
Match: SLC35B1 (solute carrier family 35 member B1 [Source:HGNC Symbol;Acc:HGNC:20798])

HSP 1 Score: 130.568 bits (327), Expect = 6.139e-36
Identity = 92/186 (49.46%), Postives = 121/186 (65.05%), Query Frame = 3
Query:  132 EKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYL 683
            E  T+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L
Sbjct:    2 EPRTRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARV-DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLL 185          
BLAST of slc35b-3 vs. Ensembl Celegans
Match: hut-1 (Yeast Homolog UDP-Gal Transporter [Source:UniProtKB/TrEMBL;Acc:Q9BHL2])

HSP 1 Score: 186.422 bits (472), Expect = 5.008e-56
Identity = 121/287 (42.16%), Postives = 169/287 (58.89%), Query Frame = 3
Query:  129 QEKITKSKFGREND---KFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGK 980
            QE+I + K+   ++   KFT    LVF  C  N I AF+  K    E+    VP +++A  + +Y+ AM ASN +LQ++ YPTQVL KS KPIPVMI GVL+A KSY  RKY +V MI +GV +FL K+      +     GFGE+LL+ SLA DG T ++QD ++  Y      +M   NL+S +YL   +L++ E   F  F+ +HP +   + G  + S LGQ  IF +I  F PL  SIVTTTRK FTI+ SV+   +P++  Q + T +VF  L  D + GK
Sbjct:   42 QERIVQGKYELPDESIEKFTFTQALVFFLCTANTIYAFLIRK--KTEI--DNVPTKMYAASAASYLLAMVASNQALQYLPYPTQVLAKSCKPIPVMIFGVLFAHKSYHWRKYCYVLMIVVGVAMFLYKNKKGG--AEDKDFGFGELLLIFSLAMDGTTTSIQDRIKKSYQRTGTSMMFYTNLYSSLYLSAGLLVTGELWSFFYFVQRHPYVFWDLTGLAIASCLGQWCIFKTIEEFSPLTCSIVTTTRKLFTIIISVLFMNHPLSGRQILATTVVFSALTADVVDGK 322          
BLAST of slc35b-3 vs. Ensembl Celegans
Match: hut-1 (Yeast Homolog UDP-Gal Transporter [Source:UniProtKB/TrEMBL;Acc:Q9BHL2])

HSP 1 Score: 186.422 bits (472), Expect = 5.008e-56
Identity = 121/287 (42.16%), Postives = 169/287 (58.89%), Query Frame = 3
Query:  129 QEKITKSKFGREND---KFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGK 980
            QE+I + K+   ++   KFT    LVF  C  N I AF+  K    E+    VP +++A  + +Y+ AM ASN +LQ++ YPTQVL KS KPIPVMI GVL+A KSY  RKY +V MI +GV +FL K+      +     GFGE+LL+ SLA DG T ++QD ++  Y      +M   NL+S +YL   +L++ E   F  F+ +HP +   + G  + S LGQ  IF +I  F PL  SIVTTTRK FTI+ SV+   +P++  Q + T +VF  L  D + GK
Sbjct:   42 QERIVQGKYELPDESIEKFTFTQALVFFLCTANTIYAFLIRK--KTEI--DNVPTKMYAASAASYLLAMVASNQALQYLPYPTQVLAKSCKPIPVMIFGVLFAHKSYHWRKYCYVLMIVVGVAMFLYKNKKGG--AEDKDFGFGELLLIFSLAMDGTTTSIQDRIKKSYQRTGTSMMFYTNLYSSLYLSAGLLVTGELWSFFYFVQRHPYVFWDLTGLAIASCLGQWCIFKTIEEFSPLTCSIVTTTRKLFTIIISVLFMNHPLSGRQILATTVVFSALTADVVDGK 322          
BLAST of slc35b-3 vs. Ensembl Celegans
Match: pst-2 (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20787])

HSP 1 Score: 82.0333 bits (201), Expect = 3.493e-17
Identity = 65/241 (26.97%), Postives = 115/241 (47.72%), Query Frame = 3
Query:  267 KSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKE-FTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
            K  +P R++   +   +  M  SN S+ ++NYPTQV+ K  K IPV+I G+L   K Y     G   +++LG+++F + D       +S     G I++  +L  D + G +Q+    KY   + +++L       V++F  +++S E F+    F+    +   + +       LG   +   I  FG L+   VTT RK  TI+ S ++F  P   I+ +  G V +  +   +Y K +
Sbjct:   99 KRMIPWRIYGVIAFFTVATMGLSNASVGYLNYPTQVIFKCCKLIPVLIGGILIQGKRYGWIDIGAAMLMSLGIIMFTLADNKVSPNFDSR----GYIMICGALLADAVIGNIQEKNMKKYGGSSNEMVLYSYGIGSVFIFAFVVLSGEVFSAIPFFLENSWKTFGYALILSCLGYLGVNVVLTHIKVFGALVAVTVTTLRKALTIILSFMLFSKPFT-IEYVYAGSVVMLAIYLNLYSKNK 334          
BLAST of slc35b-3 vs. Ensembl Celegans
Match: pst-1 (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXJ9])

HSP 1 Score: 81.2629 bits (199), Expect = 1.001e-16
Identity = 76/288 (26.39%), Postives = 144/288 (50.00%), Query Frame = 3
Query:  129 QEKITKSKFGREN-----DKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGF-GEILLLISLAFDGITGAVQDDL-RTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFA--QFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLD 965
            QE+I    + R +     DKF     L+F   I+  +++ + +     +      P  + ++ S +   + +    +L++V++PTQ + K++K +  M++G L   + Y   +YG    I  G  LFL+   S    S  +   F G IL+   L FD  T   Q  L  TK  V  Y +M  +N +S +    A+ + ++ T+++  +F  +H +    V    L+ A+GQIFI+++I  FGP++ +++ T R+  +I+ S I++ + + F+  IG  +VF  + +D
Sbjct:  139 QERIITRGYRRSDQLEVEDKFGETQFLIFCNRIVALVLSLMILAKDWTKQPPHVPPLYVHSYTSFSNTISSWCQYEALKYVSFPTQTICKASKVVVTMLMGRLVRGQRYSWFEYGCGCTIAFGASLFLLSSSSKGAGSTITYTSFSGMILMAGYLLFDAFTLNWQKALFDTKPKVSKYQMMFGVNFFSAILC--AVSLIEQGTLWSSIKFGAEHVDFSRDVFLLSLSGAIGQIFIYSTIERFGPIVFAVIMTIRQMLSIVLSTIMYGHELTFLAAIGFMIVFAAIFVD 424          
BLAST of slc35b-3 vs. Ensembl Celegans
Match: pst-1 (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXJ9])

HSP 1 Score: 80.8777 bits (198), Expect = 1.102e-16
Identity = 76/288 (26.39%), Postives = 144/288 (50.00%), Query Frame = 3
Query:  129 QEKITKSKFGREN-----DKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGF-GEILLLISLAFDGITGAVQDDL-RTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFA--QFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLD 965
            QE+I    + R +     DKF     L+F   I+  +++ + +     +      P  + ++ S +   + +    +L++V++PTQ + K++K +  M++G L   + Y   +YG    I  G  LFL+   S    S  +   F G IL+   L FD  T   Q  L  TK  V  Y +M  +N +S +    A+ + ++ T+++  +F  +H +    V    L+ A+GQIFI+++I  FGP++ +++ T R+  +I+ S I++ + + F+  IG  +VF  + +D
Sbjct:  124 QERIITRGYRRSDQLEVEDKFGETQFLIFCNRIVALVLSLMILAKDWTKQPPHVPPLYVHSYTSFSNTISSWCQYEALKYVSFPTQTICKASKVVVTMLMGRLVRGQRYSWFEYGCGCTIAFGASLFLLSSSSKGAGSTITYTSFSGMILMAGYLLFDAFTLNWQKALFDTKPKVSKYQMMFGVNFFSAILC--AVSLIEQGTLWSSIKFGAEHVDFSRDVFLLSLSGAIGQIFIYSTIERFGPIVFAVIMTIRQMLSIVLSTIMYGHELTFLAAIGFMIVFAAIFVD 409          
BLAST of slc35b-3 vs. Ensembl Fly
Match: meigo (gene:FBgn0250820 transcript:FBtr0084017)

HSP 1 Score: 204.912 bits (520), Expect = 4.266e-63
Identity = 121/295 (41.02%), Postives = 177/295 (60.00%), Query Frame = 3
Query:  129 QEKITKSKFGRE-------NDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKL 992
            QEK+T+ ++G E        ++FT  L LV++QC+ N + A + + ++  +  +       +  CSLTY+ AM ++N +++ V YPT V+GKSAKPIPVMILGVL  +KSY   +Y  V  I LGV+LF+ K+     L   + +  GE+LL +SL+ DG+TGAVQ+ +R         +M  MN WS + L  A++ + E   F  F I+HPE  T +    +   LGQ FIF  + +FGPL  S+VTTTRKFFT+L SV++F N +   Q +G  LVF  L +D +YGK+  L
Sbjct:   27 QEKLTRGRYGEEVQTDGSVGERFTYALALVWVQCLCNYVFAKVLLTIRPQK--EDTTNAGSYVACSLTYLLAMVSTNMAMRWVPYPTAVVGKSAKPIPVMILGVLIGRKSYSWTRYACVLTIVLGVILFMYKEGKVSNLPAETTL-LGEVLLFLSLSMDGLTGAVQERIRAASAPSGQQMMRAMNFWSTLMLGVAMVFTGEAKEFMYFTIRHPEAWTHLSLIAVCGVLGQFFIFLMVASFGPLACSVVTTTRKFFTVLCSVLLFGNVLIARQWLGAVLVFAALFVDMLYGKKAPL 318          
BLAST of slc35b-3 vs. Ensembl Fly
Match: meigo (gene:FBgn0250820 transcript:FBtr0113259)

HSP 1 Score: 204.912 bits (520), Expect = 4.266e-63
Identity = 121/295 (41.02%), Postives = 177/295 (60.00%), Query Frame = 3
Query:  129 QEKITKSKFGRE-------NDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKL 992
            QEK+T+ ++G E        ++FT  L LV++QC+ N + A + + ++  +  +       +  CSLTY+ AM ++N +++ V YPT V+GKSAKPIPVMILGVL  +KSY   +Y  V  I LGV+LF+ K+     L   + +  GE+LL +SL+ DG+TGAVQ+ +R         +M  MN WS + L  A++ + E   F  F I+HPE  T +    +   LGQ FIF  + +FGPL  S+VTTTRKFFT+L SV++F N +   Q +G  LVF  L +D +YGK+  L
Sbjct:   27 QEKLTRGRYGEEVQTDGSVGERFTYALALVWVQCLCNYVFAKVLLTIRPQK--EDTTNAGSYVACSLTYLLAMVSTNMAMRWVPYPTAVVGKSAKPIPVMILGVLIGRKSYSWTRYACVLTIVLGVILFMYKEGKVSNLPAETTL-LGEVLLFLSLSMDGLTGAVQERIRAASAPSGQQMMRAMNFWSTLMLGVAMVFTGEAKEFMYFTIRHPEAWTHLSLIAVCGVLGQFFIFLMVASFGPLACSVVTTTRKFFTVLCSVLLFGNVLIARQWLGAVLVFAALFVDMLYGKKAPL 318          
BLAST of slc35b-3 vs. Ensembl Fly
Match: sll (gene:FBgn0038524 transcript:FBtr0083462)

HSP 1 Score: 109.768 bits (273), Expect = 2.285e-26
Identity = 85/289 (29.41%), Postives = 152/289 (52.60%), Query Frame = 3
Query:  129 QEKITKSK---FGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
            QEKI       F  E+ KF     LVF   ++  ++A   ++ Q + V + R P   +++ S + I + +    +L+ VN+PTQVL KS K IPVM++G + +K  Y   +Y    +I+LG++ F+     S K S  + +  G  LL + + FD  T   Q  L   Y +    +M  +NL+S ++   ++ +   F     F  +HP+ +  +V   + SA+GQ+FI+ +I  FGP++ +I+ T R+   I+ S  I+Q+ ++ +   G  +VF+ + L ++Y  +R
Sbjct:  163 QEKIMTQNYLNFTGESAKFKDSQFLVFSNRLLAFLVALAYLQWQPSPV-RHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYESYEYVTALLISLGMIFFMSGSSDSSKASGVTTLT-GIFLLSMYMVFDSFTANWQGSLFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDVFGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFL-RVYCTQR 448          
BLAST of slc35b-3 vs. Ensembl Fly
Match: sll (gene:FBgn0038524 transcript:FBtr0305308)

HSP 1 Score: 109.768 bits (273), Expect = 2.285e-26
Identity = 85/289 (29.41%), Postives = 152/289 (52.60%), Query Frame = 3
Query:  129 QEKITKSK---FGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
            QEKI       F  E+ KF     LVF   ++  ++A   ++ Q + V + R P   +++ S + I + +    +L+ VN+PTQVL KS K IPVM++G + +K  Y   +Y    +I+LG++ F+     S K S  + +  G  LL + + FD  T   Q  L   Y +    +M  +NL+S ++   ++ +   F     F  +HP+ +  +V   + SA+GQ+FI+ +I  FGP++ +I+ T R+   I+ S  I+Q+ ++ +   G  +VF+ + L ++Y  +R
Sbjct:  163 QEKIMTQNYLNFTGESAKFKDSQFLVFSNRLLAFLVALAYLQWQPSPV-RHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYESYEYVTALLISLGMIFFMSGSSDSSKASGVTTLT-GIFLLSMYMVFDSFTANWQGSLFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDVFGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFL-RVYCTQR 448          
BLAST of slc35b-3 vs. Ensembl Fly
Match: Papst2 (gene:FBgn0036695 transcript:FBtr0075279)

HSP 1 Score: 87.0409 bits (214), Expect = 1.032e-18
Identity = 74/249 (29.72%), Postives = 122/249 (49.00%), Query Frame = 3
Query:  252 NNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGL-VFLGLVLDQMYGKERKL 992
            N E     +P R +   +   +G M  SN SL ++NYPTQV+ K  K IPV++  +L   K Y L  +     + +G+  F + D  S    N +++G    ++  +L  D   G VQ+    ++   + +++        VYLF  +L++  F     F ++HP E   +   F L+  LG  F+ A + + G  + + VTT RK  TI  S ++F  P   +Q + +GL V LG+ L+ +Y K  KL
Sbjct:  126 NIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQGKRYGLLDFAAATCMCIGLAWFTLAD--SQMTPNFNLLGVA--MISGALLCDAAIGNVQEKAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFT-LQYLWSGLIVVLGIYLN-VYSKRNKL 368          
BLAST of slc35b-3 vs. Ensembl Zebrafish
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:447844])

HSP 1 Score: 228.024 bits (580), Expect = 5.182e-72
Identity = 146/289 (50.52%), Postives = 190/289 (65.74%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QE IT++ +    + +KF    TLVFIQCIINA  A + ++       +      L+  CSL+Y+GAM +SN +LQ+VNYPTQVLGKS KPIPVMILGV   +K YP+ KY  VF+I  GV LFL K       S+  V GFGE+LLL+SL  DG+TG VQD +R ++   A  +MLN+N+WS + L  A+L S E   F  F  ++P I+  ++ FG+TSALGQ FIF ++  FGPL  SIVTTTRKFFTIL SV++F N ++ +Q  GT LVFLGL LD  +GK  K
Sbjct:   38 QETITRADYTHAGKKEKFRYATTLVFIQCIINAAFARLLIQFFEGSK-QDHTRSWLYGLCSLSYLGAMVSSNSALQYVNYPTQVLGKSCKPIPVMILGVTILRKKYPMAKYLCVFLIVGGVALFLYKPNKGSSTSDEHVFGFGEMLLLLSLTLDGLTGVVQDHMRGRFQTGANHMMLNVNMWSTLVLGIAVLWSGEVWEFLAFTDRYPSIIYNILLFGITSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVLLFGNVISHMQWFGTILVFLGLGLDAKFGKSPK 325          
BLAST of slc35b-3 vs. Ensembl Zebrafish
Match: slc35b2 (solute carrier family 35 member B2 [Source:ZFIN;Acc:ZDB-GENE-050213-1])

HSP 1 Score: 124.405 bits (311), Expect = 1.279e-31
Identity = 80/238 (33.61%), Postives = 135/238 (56.72%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLIS-LAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
             P   ++F SL+ I + +    +L+ +++PTQVL K++K IPVM++G + ++KSY   +Y    +I+LGV +FL+   SS     S+V  F  +L+L   + FD  T   QD+L  KY + +  +M  +NL+S ++   ++L    F     F+ +H E     V   + SA GQ+FIF +I  FG  + +I+ T R+   IL S  ++ +P++   G+G G+VFL L L ++Y + R
Sbjct:  186 APMYKYSFASLSNILSSWCQYEALKFISFPTQVLAKASKVIPVMLMGKIVSRKSYEYWEYLTAVLISLGVSMFLLS--SSTDKHPSTVTTFSGVLILAGYIVFDSFTSNWQDNL-FKYKMSSVQMMFGVNLFSCLFTVGSLLEQGAFFNSLAFMTRHSEFAFHAVLLSVCSAFGQLFIFFTIAQFGAAVFTIIMTLRQALAILLSCFLYGHPVSLTGGLGVGVVFLALFL-RIYARSR 419          
BLAST of slc35b-3 vs. Ensembl Zebrafish
Match: slc35b2 (solute carrier family 35 member B2 [Source:ZFIN;Acc:ZDB-GENE-050213-1])

HSP 1 Score: 124.405 bits (311), Expect = 1.279e-31
Identity = 80/238 (33.61%), Postives = 135/238 (56.72%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLIS-LAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
             P   ++F SL+ I + +    +L+ +++PTQVL K++K IPVM++G + ++KSY   +Y    +I+LGV +FL+   SS     S+V  F  +L+L   + FD  T   QD+L  KY + +  +M  +NL+S ++   ++L    F     F+ +H E     V   + SA GQ+FIF +I  FG  + +I+ T R+   IL S  ++ +P++   G+G G+VFL L L ++Y + R
Sbjct:  186 APMYKYSFASLSNILSSWCQYEALKFISFPTQVLAKASKVIPVMLMGKIVSRKSYEYWEYLTAVLISLGVSMFLLS--SSTDKHPSTVTTFSGVLILAGYIVFDSFTSNWQDNL-FKYKMSSVQMMFGVNLFSCLFTVGSLLEQGAFFNSLAFMTRHSEFAFHAVLLSVCSAFGQLFIFFTIAQFGAAVFTIIMTLRQALAILLSCFLYGHPVSLTGGLGVGVVFLALFL-RIYARSR 419          
BLAST of slc35b-3 vs. Ensembl Zebrafish
Match: slc35b3 (solute carrier family 35 member B3 [Source:ZFIN;Acc:ZDB-GENE-060312-46])

HSP 1 Score: 93.5893 bits (231), Expect = 8.038e-21
Identity = 81/256 (31.64%), Postives = 119/256 (46.48%), Query Frame = 3
Query:  240 MKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAF--DGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 998
            ++LQ  +  + R+P + +   +   +G M  SN SL ++NYPTQV+ K  K IPVMI GV    K Y +        ++LG++ F + D  S    N +V G    +LLISLA   D   G VQ+     +N    +++L       VY+   +L          F  +HP     +   F LT   G  F+ A I  FG L+   VTT RK  TI+ S + F  P  F    G  LV  G+ L+     + K+K+
Sbjct:  114 VELQLTQDKRRRIPCKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMIGGVFIQGKRYNVADVSAALCMSLGLIWFTLAD--SKIAPNFNVTG----VLLISLALCADAAIGNVQEKAMKLHNGSNSEMVLYSYSIGFVYILLGLLSLGGLGPAVSFCAQHPMTTYGYAFLFSLTGYFGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFLFFSKPFTFQYVWGGLLVVFGIFLNVYSKNKDKMKL 363          
BLAST of slc35b-3 vs. Ensembl Zebrafish
Match: slc35b3 (solute carrier family 35 member B3 [Source:ZFIN;Acc:ZDB-GENE-060312-46])

HSP 1 Score: 93.2041 bits (230), Expect = 8.127e-21
Identity = 81/256 (31.64%), Postives = 119/256 (46.48%), Query Frame = 3
Query:  240 MKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAF--DGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 998
            ++LQ  +  + R+P + +   +   +G M  SN SL ++NYPTQV+ K  K IPVMI GV    K Y +        ++LG++ F + D  S    N +V G    +LLISLA   D   G VQ+     +N    +++L       VY+   +L          F  +HP     +   F LT   G  F+ A I  FG L+   VTT RK  TI+ S + F  P  F    G  LV  G+ L+     + K+K+
Sbjct:  101 VELQLTQDKRRRIPCKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMIGGVFIQGKRYNVADVSAALCMSLGLIWFTLAD--SKIAPNFNVTG----VLLISLALCADAAIGNVQEKAMKLHNGSNSEMVLYSYSIGFVYILLGLLSLGGLGPAVSFCAQHPMTTYGYAFLFSLTGYFGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFLFFSKPFTFQYVWGGLLVVFGIFLNVYSKNKDKMKL 350          
BLAST of slc35b-3 vs. Ensembl Xenopus
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:395058])

HSP 1 Score: 228.794 bits (582), Expect = 5.609e-72
Identity = 143/289 (49.48%), Postives = 193/289 (66.78%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QE IT+  +G   + +KF   L+LVF+QCI+NA+ A + ++  ++     R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I LGV LF+ K  ++    +    G+GE+LLL+SL  DG+TG  QD +R  +   +  +ML +NLWS ++L   I+ + E   F  F  ++P I+  ++ F LTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ IQ +GT LVFLGL LD  YGK  K
Sbjct:   51 QETITRGTYGEGEKQEKFRFALSLVFVQCIVNALFAKLLIQFFDSGKT-DRTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGYGELLLLLSLTLDGLTGVSQDHMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLGLGLDATYGKGSK 338          
BLAST of slc35b-3 vs. Ensembl Xenopus
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:395058])

HSP 1 Score: 216.853 bits (551), Expect = 1.099e-67
Identity = 136/277 (49.10%), Postives = 186/277 (67.15%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG 953
            QE IT+  +G   + +KF   L+LVF+QCI+NA+ A + ++  ++     R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I LGV LF+ K  ++    +    G+GE+LLL+SL  DG+TG  QD +R  +   +  +ML +NLWS ++L   I+ + E   F  F  ++P I+  ++ F LTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ IQ +GT LVFLG
Sbjct:   32 QETITRGTYGEGEKQEKFRFALSLVFVQCIVNALFAKLLIQFFDSGKTD-RTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGYGELLLLLSLTLDGLTGVSQDHMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLG 307          
BLAST of slc35b-3 vs. Ensembl Xenopus
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:395058])

HSP 1 Score: 216.853 bits (551), Expect = 1.250e-67
Identity = 136/277 (49.10%), Postives = 186/277 (67.15%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG 953
            QE IT+  +G   + +KF   L+LVF+QCI+NA+ A + ++  ++     R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I LGV LF+ K  ++    +    G+GE+LLL+SL  DG+TG  QD +R  +   +  +ML +NLWS ++L   I+ + E   F  F  ++P I+  ++ F LTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ IQ +GT LVFLG
Sbjct:   32 QETITRGTYGEGEKQEKFRFALSLVFVQCIVNALFAKLLIQFFDSGKTD-RTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGYGELLLLLSLTLDGLTGVSQDHMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLG 307          
BLAST of slc35b-3 vs. Ensembl Xenopus
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:395058])

HSP 1 Score: 216.853 bits (551), Expect = 1.323e-67
Identity = 136/277 (49.10%), Postives = 186/277 (67.15%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG 953
            QE IT+  +G   + +KF   L+LVF+QCI+NA+ A + ++  ++     R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I LGV LF+ K  ++    +    G+GE+LLL+SL  DG+TG  QD +R  +   +  +ML +NLWS ++L   I+ + E   F  F  ++P I+  ++ F LTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ IQ +GT LVFLG
Sbjct:   31 QETITRGTYGEGEKQEKFRFALSLVFVQCIVNALFAKLLIQFFDSGKTD-RTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGYGELLLLLSLTLDGLTGVSQDHMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLG 306          
BLAST of slc35b-3 vs. Ensembl Xenopus
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:395058])

HSP 1 Score: 216.853 bits (551), Expect = 1.396e-67
Identity = 136/277 (49.10%), Postives = 186/277 (67.15%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG 953
            QE IT+  +G   + +KF   L+LVF+QCI+NA+ A + ++  ++     R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I LGV LF+ K  ++    +    G+GE+LLL+SL  DG+TG  QD +R  +   +  +ML +NLWS ++L   I+ + E   F  F  ++P I+  ++ F LTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ IQ +GT LVFLG
Sbjct:   38 QETITRGTYGEGEKQEKFRFALSLVFVQCIVNALFAKLLIQFFDSGKTD-RTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPLSKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGYGELLLLLSLTLDGLTGVSQDHMRAHFQTGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVYFGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLG 313          
BLAST of slc35b-3 vs. Ensembl Mouse
Match: Slc35b1 (solute carrier family 35, member B1 [Source:MGI Symbol;Acc:MGI:1343133])

HSP 1 Score: 243.047 bits (619), Expect = 7.732e-78
Identity = 152/289 (52.60%), Postives = 194/289 (67.13%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V GFGE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS   L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARV-DRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GFGELLLLMSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTFLLGAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVFLGLGLDAKFGKGTK 318          
BLAST of slc35b-3 vs. Ensembl Mouse
Match: Slc35b2 (solute carrier family 35, member B2 [Source:MGI Symbol;Acc:MGI:1921086])

HSP 1 Score: 102.449 bits (254), Expect = 6.540e-24
Identity = 73/240 (30.42%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
             P   ++F SL+ + + +    +L+ V++PTQVL K++K IPVM++G L +++SY   +Y    +I++GV +FL+      + S ++ +  G +LL   +AFD  T   QD L   Y + +  +M  +NL+S ++   ++L        A+F+ +H E     +   + SA GQ+FIF +I  FG  + +I+ T R+   IL S +++ + +  + G+G  +VF  L+L ++Y + RK +
Sbjct:  132 APMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLS-GLVLLAGYIAFDSFTSNWQDAL-FAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLL-RVYARGRKQR 368          
BLAST of slc35b-3 vs. Ensembl Mouse
Match: Slc35b2 (solute carrier family 35, member B2 [Source:MGI Symbol;Acc:MGI:1921086])

HSP 1 Score: 102.449 bits (254), Expect = 6.540e-24
Identity = 73/240 (30.42%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
             P   ++F SL+ + + +    +L+ V++PTQVL K++K IPVM++G L +++SY   +Y    +I++GV +FL+      + S ++ +  G +LL   +AFD  T   QD L   Y + +  +M  +NL+S ++   ++L        A+F+ +H E     +   + SA GQ+FIF +I  FG  + +I+ T R+   IL S +++ + +  + G+G  +VF  L+L ++Y + RK +
Sbjct:  132 APMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLS-GLVLLAGYIAFDSFTSNWQDAL-FAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLL-RVYARGRKQR 368          
BLAST of slc35b-3 vs. Ensembl Mouse
Match: Slc35b2 (solute carrier family 35, member B2 [Source:MGI Symbol;Acc:MGI:1921086])

HSP 1 Score: 101.679 bits (252), Expect = 1.855e-23
Identity = 73/240 (30.42%), Postives = 135/240 (56.25%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
             P   ++F SL+ + + +    +L+ V++PTQVL K++K IPVM++G L +++SY   +Y    +I++GV +FL+      + S ++ +  G +LL   +AFD  T   QD L   Y + +  +M  +NL+S ++   ++L        A+F+ +H E     +   + SA GQ+FIF +I  FG  + +I+ T R+   IL S +++ + +  + G+G  +VF  L+L ++Y + RK +
Sbjct:  181 APMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLS-GLVLLAGYIAFDSFTSNWQDAL-FAYKMSSVQMMFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLL-RVYARGRKQR 417          
BLAST of slc35b-3 vs. Ensembl Mouse
Match: Slc35b1 (solute carrier family 35, member B1 [Source:MGI Symbol;Acc:MGI:1343133])

HSP 1 Score: 95.1301 bits (235), Expect = 3.187e-23
Identity = 46/72 (63.89%), Postives = 55/72 (76.39%), Query Frame = 3
Query:  288 LFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMK 503
            L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K
Sbjct:   76 LYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYK 147          
BLAST of slc35b-3 vs. UniProt/SwissProt
Match: sp|P97858|S35B1_MOUSE (Solute carrier family 35 member B1 OS=Mus musculus OX=10090 GN=Slc35b1 PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 5.409e-77
Identity = 152/289 (52.60%), Postives = 194/289 (67.13%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V GFGE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS   L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARV-DRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GFGELLLLMSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTFLLGAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVFLGLGLDAKFGKGTK 318          
BLAST of slc35b-3 vs. UniProt/SwissProt
Match: sp|Q6V7K3|S35B1_RAT (Solute carrier family 35 member B1 OS=Rattus norvegicus OX=10116 GN=Slc35b1 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.260e-75
Identity = 153/289 (52.94%), Postives = 195/289 (67.47%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V GFGE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS V L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAKILIQFFDTARV-DRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GFGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTVLLGAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVFLGLGLDAKFGKGTK 318          
BLAST of slc35b-3 vs. UniProt/SwissProt
Match: sp|Q8MII5|S35B1_BOVIN (Solute carrier family 35 member B1 OS=Bos taurus OX=9913 GN=SLC35B1 PE=2 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 8.767e-74
Identity = 149/289 (51.56%), Postives = 195/289 (67.47%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC++NA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YP+ KY  V +I  GV LF+ K      +   + IG+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGAKQETFTFALTLVFIQCVVNAVFAKILIQFFDTARV-DRTRSWLYAACSVSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPMAKYLCVLLIVAGVALFMYKPKKVVGIEEHT-IGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGAGILFTGELWEFLSFAERYPTIVYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAK 318          
BLAST of slc35b-3 vs. UniProt/SwissProt
Match: sp|Q8AWB6|S35B1_CHICK (Solute carrier family 35 member B1 OS=Gallus gallus OX=9031 GN=SLC35B1 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 8.802e-74
Identity = 148/289 (51.21%), Postives = 194/289 (67.13%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QE IT+ K+G     +KFT  L+LVFIQC+INA  A + ++  ++ V   R    L+A CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   +K YPL KY  V +I  GV LF+ K        +  + G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS ++L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   35 QESITRGKYGDGARQEKFTFALSLVFIQCVINAAFAKLLIRFFDS-VRADRTHSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTVLRKKYPLAKYLCVLLIVTGVALFMYKPKKGAG-GDDHIFGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNVNLWSTLFLGAGILFTGELWEFLSFTERYPSIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISTMQWVGTVLVFLGLGLDAKFGKGVK 321          
BLAST of slc35b-3 vs. UniProt/SwissProt
Match: sp|P78383|S35B1_HUMAN (Solute carrier family 35 member B1 OS=Homo sapiens OX=9606 GN=SLC35B1 PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 9.055e-74
Identity = 151/289 (52.25%), Postives = 195/289 (67.47%), Query Frame = 3
Query:  129 QEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT+ K+G   + + FT  LTLVFIQC+INA+ A I ++  +   V  R    L+A CS++Y+GAM +SN +LQ VNYPTQVLGKS KPIPVM+LGV   KK YPL KY  V +I  GV LF+ K      +   +V G+GE+LLL+SL  DG+TG  QD +R  Y   +  +MLN+NLWS + L   IL + E   F  F  ++P I+  ++ FGLTSALGQ FIF ++  FGPL  SI+TTTRKFFTILASVI+F NP++ +Q +GT LVFLGL LD  +GK  K
Sbjct:   32 QEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKILIQFFDTARV-DRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV-GYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAK 318          
BLAST of slc35b-3 vs. TrEMBL
Match: A0A0H3YKF4 (Slc35b-3 OS=Schmidtea mediterranea OX=79327 GN=slc35b-3 PE=2 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = 3
Query:   54 MEGTRKHLFGCSLXXXXXXXXXXXXQEKITKSKFGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 998
            MEGTRKHLFGCSLGIFFSYFFYGIIQEKITKSKFGRENDKFTCILTLVFIQCIINAIIAFIAMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV
Sbjct:    1 MEGTRKHLFGCSLGIFFSYFFYGIIQEKITKSKFGRENDKFTCILTLVFIQCIINAIIAFIAMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 315          
BLAST of slc35b-3 vs. TrEMBL
Match: I1ZIK0 (Solute carrier family 35 B1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 1.864e-122
Identity = 181/196 (92.35%), Postives = 182/196 (92.86%), Query Frame = 3
Query:  255 NEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQV--------------LGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQI 800
            NEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQV              LGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQ+
Sbjct:    1 NEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVKYFNFCYLIKFFKVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQV 196          
BLAST of slc35b-3 vs. TrEMBL
Match: K1QPG1 (Solute carrier family 35 member B1 OS=Crassostrea gigas OX=29159 GN=CGI_10026627 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 3.131e-94
Identity = 174/315 (55.24%), Postives = 223/315 (70.79%), Query Frame = 3
Query:   54 MEGTRKHLFGCSLXXXXXXXXXXXXQEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNS-SVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            M   R  L  C+ G F  YF+YGIIQE ITK K+G   + +KF   L LVF+QCIINA+ A IAM  Q     +   P  +F+ CSL+Y+GAM ASN++LQHV+YPTQVLGKSAKPIPVMILG+++A+K YP  K+ FV MI LGV +FL KD    K S++ S+IG GEILLL+SL  DG+TGAVQ+ +R+ +   A  +M N+N+WS+++    ++++ E   F  F+ +HP IL  +V FGL SA GQ FIF +++ FGPL  SI+TTTRKFFTIL SVIIFQNPMN  Q IGT LVF+GL LD  YGKE+K
Sbjct:   39 MTAGRNKLLICAAGTFICYFYYGIIQESITKGKYGEGEKAEKFKYTLALVFVQCIINALAAKIAMFWQKE---RDTTPGTMFSLCSLSYLGAMLASNHALQHVSYPTQVLGKSAKPIPVMILGIIFARKRYPWAKFLFVLMIVLGVAMFLYKDSGQSKKSDTDSLIGMGEILLLVSLTLDGVTGAVQERMRSDHKTGANSMMFNINVWSILWSAIGLVVTGEGIAFLGFMERHPSILAKMVTFGLASAAGQTFIFITVSTFGPLTCSIITTTRKFFTILGSVIIFQNPMNSRQWIGTVLVFMGLGLDSAYGKEKK 350          
BLAST of slc35b-3 vs. TrEMBL
Match: V3ZR80 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_128290 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.206e-92
Identity = 171/314 (54.46%), Postives = 223/314 (71.02%), Query Frame = 3
Query:   60 GTRKHLFGCSLXXXXXXXXXXXXQEKITKSKFGR--ENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
            G  K L  C++GIF  YF+YGI+QEKITK K+G   E +KF   L+LVF+QCI+N + A++  K    +V     P + +  CSLTY+GAM ASN++LQHV+YPTQVLGK+ KPIPVMILGVL A+K YPL KY FV MI LGV LF+ KD  + K S+   IG GE LLL+SL  DG+TGA QD +R++Y+ + Y +M  +NL+S+++LF  ++++ E  +F  F  + P +   ++ F L SALGQIFIF ++T FGPL  SIVTTTRKFFTIL SV+IFQNPM   Q IGT LVF+GL  D +YGKE+K K
Sbjct:    2 GVNKKLIVCAIGIFVCYFYYGILQEKITKGKYGEGEEREKFVYTLSLVFVQCIVNVLAAYLGTKYMQKKV--DATPTKYYIACSLTYLGAMLASNHALQHVSYPTQVLGKTIKPIPVMILGVLIARKRYPLVKYLFVLMIVLGVALFMYKDDKAAK-SDKHEIGIGEFLLLVSLTLDGLTGASQDKMRSEYSTQGYSMMFFVNLFSILWLFIGLIVTGEGLLFLSFSTRFPVVWFNLLSFSLASALGQIFIFTTVTTFGPLTCSIVTTTRKFFTILTSVLIFQNPMGGKQWIGTVLVFIGLGFDSVYGKEKKKK 312          
BLAST of slc35b-3 vs. TrEMBL
Match: A0A0L8GI39 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033077mg PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 9.428e-92
Identity = 175/312 (56.09%), Postives = 220/312 (70.51%), Query Frame = 3
Query:   66 RKHLFGCSLXXXXXXXXXXXXQEKITKSKFGR-EN-DKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
            ++ LF CSLGI   YFFYGI+QEKITK K+G  EN +KFT  L LVFIQCIIN + + ++M + ++   K   PK L+A CSLTY+ AM ASN+SLQHVNYPTQVLGKS KPIPVMILGVL A+K YP  KY  V +I  GV LFL KD S  + S     G GEILLLISL  DG+TGA+QD +R K    A+++M  MN +S+++L   ++ + E   F  F  +HP +L  +  FG+ SALGQ FIF +++ FGPL  SI+TTTRKFFTIL SVIIFQNP++  Q IGT +VF GL LD +YGK++K K
Sbjct:   36 KRMLFFCSLGILVCYFFYGILQEKITKGKYGEGENQEKFTYTLALVFIQCIINVVASKLSMSVFHSP--KDSTPKILYALCSLTYLLAMLASNHSLQHVNYPTQVLGKSVKPIPVMILGVLLARKRYPAAKYLCVLLIVTGVALFLYKD-SKAEDSKPHAFGMGEILLLISLTMDGLTGAIQDRMRAKAPTNAHNMMFFMNAFSVLWLLFGLIFTGEGIEFVSFTSRHPSVLLGIFAFGIASALGQTFIFLTVSKFGPLTCSILTTTRKFFTILTSVIIFQNPLSQRQWIGTIMVFTGLTLDNIYGKQQKQK 344          
BLAST of slc35b-3 vs. Ensembl Cavefish
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:447844])

HSP 1 Score: 159.844 bits (403), Expect = 2.757e-47
Identity = 96/195 (49.23%), Postives = 128/195 (65.64%), Query Frame = 3
Query:  405 MILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            MILGV   +K YP+ KY  V +I  GV LFL K       S+  + GFGE+LLL+SL  DG+TG  QD +R ++   A  +MLN+NLWS ++L  A+L + E   F  F  ++P ++  ++ FG+TSALGQ FIF ++  FGPL  SIVTTTRKFFTIL SV++F N ++ +Q  GT LVFLGL LD  +GK  K
Sbjct:    1 MILGVTILRKKYPMAKYLCVLLIVTGVALFLYKPNKGSTTSDEHIFGFGEMLLLLSLTLDGLTGVAQDHMRARFQTGANHMMLNVNLWSTLFLGSAVLWTGEVWEFLSFADRYPSVIYNIMLFGITSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVLLFGNVISPVQWFGTILVFLGLGLDAKFGKAPK 195          
BLAST of slc35b-3 vs. Ensembl Cavefish
Match: slc35b2 (solute carrier family 35 member B2 [Source:NCBI gene;Acc:103047832])

HSP 1 Score: 119.783 bits (299), Expect = 4.968e-30
Identity = 75/243 (30.86%), Postives = 134/243 (55.14%), Query Frame = 3
Query:  267 KSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLK 995
            +   P   +++ SL+ I + +    +L+++++PTQVL K++K IPVM++G L + KSY   +Y    +I++GV +FL+   ++   S  +    G I+L   + FD  T   QD+L  KY + +  +M  +NL+S ++   ++L    F     F+ +H E     +   + SA GQ+FIF +I  FG  + +I+ T R+   IL S  ++ + + F+ G+G  +VFL L L ++Y + R  K
Sbjct:  183 RHAAPMYKYSYASLSNILSSWCQYEALKYISFPTQVLAKASKVIPVMLMGKLVSHKSYEYWEYFTAVLISVGVSMFLLSSHTNKHPSTVTTFS-GVIILAGYIVFDSFTSNWQDNL-FKYKMSSVQMMFGVNLFSCLFTVGSLLEQGAFFESLAFMSRHSEFAFHAILLSICSACGQLFIFYTIAQFGAAVFTIIMTLRQAIAILLSCFLYGHAVTFVGGLGVAVVFLALFL-RVYARSRMKK 422          
BLAST of slc35b-3 vs. Ensembl Cavefish
Match: slc35b3 (solute carrier family 35 member B3 [Source:ZFIN;Acc:ZDB-GENE-060312-46])

HSP 1 Score: 92.8189 bits (229), Expect = 1.247e-20
Identity = 82/258 (31.78%), Postives = 122/258 (47.29%), Query Frame = 3
Query:  240 MKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER-KLKV*CF 1007
            ++LQ  +  + R+P + +   +   +G M  SN SL ++NYPTQV+ K  K IPVMI GV    K Y +        ++LG++ F + D  S    N +V G   IL+ ++L  D   G VQ+     +N    +++L       VY+   +L          F  +HP     +   F LT   G  F+ A I  FG L+   VTT RK  TI+ S + F  P  F    G  LV  G+ L+ +Y K R K+K+  F
Sbjct:  117 VELQLTQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMIGGVFIQGKRYNIADVSAALCMSLGLIWFTLAD--SKVAPNFNVTGV--ILISLALCADAAIGNVQEKAMKLHNGSNSEMVLYSYSIGFVYILLGLLCIGGLGPAVAFCAQHPVTTYGYAFFFSLTGYFGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFLFFTKPFTFQYIWGGLLVVFGIFLN-VYSKNRDKMKLPSF 369          
BLAST of slc35b-3 vs. Ensembl Cavefish
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 50.0618 bits (118), Expect = 1.544e-6
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 3
Query:  333 SNYSLQ-HVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLM---KDFSSFKLSNSS--VIGF-----GEILLLISLAFDGITGAVQDDLRTKYNVRAYD-------------LMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFG-PLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVL 962
            +NY+L  ++  P  ++ +S   I  MILG++  KK Y   KY  + ++++G+ +  +   K  S+ K S     V  F     G  +L  +L      G  Q+ L  +Y   + +             L+L+ N+++      A+  S+   V    I +H  ++ WV             +   IT  G   M   + T RKF +++ S++ FQNP      +GT +VFLG +L
Sbjct:   80 NNYALNFNIAMPLHMIFRSGSLIANMILGIIILKKRYSASKYLSIVLVSIGIFICTIMSAKQVSAQKGSTDEDGVYTFLQWLVGICMLTFALLMSARMGIFQETLYKQYGKHSKEALFYNHCLPLPGFLLLSTNIYN-----HAVFFSQSTPVEIPLIGQHVPVM-WVY-----------LLMNVITQCGVTFMHLWILTLRKFLSLIISILYFQNPFTVWHWVGTAVVFLGTLL 297          
BLAST of slc35b-3 vs. Ensembl Sea Lamprey
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:447844])

HSP 1 Score: 241.506 bits (615), Expect = 6.443e-78
Identity = 135/290 (46.55%), Postives = 191/290 (65.86%), Query Frame = 3
Query:  141 TKSKFGREN--DKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFL-----MKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            T+ ++G  +  ++F   ++LVF+QC+I+A+ A + M          R    L A C+++Y+GAM +SN +LQ+VNYPTQVLGKS KPIPVMILGVL A+K YPL KY  V +I +GV +FL                   +G+GEILLL+SL  DG+TG  QD +++++   ++ +M N+NLWS + L   +L++ E   F  F  +HP IL  ++ F +TSALGQ FIF ++ +FGPL  SI+TTTRKFFTILASV++F NPM+  Q +GT LVF+GL +D +YGK  K
Sbjct:   42 TRGQYGSGDVEERFRFAMSLVFVQCVISALFAKLVMTYVTRPA-PDRTAGWLSAACAVSYLGAMVSSNSALQYVNYPTQVLGKSCKPIPVMILGVLLARKRYPLIKYLCVLLIVVGVAMFLYKGKGGAKGGDGGGPEQGYLGYGEILLLVSLTLDGLTGVTQDKMKSRHQTGSHHMMFNVNLWSSLLLGVGVLVTGEIFEFVSFTERHPAILYKILLFSITSALGQNFIFMTVVSFGPLTCSIITTTRKFFTILASVLLFSNPMSSFQWVGTVLVFMGLGMDSLYGKVPK 330          
BLAST of slc35b-3 vs. Ensembl Sea Lamprey
Match: slc35b2 (solute carrier family 35 member B2 [Source:ZFIN;Acc:ZDB-GENE-050213-1])

HSP 1 Score: 104.76 bits (260), Expect = 2.086e-25
Identity = 66/212 (31.13%), Postives = 117/212 (55.19%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPM 911
             P   ++FCS++ I + +    +L+ V++PTQVL K++K IPVM++G L + K+Y   +Y    +I++GV +FL+   S  K S++     G ++L   + FD  T   QD L  KY + +  +M  +NL+S +    ++L          F+ +H +     +   + SA GQ+FIF +I +FG  + +++ TTR+   IL S +I+ + M
Sbjct:  180 APMYKYSFCSMSNILSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSHKTYEHWEYLTAGLISVGVSMFLLSSNSEEKHSSTVTTFSGLVILAGYILFDSFTSNWQDAL-FKYRMSSVQMMFGVNLFSCLLTTCSLLEQGALLEGLSFMSRHSDFALHALLLSMCSASGQLFIFYTINHFGAAIFTLIMTTRQALAILLSCLIYGHHM 390          
BLAST of slc35b-3 vs. Ensembl Sea Lamprey
Match: slc35b3 (solute carrier family 35 member B3 [Source:ZFIN;Acc:ZDB-GENE-060312-46])

HSP 1 Score: 102.834 bits (255), Expect = 5.748e-25
Identity = 77/243 (31.69%), Postives = 124/243 (51.03%), Query Frame = 3
Query:  240 MKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLD 965
            +K+++N+  + R+P R +   +   +  M  SN SL ++NYPTQV+ K  K +PVMI GVL   K Y L     V  ++LG++ F + D  S  + N ++ G    L+L++L  D   G VQ+    +++    +++L       VYLF  I +S  F+    F  +HP +   + + F ++  LG  F+ A I  FG L+   VTT RK  TI+ S + F  P          +V LG+ L+
Sbjct:   96 LKIKSNK--QRRIPLRTYFMIAFLTVATMGLSNTSLGYLNYPTQVIFKCCKLVPVMIGGVLIQGKRYTLVDVCAVICMSLGLIWFTLAD--SKVVPNFNITGVA--LILLALCADAAIGNVQEKAMKEFSSSNSEMVLYSYSIGFVYLFFGIGLSGSFSTAFTFCYQHPFQTYGYALIFSISGYLGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFMFFSKPFTIHYVFAGAVVVLGIFLN 332          
BLAST of slc35b-3 vs. Ensembl Sea Lamprey
Match: slc35b4 (solute carrier family 35 member B4 [Source:NCBI gene;Acc:323737])

HSP 1 Score: 55.0694 bits (131), Expect = 7.910e-9
Identity = 60/254 (23.62%), Postives = 115/254 (45.28%), Query Frame = 3
Query:  267 KSRVPKRLFAFCSLTYIGAMFASNYSLQ-HVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLF-------LMKDFSSFKLSN-----SSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYD-LMLNMNLWSLVYLFPAILISKEFTVFAQ--------FIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVL 962
            K  +P R +    + +      +NY+L  ++  P  ++ +S   I  M+LG++  KK Y L KY  + +++LG+ +        +  D+++ K        + +IG G  +L  +L      G  Q++L  ++     + L  N  L    +L  A  I  +  +F+Q          +  PE+   ++   +T  +    +F   T    L  ++V T RKF +++ S++IF+N       +GTG+ FLG +L
Sbjct:   78 KPVIPIRHYTVMVIMFFAVSVLNNYALNFNIAMPLHMIFRSGSLIANMVLGIIILKKRYTLPKYLSIVLVSLGIFICTFMSAKQVASDYNAAKDDGVYAIITWLIGIG--MLTFALFMSARMGIFQEELYARFGKHPREALFYNHALPLPGFLLLAKDIYNQGVLFSQSAPVALPWLDLAVPEMWLMLLVNIITQYVCIRAVFVLTTECASLTVTLVVTLRKFISLILSILIFKNAFTTWHWLGTGVTFLGTLL 329          
BLAST of slc35b-3 vs. Ensembl Yeast
Match: HUT1 (Protein with a role in UDP-galactose transport to the Golgi lumen; has similarity to human UDP-galactose transporter UGTrel1, exhibits a genetic interaction with S. cerevisiae ERO1 [Source:SGD;Acc:S000006165])

HSP 1 Score: 91.2781 bits (225), Expect = 3.030e-21
Identity = 67/238 (28.15%), Postives = 118/238 (49.58%), Query Frame = 3
Query:  342 SLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNS--------SVIGFGEILLLISLAFDGITGAVQDDLRTKYNVR---------AYDLMLNMNL----WSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKL 992
            SL+HV+Y T +L KS K IPV+++ +L  +     +K     +++LGV +F +      KL  S         + GFG  LL  SL  DG+T A QD L      +            LM  +NL    W+++Y    ++  K++      +   P++  +++ +    A+GQ FIF ++  FG L+  ++T TRK  +++ S+I+F   + F Q +G  +VF G+  + +  K+  +
Sbjct:  100 SLKHVDYLTYMLAKSCKMIPVLLVHLLLYRTPIASQKKVVALLVSLGVTIFTIGGNDGKKLKRSFNESGNDNKLQGFG--LLFSSLFLDGLTNATQDKLLKANKAKEKGKQTLITGAHLMFTLNLFVILWNILYFI--VIDCKQWDNAVSVLTMDPQVWGYLMLYSFCGAMGQCFIFYTLEQFGSLVLIMITVTRKMVSMILSIIVFGKSVRFQQWVGMFIVFGGITWEALNKKKANI 333          
BLAST of slc35b-3 vs. Ensembl Nematostella
Match: EDO49094 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI55])

HSP 1 Score: 224.557 bits (571), Expect = 1.540e-71
Identity = 135/291 (46.39%), Postives = 187/291 (64.26%), Query Frame = 3
Query:  129 QEKITKSKFGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQ-NNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNS---SVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QEKIT++K+G E + FT  L LVF+QCI+NA+ A + +K   + +  K   P   +  C+ TY+GAM A                KS KPIPVMILGVL+A+K YPL KY  VF+I +GV LF+ KD    K SN+   S+ GFGEILL++SL FDG+TGAVQD +R +++V+++ +M NMNLWS+  +   ++ + E   FA F  K P ++  V+ F   SA+GQ FIF ++ NFGPL  SIVTTTRKFFTIL SV++F + ++  Q +G   VF+GL  D +  K +K
Sbjct:   30 QEKITRTKYGEEKEPFTYALCLVFVQCIVNALFAKLVIKFTYDKKEAKDSTPFLWYGACAATYLGAMLAR---------------KSCKPIPVMILGVLFARKRYPLIKYLCVFLIVIGVALFMYKD--KPKTSNTEEHSLFGFGEILLIVSLTFDGLTGAVQDRMRAEHHVQSHFMMFNMNLWSIGIMGLTVITTGELFRFAVFCEKFPFVMANVLTFSCASAVGQNFIFMTVANFGPLACSIVTTTRKFFTILGSVLLFGHALSIRQWVGVVCVFVGLGADSILSKSKK 303          
BLAST of slc35b-3 vs. Ensembl Nematostella
Match: EDO46818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX8])

HSP 1 Score: 130.568 bits (327), Expect = 8.552e-35
Identity = 80/240 (33.33%), Postives = 138/240 (57.50%), Query Frame = 3
Query:  267 KSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
            + R P   +++ S + I + +    +L+ V++PTQVL K++K IPVM++G L +KKSYP  +Y    ++++GV LFL+   +  K +  + +  G ++LL  + FD  T   Q +L   Y + +  +M   NL+S ++ F ++L + +      F I HPE     V   L SA GQ+FIF +I +FGP++ +I+ TTR   +I+ S I++Q+P++     G  +VF  L L ++Y + R
Sbjct:  129 QHRAPLYKYSYSSFSNIMSSWCQYEALKFVSFPTQVLCKASKIIPVMLMGKLVSKKSYPYYEYFIAVVLSVGVSLFLLSTGTQKKTAVETTVS-GALILLGYMLFDSFTSNWQSELFHSYKMSSMQMMFGTNLFSSIFTFWSLLQNGKLFSSVIFAIDHPEFAYHSVILSLCSATGQLFIFYTIQSFGPVVFTIIMTTRLMLSIVISCILYQHPLSTQAVFGVIVVFTALFL-RVYARYR 366          
BLAST of slc35b-3 vs. Ensembl Nematostella
Match: EDO32018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWA3])

HSP 1 Score: 88.5817 bits (218), Expect = 5.163e-20
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 3
Query:  267 KSR-VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLD 965
            KSR +P + +A  +L  +  M  SN SL ++NYPTQV+ KS K IPVM+ G++   K Y +  +     ++LG++LF + D       N +    G + + ++L  D + G VQ+     Y     +++L       VY+   + +S       QF  +HP ++      F ++  LG  F+   +  FG LM   VTT RK  T++ S + F  P          +VF G+ L+
Sbjct:   63 KSRKIPLKTYAGLALLTVSTMGLSNSSLGYLNYPTQVIFKSCKLIPVMVGGIIIQGKRYGIIDFVACLFMSLGLILFTLADSKVQPEFNHT----GVVFISLALCADAVIGNVQEKTMKAYRSTNTEVVLYSYGIGFVYILVGLTVSGSLLDAFQFCAQHPVQVYGLAFLFSISGYLGITFVLMLVRLFGALMAVTVTTFRKAVTMVLSFLFFTKPFTTQYLWSAFIVFFGIFLN 293          
BLAST of slc35b-3 vs. Ensembl Nematostella
Match: EDO45391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT41])

HSP 1 Score: 62.003 bits (149), Expect = 6.709e-11
Identity = 58/244 (23.77%), Postives = 114/244 (46.72%), Query Frame = 3
Query:  333 SNYSLQ-HVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSS-------VIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYD-------------LMLNMNLWSLVYLFPAILISKEFTVFAQ--FIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG-LVLDQMYGKERKL 992
            +NY+   ++  P  ++ ++   +  +ILGV+   +SYP+ KY  V M+T G+ +  +      ++ +++        +  G  +L+ +L      G  Q+ L T Y     +             L+L  +L+  V +F A   S+ F +F    FI   P++  + +G  +T  +    ++   +    L  ++V T RKF ++L S+  F+NP      IGT LVF G L+  +++ K +++
Sbjct:   80 NNYAFNFNIPVPLHMIFRAGSLVANLILGVIVLNRSYPVSKYLSVLMVTCGISICTIVSAHRVEVHHTADTDHDFFWLCVGIAMLITALLLSARMGIYQEQLYTTYGKHPKEALFYAHALPLPGFLLLAKDLYRHVIIFNA---SEPFILFGTSLFI---PKLWLYTLGNMVTQYVCIRSVYILTSECTSLTVTLVVTLRKFLSLLVSIFYFRNPFTVYHWIGTALVFSGTLIFVEIFSKIKQV 317          
BLAST of slc35b-3 vs. Ensembl Medaka
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:101154867])

HSP 1 Score: 249.595 bits (636), Expect = 1.687e-80
Identity = 155/288 (53.82%), Postives = 189/288 (65.62%), Query Frame = 3
Query:  129 QEKITKSKFGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKR-LFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QE IT+  +G E  KF    TLVFIQCIINA+ A   + +Q  E  K    K  L+  CSL+Y+GAM +SN +LQ VNYPTQVLGKS KPIPVMILGV   +K YPL KY  V +I  GV LFL K   S    +  + GFGEILLL+SL  DG+TG  QD +R ++   A  +MLN+N+WS + L  A+L + E   F  F  +HP I   ++ FGLTSALGQ FIF ++  FGPL  SIVTTTRKFFTIL SVI+F N M+ +Q IGT LVFLGL LD  +GK  K
Sbjct:   39 QETITRGDYGHE--KFRYARTLVFIQCIINAVFAR--ILIQVFEGSKPDPTKSWLYGLCSLSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMILGVTILRKRYPLAKYLCVLLIVTGVALFLYKPNKSTAAVDDHIFGFGEILLLVSLTLDGLTGVAQDHMRARFQTGANHMMLNINVWSTLILGFAVLWTGEVWDFLSFAERHPTIFYNILLFGLTSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVILFGNVMSSMQWIGTVLVFLGLGLDAKFGKTPK 322          
BLAST of slc35b-3 vs. Ensembl Medaka
Match: slc35b1 (solute carrier family 35 member B1 [Source:NCBI gene;Acc:101154867])

HSP 1 Score: 226.483 bits (576), Expect = 1.640e-71
Identity = 147/288 (51.04%), Postives = 183/288 (63.54%), Query Frame = 3
Query:  129 QEKITKSKFGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKR-LFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            QE IT+  +G E  KF    TLVFIQCIINA+ A   + +Q  E  K    K  L+  CSL+Y+GAM +SN +LQ VNYPTQV    +  + VMILGV   +K YPL KY  V +I  GV LFL K   S    +  + GFGEILLL+SL  DG+TG  QD +R ++   A  +MLN+N+WS + L  A+L + E   F  F  +HP I   ++ FGLTSALGQ FIF ++  FGPL  SIVTTTRKFFTIL SVI+F N M+ +Q IGT LVFLGL LD  +GK  K
Sbjct:   39 QETITRGDYGHE--KFRYARTLVFIQCIINAVFAR--ILIQVFEGSKPDPTKSWLYGLCSLSYVGAMVSSNSALQFVNYPTQVSFFLSCLVTVMILGVTILRKRYPLAKYLCVLLIVTGVALFLYKPNKSTAAVDDHIFGFGEILLLVSLTLDGLTGVAQDHMRARFQTGANHMMLNINVWSTLILGFAVLWTGEVWDFLSFAERHPTIFYNILLFGLTSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVILFGNVMSSMQWIGTVLVFLGLGLDAKFGKTPK 322          
BLAST of slc35b-3 vs. Ensembl Medaka
Match: slc35b2 (solute carrier family 35 member B2 [Source:NCBI gene;Acc:101166179])

HSP 1 Score: 105.145 bits (261), Expect = 9.199e-25
Identity = 75/241 (31.12%), Postives = 136/241 (56.43%), Query Frame = 3
Query:  267 KSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLIS-LAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
            +   P   ++F SL+ I + +    +L+ +++PTQVL K++K IPVM++G + ++K+Y   +Y    +I++GV +FL+   SS     S+V  F  +++L+  + FD  T   QD+L  KY + +  +M  +N++S ++   ++L    F     F+++H E     V   + SA GQ+FIF +I  FG  + +I+ T R+ F IL S  ++ + +  + G G  +VFL L L ++Y + R
Sbjct:  176 RHGAPMYKYSFASLSNIMSSWCQYEALKFISFPTQVLAKASKVIPVMLMGKIVSQKNYEYWEYLTALLISVGVSMFLLS--SSEDKHPSTVTTFSGVIILVGYIVFDSFTSNWQDNL-FKYKMSSVQMMFGVNMFSCLFTVGSLLEQGAFFDSLAFMMRHSEFAFHAVLLSVCSACGQLFIFYTINQFGAAVFTIIMTLRQAFAILLSCFLYGHAVTVVGGFGVAVVFLALFL-RVYARSR 412          
BLAST of slc35b-3 vs. Ensembl Medaka
Match: slc35b2 (solute carrier family 35 member B2 [Source:NCBI gene;Acc:101166179])

HSP 1 Score: 105.145 bits (261), Expect = 9.352e-25
Identity = 75/238 (31.51%), Postives = 135/238 (56.72%), Query Frame = 3
Query:  276 VPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLIS-LAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKER 986
             P   ++F SL+ I + +    +L+ +++PTQVL K++K IPVM++G + ++K+Y   +Y    +I++GV +FL+   SS     S+V  F  +++L+  + FD  T   QD+L  KY + +  +M  +N++S ++   ++L    F     F+++H E     V   + SA GQ+FIF +I  FG  + +I+ T R+ F IL S  ++ + +  + G G  +VFL L L ++Y + R
Sbjct:  185 APMYKYSFASLSNIMSSWCQYEALKFISFPTQVLAKASKVIPVMLMGKIVSQKNYEYWEYLTALLISVGVSMFLLS--SSEDKHPSTVTTFSGVIILVGYIVFDSFTSNWQDNL-FKYKMSSVQMMFGVNMFSCLFTVGSLLEQGAFFDSLAFMMRHSEFAFHAVLLSVCSACGQLFIFYTINQFGAAVFTIIMTLRQAFAILLSCFLYGHAVTVVGGFGVAVVFLALFL-RVYARSR 418          
BLAST of slc35b-3 vs. Ensembl Medaka
Match: slc35b3 (solute carrier family 35 member B3 [Source:NCBI gene;Acc:101160943])

HSP 1 Score: 96.2857 bits (238), Expect = 5.929e-22
Identity = 74/257 (28.79%), Postives = 120/257 (46.69%), Query Frame = 3
Query:  240 MKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFS---SFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 998
            ++LQ  +  + R+P + +   +   +G M  SN SL ++NYPTQV+ K  K IPVMI G+    K Y          ++LG++ F + D +   +F L+       G +L+ ++L  D + G VQ+     +N    +++L       +Y+   +L          F  +HP +   +   F LT   G  F+ A I  FG L+   VTT RK  TI+ S + F  P  F    G  LV  G+ L+     + K+K+
Sbjct:  102 IELQLTQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMIGGIFIQGKRYNFADVAAAVCMSLGLIWFTLADSTVAPNFHLT-------GVLLISLALCADAVIGNVQEKAMKIHNGSNSEMVLYSYSIGFIYILAGLLCVGGLGPAVAFCSEHPVKTYGYAFFFSLTGYFGISFVLALIKLFGALVAVTVTTGRKAMTIVLSFMFFSKPFTFQYIWGGLLVLFGIFLNVYSKNKDKMKL 351          
BLAST of slc35b-3 vs. Planmine SMEST
Match: SMESG000064878.1 (SMESG000064878.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = 3
Query:   54 MEGTRKHLFGCSLXXXXXXXXXXXXQEKITKSKFGRENDKFTCILTLVFXXXXXXXXXXXXXMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 998
            MEGTRKHLFGCSLGIFFSYFFYGIIQEKITKSKFGRENDKFTCILTLVFIQCIINAIIAFIAMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV
Sbjct:    1 MEGTRKHLFGCSLGIFFSYFFYGIIQEKITKSKFGRENDKFTCILTLVFIQCIINAIIAFIAMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERKLKV 315          
BLAST of slc35b-3 vs. Planmine SMEST
Match: SMESG000049708.1 (SMESG000049708.1)

HSP 1 Score: 101.293 bits (251), Expect = 1.158e-23
Identity = 71/232 (30.60%), Postives = 129/232 (55.60%), Query Frame = 3
Query:  291 FAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGF------GEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQ--FIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVL 962
            +++ SL+ I + +    +L++V++P Q+L K++K IPVM++G L  K++Y L ++    +I++GV  FL+   S    SN+S          G ILL+  + FD  T   QD L   Y + ++ +M  +N+WS  +   +++  ++ T+F    F ++H + +   V   + SA GQ+FIF +I  FG ++  I+ T R+   IL S II+ + ++ +   G  ++FL L L
Sbjct:  176 YSYASLSNILSSWCQYEALKYVSFPVQILAKASKIIPVMLMGKLVKKQNYRLDEFIMAGVISIGVTFFLLDTNSRKSSSNNSQSVTSHSPISGMILLVCYMLFDSFTSNWQDSLFKVYKINSFQMMAGVNIWSCFFTVASLI--EQGTLFDSLGFGLRHWDFIEDAVILSVCSAFGQVFIFFTIQKFGAVVFIIIMTMRQAIAILLSCIIYGHSVHLLGVFGIFIIFLALFL 405          
BLAST of slc35b-3 vs. Planmine SMEST
Match: SMESG000049708.1 (SMESG000049708.1)

HSP 1 Score: 101.293 bits (251), Expect = 2.156e-23
Identity = 71/232 (30.60%), Postives = 129/232 (55.60%), Query Frame = 3
Query:  291 FAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGF------GEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQ--FIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVL 962
            +++ SL+ I + +    +L++V++P Q+L K++K IPVM++G L  K++Y L ++    +I++GV  FL+   S    SN+S          G ILL+  + FD  T   QD L   Y + ++ +M  +N+WS  +   +++  ++ T+F    F ++H + +   V   + SA GQ+FIF +I  FG ++  I+ T R+   IL S II+ + ++ +   G  ++FL L L
Sbjct:  251 YSYASLSNILSSWCQYEALKYVSFPVQILAKASKIIPVMLMGKLVKKQNYRLDEFIMAGVISIGVTFFLLDTNSRKSSSNNSQSVTSHSPISGMILLVCYMLFDSFTSNWQDSLFKVYKINSFQMMAGVNIWSCFFTVASLI--EQGTLFDSLGFGLRHWDFIEDAVILSVCSAFGQVFIFFTIQKFGAVVFIIIMTMRQAIAILLSCIIYGHSVHLLGVFGIFIIFLALFL 480          
BLAST of slc35b-3 vs. Planmine SMEST
Match: SMESG000049708.1 (SMESG000049708.1)

HSP 1 Score: 100.908 bits (250), Expect = 2.166e-23
Identity = 71/232 (30.60%), Postives = 129/232 (55.60%), Query Frame = 3
Query:  291 FAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFSSFKLSNSSVIGF------GEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQ--FIIKHPEILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVL 962
            +++ SL+ I + +    +L++V++P Q+L K++K IPVM++G L  K++Y L ++    +I++GV  FL+   S    SN+S          G ILL+  + FD  T   QD L   Y + ++ +M  +N+WS  +   +++  ++ T+F    F ++H + +   V   + SA GQ+FIF +I  FG ++  I+ T R+   IL S II+ + ++ +   G  ++FL L L
Sbjct:  210 YSYASLSNILSSWCQYEALKYVSFPVQILAKASKIIPVMLMGKLVKKQNYRLDEFIMAGVISIGVTFFLLDTNSRKSSSNNSQSVTSHSPISGMILLVCYMLFDSFTSNWQDSLFKVYKINSFQMMAGVNIWSCFFTVASLI--EQGTLFDSLGFGLRHWDFIEDAVILSVCSAFGQVFIFFTIQKFGAVVFIIIMTMRQAIAILLSCIIYGHSVHLLGVFGIFIIFLALFL 439          
BLAST of slc35b-3 vs. Planmine SMEST
Match: SMESG000064892.1 (SMESG000064892.1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.343e-19
Identity = 70/247 (28.34%), Postives = 117/247 (47.37%), Query Frame = 3
Query:  261 VVKSRVPKRLFAFCSLTYIGAMFASNYSLQHVNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMKDFS---SFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLMLNMNLWSLVYLFPAILISKEFTVFAQFIIKHP-EILTWVVGFGLTSALGQIFIFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLGLVLDQMYGKERK 989
            +    VP +++   +   +  M  SN S+ ++NYPTQV+ K  K IP MI GVL  + SY       V ++ +G++ F++ D S   +F L       +G +L+ ++L  DG  G VQ+    KY++   +++L      LV +   +++S +F    +     P       + F L+   G  F+   + NFG L    V+T RK  TI+ S + FQ P          +V LG+ L+ +Y K   
Sbjct:  100 ITHKEVPWKIYVLIAFLTVCTMGLSNSSVGYLNYPTQVIFKCCKLIPTMIGGVLIQRISYNKLDITSVLLMVVGLIWFILADTSVQPNFNL-------YGVLLISLALCADGAIGNVQEKTMKKYSLTTSEMVLYSYTIGLVMISLGLIVSGQFVPAFRICAVDPFRTYGMFIIFSLSGYFGIQFVLMLVKNFGALPAVTVSTCRKAVTIILSFLFFQKPYTMTYLYAGLVVLLGIYLN-LYSKNES 338          
The following BLAST results are available for this feature:
BLAST of slc35b-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC35B11.886e-7452.25solute carrier family 35 member B1 [Source:HGNC Sy... [more]
SLC35B17.539e-7452.25solute carrier family 35 member B1 [Source:HGNC Sy... [more]
SLC35B11.158e-6153.02solute carrier family 35 member B1 [Source:HGNC Sy... [more]
SLC35B13.696e-4147.71solute carrier family 35 member B1 [Source:HGNC Sy... [more]
SLC35B16.139e-3649.46solute carrier family 35 member B1 [Source:HGNC Sy... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hut-15.008e-5642.16Yeast Homolog UDP-Gal Transporter [Source:UniProt... [more]
hut-15.008e-5642.16Yeast Homolog UDP-Gal Transporter [Source:UniProt... [more]
pst-23.493e-1726.97Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
pst-11.001e-1626.39Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
pst-11.102e-1626.39Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meigo4.266e-6341.02gene:FBgn0250820 transcript:FBtr0084017[more]
meigo4.266e-6341.02gene:FBgn0250820 transcript:FBtr0113259[more]
sll2.285e-2629.41gene:FBgn0038524 transcript:FBtr0083462[more]
sll2.285e-2629.41gene:FBgn0038524 transcript:FBtr0305308[more]
Papst21.032e-1829.72gene:FBgn0036695 transcript:FBtr0075279[more]
back to top
BLAST of slc35b-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35b15.182e-7250.52solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b21.279e-3133.61solute carrier family 35 member B2 [Source:ZFIN;Ac... [more]
slc35b21.279e-3133.61solute carrier family 35 member B2 [Source:ZFIN;Ac... [more]
slc35b38.038e-2131.64solute carrier family 35 member B3 [Source:ZFIN;Ac... [more]
slc35b38.127e-2131.64solute carrier family 35 member B3 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35b15.609e-7249.48solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b11.099e-6749.10solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b11.250e-6749.10solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b11.323e-6749.10solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b11.396e-6749.10solute carrier family 35 member B1 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc35b17.732e-7852.60solute carrier family 35, member B1 [Source:MGI Sy... [more]
Slc35b26.540e-2430.42solute carrier family 35, member B2 [Source:MGI Sy... [more]
Slc35b26.540e-2430.42solute carrier family 35, member B2 [Source:MGI Sy... [more]
Slc35b21.855e-2330.42solute carrier family 35, member B2 [Source:MGI Sy... [more]
Slc35b13.187e-2363.89solute carrier family 35, member B1 [Source:MGI Sy... [more]
back to top
BLAST of slc35b-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P97858|S35B1_MOUSE5.409e-7752.60Solute carrier family 35 member B1 OS=Mus musculus... [more]
sp|Q6V7K3|S35B1_RAT4.260e-7552.94Solute carrier family 35 member B1 OS=Rattus norve... [more]
sp|Q8MII5|S35B1_BOVIN8.767e-7451.56Solute carrier family 35 member B1 OS=Bos taurus O... [more]
sp|Q8AWB6|S35B1_CHICK8.802e-7451.21Solute carrier family 35 member B1 OS=Gallus gallu... [more]
sp|P78383|S35B1_HUMAN9.055e-7452.25Solute carrier family 35 member B1 OS=Homo sapiens... [more]
back to top
BLAST of slc35b-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKF40.000e+0100.00Slc35b-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
I1ZIK01.864e-12292.35Solute carrier family 35 B1 (Fragment) OS=Schmidte... [more]
K1QPG13.131e-9455.24Solute carrier family 35 member B1 OS=Crassostrea ... [more]
V3ZR802.206e-9254.46Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0L8GI399.428e-9256.09Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc35b12.757e-4749.23solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b24.968e-3030.86solute carrier family 35 member B2 [Source:NCBI ge... [more]
slc35b31.247e-2031.78solute carrier family 35 member B3 [Source:ZFIN;Ac... [more]
slc35b41.544e-625.11solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc35b16.443e-7846.55solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b22.086e-2531.13solute carrier family 35 member B2 [Source:ZFIN;Ac... [more]
slc35b35.748e-2531.69solute carrier family 35 member B3 [Source:ZFIN;Ac... [more]
slc35b47.910e-923.62solute carrier family 35 member B4 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HUT13.030e-2128.15Protein with a role in UDP-galactose transport to ... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO490941.540e-7146.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468188.552e-3533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320185.163e-2029.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453916.709e-1123.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc35b-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35b11.687e-8053.82solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b11.640e-7151.04solute carrier family 35 member B1 [Source:NCBI ge... [more]
slc35b29.199e-2531.12solute carrier family 35 member B2 [Source:NCBI ge... [more]
slc35b29.352e-2531.51solute carrier family 35 member B2 [Source:NCBI ge... [more]
slc35b35.929e-2228.79solute carrier family 35 member B3 [Source:NCBI ge... [more]
back to top
BLAST of slc35b-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064878.10.000e+0100.00SMESG000064878.1[more]
SMESG000049708.11.158e-2330.60SMESG000049708.1[more]
SMESG000049708.12.156e-2330.60SMESG000049708.1[more]
SMESG000049708.12.166e-2330.60SMESG000049708.1[more]
SMESG000064892.12.343e-1928.34SMESG000064892.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018508
GenBankAKN21643.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018508 ID=SMED30018508|Name=slc35b-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1074bp
GTCAAATTAAATTATTTTTCGCAATCTTTCATTTTTAATTTATTTTAAAA
TTAATGGAAGGAACAAGAAAACACTTATTCGGTTGTTCATTGGGAATATT
TTTTTCTTACTTCTTTTACGGCATAATTCAAGAAAAAATAACAAAATCTA
AATTCGGACGTGAAAATGATAAGTTTACTTGTATTTTAACCTTAGTTTTT
ATTCAGTGTATTATAAATGCAATAATTGCATTTATTGCCATGAAATTACA
AAATAATGAAGTTGTAAAATCCAGAGTACCCAAGCGGCTATTTGCTTTTT
GTTCACTAACATATATTGGTGCAATGTTTGCAAGTAATTATTCATTACAG
CATGTAAACTATCCGACACAAGTTCTTGGAAAATCTGCGAAACCAATTCC
AGTCATGATTTTAGGCGTATTGTGGGCTAAAAAATCATACCCATTAAGAA
AATACGGATTTGTATTTATGATTACATTAGGTGTTATGCTTTTTTTAATG
AAAGATTTTTCATCCTTTAAACTCAGTAATAGTTCTGTGATTGGATTTGG
AGAAATATTGCTGCTCATTTCTCTAGCATTTGACGGAATAACTGGTGCAG
TCCAGGACGATTTACGAACTAAATATAACGTTAGAGCATATGATTTGATG
CTTAATATGAATCTTTGGTCGTTGGTTTATCTGTTTCCTGCAATTCTGAT
TTCGAAAGAATTTACCGTTTTTGCACAGTTTATCATTAAGCATCCTGAAA
TTCTCACTTGGGTTGTCGGATTCGGTTTGACTAGTGCTTTGGGACAAATT
TTTATTTTTGCTTCAATTACGAATTTTGGGCCTCTGATGACATCGATTGT
GACTACAACAAGGAAATTTTTTACTATTTTAGCTTCAGTAATTATTTTTC
AAAACCCGATGAATTTTATTCAAGGAATCGGAACTGGGCTTGTGTTTTTG
GGGCTGGTTTTGGATCAAATGTATGGTAAAGAAAGAAAATTAAAAGTTTA
ATGTTTTTTGTTGAAAGCATTTATTTGATTTGTTTTTTCTCAATAAATGA
TACTCATAAATGAATAGCCTATCG
back to top

protein sequence of SMED30018508-orf-1

>SMED30018508-orf-1 ID=SMED30018508-orf-1|Name=SMED30018508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MEGTRKHLFGCSLGIFFSYFFYGIIQEKITKSKFGRENDKFTCILTLVFI
QCIINAIIAFIAMKLQNNEVVKSRVPKRLFAFCSLTYIGAMFASNYSLQH
VNYPTQVLGKSAKPIPVMILGVLWAKKSYPLRKYGFVFMITLGVMLFLMK
DFSSFKLSNSSVIGFGEILLLISLAFDGITGAVQDDLRTKYNVRAYDLML
NMNLWSLVYLFPAILISKEFTVFAQFIIKHPEILTWVVGFGLTSALGQIF
IFASITNFGPLMTSIVTTTRKFFTILASVIIFQNPMNFIQGIGTGLVFLG
LVLDQMYGKERKLKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013657UAA
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013657UAA transporterPFAMPF08449UAAcoord: 11..304
e-value: 8.9E-57
score: 192.6
NoneNo IPR availablePANTHERPTHR10778:SF10SOLUTE CARRIER FAMILY 35 MEMBER B1coord: 7..312
NoneNo IPR availablePANTHERPTHR10778SOLUTE CARRIER FAMILY 35 MEMBER Bcoord: 7..312
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 69..151
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 211..308
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 162..184
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 130..149
NoneNo IPR availableTMHMMTMhelixcoord: 79..101
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 281..303
NoneNo IPR availableTMHMMTMhelixcoord: 233..255