Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30018507
Length (bp)4567
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30018507) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30018507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30018507) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30018507) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018507SMESG000038461.1 dd_Smed_v4_3170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018507SMESG000038461.1 dd_Smed_v4_3170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018507SMESG000038461.1 dd_Smed_v4_3170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018507SMESG000038461.1 dd_Smed_v4_3170_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018507SMESG000038461.1 dd_Smed_v4_4559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018507SMESG000038461.1 dd_Smed_v4_4559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018507SMESG000038461.1 dd_Smed_v4_4559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018507SMESG000038461.1 dd_Smed_v4_4559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018507SMESG000038461.1 dd_Smed_v6_4559_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018507SMESG000038461.1 dd_Smed_v4_3170_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018507SMESG000038461.1 dd_Smed_v4_4559_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1103.2 bits (2852), Expect = 0.000e+0
Identity = 651/1140 (57.11%), Postives = 832/1140 (72.98%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA    E+   +  + +      S + + +K            K  +    EE +KKK  + KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ    ++    R+  V G VRR +  LSQ+
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQT-KAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQL 1141          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 652/1172 (55.63%), Postives = 843/1172 (71.93%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSD 3513
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA    E+   +  + +        ++E++ L  + E   + +++K      + +K          SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ    ++    R+  V G VRR +  LSQ+  +        +S P   + SA + +S   S+
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAV----AMEMQPL-KSAEGGEMEEREKKKANAPKKEK----------SVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQLHDVT------NLSTPTHAILSAANPTSAAGSE 1153          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 646/1140 (56.67%), Postives = 831/1140 (72.89%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA    E+   +  + +        ++E++ L  + E   + +++K      + +K          SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ    ++    R+  V G VRR +  LSQ+
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAV----AMEMQPL-KSAEGGEMEEREKKKANAPKKEK----------SVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQL 1127          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 643/1111 (57.88%), Postives = 819/1111 (73.72%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +S   + +K            K  +    EE +KKK  + KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 643/1111 (57.88%), Postives = 819/1111 (73.72%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +S   + +K            K  +    EE +KKK  + KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 635/1107 (57.36%), Postives = 806/1107 (72.81%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGL-SATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXX-XXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK---KKEIPQPXXXXXXXXXXXXXLGTSTP----YGESEDELKSPGQKLWIRGLSRLQTQ 3336
            ++   ++EL  LM +R  EA E+I+  Y     LC +LKT PN+GL +  ++L  RR VFG+N IPP PPK FL+L++EALQDVTL++L+ +A++SL L+ Y     +   SD SE DAGWIEGVAIL +V+VVV+VTA ND+ KE+QFRGLQ KIE  H+  V+R G+  +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGSGKM+VTAVG++SQ GII  LLGAA+   +  ++  + +                + T    L  K  +     +A    +   KK+ SVLQ KL +LA  IG  G+ +A  TV+ILIIRFCI  Y I   S+ +   +  I+FLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F N  +Y+ + P+   L +N    ++  I++NSSY+S+++P K  GE  TQ+GNKTEC +LGF+  A+GK Y E+R    E+ + K+YTFNSVRKSMST+I   D    + +KGASE+V  +C + +GK+G++  F+  DA  L++ VIEPMA DGLRTI +AYK++V    +    Q  Y    D E+E  I+ D+T I ++GI+DPVRPEVP AI +CQ AGITVRMVTGDN+NTARSIA  CGILKP +DFI +EGKEFN +IRD + G++ Q K+D IWP+LRVLAR+ P DKY LV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAV+VAFVGAC + D+PLKAVQMLWVNLIMDTLASLALATE+PTEELL R PYGRT  +ISR M KNILG ++YQL++ F LI++GE+  ++ + R   A  ++ PS+HFT VFNTFV+MTLFNEIN+RKIHG+RN+F G+  N I+ +IWI T + Q+VIIQFGG   ST+ L+   W+WC+ FG G+LLW Q+V S+PT  +P        E P                 T+ P    Y +S+   K  GQ LW+RGL+RLQTQ
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAE-------EGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRW--APLHSPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAP-----------------TNDPLMPDYEDSDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 635/1107 (57.36%), Postives = 806/1107 (72.81%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGL-SATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXX-XXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK---KKEIPQPXXXXXXXXXXXXXLGTSTP----YGESEDELKSPGQKLWIRGLSRLQTQ 3336
            ++   ++EL  LM +R  EA E+I+  Y     LC +LKT PN+GL +  ++L  RR VFG+N IPP PPK FL+L++EALQDVTL++L+ +A++SL L+ Y     +   SD SE DAGWIEGVAIL +V+VVV+VTA ND+ KE+QFRGLQ KIE  H+  V+R G+  +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGSGKM+VTAVG++SQ GII  LLGAA+   +  ++  + +                + T    L  K  +     +A    +   KK+ SVLQ KL +LA  IG  G+ +A  TV+ILIIRFCI  Y I   S+ +   +  I+FLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F N  +Y+ + P+   L +N    ++  I++NSSY+S+++P K  GE  TQ+GNKTEC +LGF+  A+GK Y E+R    E+ + K+YTFNSVRKSMST+I   D    + +KGASE+V  +C + +GK+G++  F+  DA  L++ VIEPMA DGLRTI +AYK++V    +    Q  Y    D E+E  I+ D+T I ++GI+DPVRPEVP AI +CQ AGITVRMVTGDN+NTARSIA  CGILKP +DFI +EGKEFN +IRD + G++ Q K+D IWP+LRVLAR+ P DKY LV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAV+VAFVGAC + D+PLKAVQMLWVNLIMDTLASLALATE+PTEELL R PYGRT  +ISR M KNILG ++YQL++ F LI++GE+  ++ + R   A  ++ PS+HFT VFNTFV+MTLFNEIN+RKIHG+RN+F G+  N I+ +IWI T + Q+VIIQFGG   ST+ L+   W+WC+ FG G+LLW Q+V S+PT  +P        E P                 T+ P    Y +S+   K  GQ LW+RGL+RLQTQ
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAE-------EGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRW--APLHSPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAP-----------------TNDPLMPDYEDSDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 635/1107 (57.36%), Postives = 806/1107 (72.81%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGL-SATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXX-XXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK---KKEIPQPXXXXXXXXXXXXXLGTSTP----YGESEDELKSPGQKLWIRGLSRLQTQ 3336
            ++   ++EL  LM +R  EA E+I+  Y     LC +LKT PN+GL +  ++L  RR VFG+N IPP PPK FL+L++EALQDVTL++L+ +A++SL L+ Y     +   SD SE DAGWIEGVAIL +V+VVV+VTA ND+ KE+QFRGLQ KIE  H+  V+R G+  +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGSGKM+VTAVG++SQ GII  LLGAA+   +  ++  + +                + T    L  K  +     +A    +   KK+ SVLQ KL +LA  IG  G+ +A  TV+ILIIRFCI  Y I   S+ +   +  I+FLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F N  +Y+ + P+   L +N    ++  I++NSSY+S+++P K  GE  TQ+GNKTEC +LGF+  A+GK Y E+R    E+ + K+YTFNSVRKSMST+I   D    + +KGASE+V  +C + +GK+G++  F+  DA  L++ VIEPMA DGLRTI +AYK++V    +    Q  Y    D E+E  I+ D+T I ++GI+DPVRPEVP AI +CQ AGITVRMVTGDN+NTARSIA  CGILKP +DFI +EGKEFN +IRD + G++ Q K+D IWP+LRVLAR+ P DKY LV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAV+VAFVGAC + D+PLKAVQMLWVNLIMDTLASLALATE+PTEELL R PYGRT  +ISR M KNILG ++YQL++ F LI++GE+  ++ + R   A  ++ PS+HFT VFNTFV+MTLFNEIN+RKIHG+RN+F G+  N I+ +IWI T + Q+VIIQFGG   ST+ L+   W+WC+ FG G+LLW Q+V S+PT  +P        E P                 T+ P    Y +S+   K  GQ LW+RGL+RLQTQ
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAE-------EGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRW--APLHSPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAP-----------------TNDPLMPDYEDSDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 635/1107 (57.36%), Postives = 806/1107 (72.81%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGL-SATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXX-XXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK---KKEIPQPXXXXXXXXXXXXXLGTSTP----YGESEDELKSPGQKLWIRGLSRLQTQ 3336
            ++   ++EL  LM +R  EA E+I+  Y     LC +LKT PN+GL +  ++L  RR VFG+N IPP PPK FL+L++EALQDVTL++L+ +A++SL L+ Y     +   SD SE DAGWIEGVAIL +V+VVV+VTA ND+ KE+QFRGLQ KIE  H+  V+R G+  +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGSGKM+VTAVG++SQ GII  LLGAA+   +  ++  + +                + T    L  K  +     +A    +   KK+ SVLQ KL +LA  IG  G+ +A  TV+ILIIRFCI  Y I   S+ +   +  I+FLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F N  +Y+ + P+   L +N    ++  I++NSSY+S+++P K  GE  TQ+GNKTEC +LGF+  A+GK Y E+R    E+ + K+YTFNSVRKSMST+I   D    + +KGASE+V  +C + +GK+G++  F+  DA  L++ VIEPMA DGLRTI +AYK++V    +    Q  Y    D E+E  I+ D+T I ++GI+DPVRPEVP AI +CQ AGITVRMVTGDN+NTARSIA  CGILKP +DFI +EGKEFN +IRD + G++ Q K+D IWP+LRVLAR+ P DKY LV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAV+VAFVGAC + D+PLKAVQMLWVNLIMDTLASLALATE+PTEELL R PYGRT  +ISR M KNILG ++YQL++ F LI++GE+  ++ + R   A  ++ PS+HFT VFNTFV+MTLFNEIN+RKIHG+RN+F G+  N I+ +IWI T + Q+VIIQFGG   ST+ L+   W+WC+ FG G+LLW Q+V S+PT  +P        E P                 T+ P    Y +S+   K  GQ LW+RGL+RLQTQ
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAE-------EGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRW--APLHSPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAP-----------------TNDPLMPDYEDSDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 635/1107 (57.36%), Postives = 806/1107 (72.81%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGL-SATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXX-XXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK---KKEIPQPXXXXXXXXXXXXXLGTSTP----YGESEDELKSPGQKLWIRGLSRLQTQ 3336
            ++   ++EL  LM +R  EA E+I+  Y     LC +LKT PN+GL +  ++L  RR VFG+N IPP PPK FL+L++EALQDVTL++L+ +A++SL L+ Y     +   SD SE DAGWIEGVAIL +V+VVV+VTA ND+ KE+QFRGLQ KIE  H+  V+R G+  +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGSGKM+VTAVG++SQ GII  LLGAA+   +  ++  + +                + T    L  K  +     +A    +   KK+ SVLQ KL +LA  IG  G+ +A  TV+ILIIRFCI  Y I   S+ +   +  I+FLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F N  +Y+ + P+   L +N    ++  I++NSSY+S+++P K  GE  TQ+GNKTEC +LGF+  A+GK Y E+R    E+ + K+YTFNSVRKSMST+I   D    + +KGASE+V  +C + +GK+G++  F+  DA  L++ VIEPMA DGLRTI +AYK++V    +    Q  Y    D E+E  I+ D+T I ++GI+DPVRPEVP AI +CQ AGITVRMVTGDN+NTARSIA  CGILKP +DFI +EGKEFN +IRD + G++ Q K+D IWP+LRVLAR+ P DKY LV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAV+VAFVGAC + D+PLKAVQMLWVNLIMDTLASLALATE+PTEELL R PYGRT  +ISR M KNILG ++YQL++ F LI++GE+  ++ + R   A  ++ PS+HFT VFNTFV+MTLFNEIN+RKIHG+RN+F G+  N I+ +IWI T + Q+VIIQFGG   ST+ L+   W+WC+ FG G+LLW Q+V S+PT  +P        E P                 T+ P    Y +S+   K  GQ LW+RGL+RLQTQ
Sbjct:    3 EYGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKTVAEEERKTAKREGGDGASGAE-------EGTAQALLDSKGDEAMANGKAVAAAESDGKKERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRD-ENGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRW--APLHSPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAP-----------------TNDPLMPDYEDSDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304047)

HSP 1 Score: 1141.72 bits (2952), Expect = 0.000e+0
Identity = 671/1111 (60.40%), Postives = 821/1111 (73.90%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX-XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAA------ELXXXXXXX----XXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E + +I      I+ LC KL TSPN+GLS +  D   RRE FGSNVIPPKPPKTFL L++EALQDVTLI+L  AA++SLGL+ Y     +       E   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D DPM+LSGTHVMEGSGKMVVTAVG++SQAGIIF LLGAA      E+ +    E             ++ ++V  E     +E ++L         +   KK+K        SVLQ KL KLA  IG  G+ IAVLTV+ILII+FCI+T+ I    W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  LP  +D+P+++ + +   I++NS+YTS ++ G + G+L  Q+GNKTEC+LLGF+ G +G  Y  +R   TEDK  ++YTFNSVRKSM T+I   N    L TKGASE+++ KC+FI G +G+++ FT++    LI+ VIEPMA DGLRTI +AY++FV   +   +      PN D  DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGIL+P DDF+++EGKEFN +IRDS  G I+Q  ID++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTK +ISR M+KNILGQ+LYQLI+ F L++ G+++LD+++ RG     N  P++HFT +FNTFV+MTLFNEIN+RKIHGQRNV  G+  N IF  IWI T + Q++IIQ+G  A ST  L ++ W+WC+FFG G+L+W QL+ SVPT  +PK        P     E   +   LG         D+    GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEK--------SVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWD--DEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDSN-GDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQEL--NAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHP-----EEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1098          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304050)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 622/1128 (55.14%), Postives = 787/1128 (69.77%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX-XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDI-------------CQVKYGDL-LPADGIIIQSNDIK----VDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVG--LSSQAGIIFALLGAAE-------LXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E + +I      I+ LC KL TSPN+GLS +  D   RRE FGSNVIPPKPPKTFL L++EALQDVTLI+L  AA++SLGL+ Y     +       E   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDI+VGDI             C ++  DL +    +  +S+ +K    VD   L+G   HV +G  +  M+++   V   +G ++ T +G  +  Q   I  +   A+       L  ++            ++ ++V  E     +E ++L         +   KK+K        SVLQ KL KLA  IG  G+ IAVLTV+ILII+FCI+T+ I    W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  LP  +D+P+++ + +   I++NS+YTS ++ G + G+L  Q+GNKTEC+LLGF+ G +G  Y  +R   TEDK  ++YTFNSVRKSM T+I   N    L TKGASE+++ KC+FI G +G+++ FT++    LI+ VIEPMA DGLRTI +AY++FV   +   +      PN D  DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGIL+P DDF+++EGKEFN +IRDS  G I+Q  ID++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTK +ISR M+KNILGQ+LYQLI+ F L++ G+++LD+++ RG     N  P++HFT +FNTFV+MTLFNEIN+RKIHGQRNV  G+  N IF  IWI T + Q++IIQ+G  A ST  L ++ W+WC+FFG G+L+W QL+ SVPT  +PK        P     E   +   LG         D+    GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT--HVMEG--SGKMVVTAVGVNSQAG-IIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEK--------SVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWD--DEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQEL--NAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHP-----EEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300558)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 622/1128 (55.14%), Postives = 787/1128 (69.77%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX-XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDI-------------CQVKYGDL-LPADGIIIQSNDIK----VDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVG--LSSQAGIIFALLGAAE-------LXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E + +I      I+ LC KL TSPN+GLS +  D   RRE FGSNVIPPKPPKTFL L++EALQDVTLI+L  AA++SLGL+ Y     +       E   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDI+VGDI             C ++  DL +    +  +S+ +K    VD   L+G   HV +G  +  M+++   V   +G ++ T +G  +  Q   I  +   A+       L  ++            ++ ++V  E     +E ++L         +   KK+K        SVLQ KL KLA  IG  G+ IAVLTV+ILII+FCI+T+ I    W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  LP  +D+P+++ + +   I++NS+YTS ++ G + G+L  Q+GNKTEC+LLGF+ G +G  Y  +R   TEDK  ++YTFNSVRKSM T+I   N    L TKGASE+++ KC+FI G +G+++ FT++    LI+ VIEPMA DGLRTI +AY++FV   +   +      PN D  DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGIL+P DDF+++EGKEFN +IRDS  G I+Q  ID++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTK +ISR M+KNILGQ+LYQLI+ F L++ G+++LD+++ RG     N  P++HFT +FNTFV+MTLFNEIN+RKIHGQRNV  G+  N IF  IWI T + Q++IIQ+G  A ST  L ++ W+WC+FFG G+L+W QL+ SVPT  +PK        P     E   +   LG         D+    GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT--HVMEG--SGKMVVTAVGVNSQAG-IIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEK--------SVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWD--DEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQEL--NAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHP-----EEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300555)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 622/1128 (55.14%), Postives = 787/1128 (69.77%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX-XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDI-------------CQVKYGDL-LPADGIIIQSNDIK----VDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVG--LSSQAGIIFALLGAAE-------LXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E + +I      I+ LC KL TSPN+GLS +  D   RRE FGSNVIPPKPPKTFL L++EALQDVTLI+L  AA++SLGL+ Y     +       E   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDI+VGDI             C ++  DL +    +  +S+ +K    VD   L+G   HV +G  +  M+++   V   +G ++ T +G  +  Q   I  +   A+       L  ++            ++ ++V  E     +E ++L         +   KK+K        SVLQ KL KLA  IG  G+ IAVLTV+ILII+FCI+T+ I    W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  LP  +D+P+++ + +   I++NS+YTS ++ G + G+L  Q+GNKTEC+LLGF+ G +G  Y  +R   TEDK  ++YTFNSVRKSM T+I   N    L TKGASE+++ KC+FI G +G+++ FT++    LI+ VIEPMA DGLRTI +AY++FV   +   +      PN D  DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGIL+P DDF+++EGKEFN +IRDS  G I+Q  ID++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTK +ISR M+KNILGQ+LYQLI+ F L++ G+++LD+++ RG     N  P++HFT +FNTFV+MTLFNEIN+RKIHGQRNV  G+  N IF  IWI T + Q++IIQ+G  A ST  L ++ W+WC+FFG G+L+W QL+ SVPT  +PK        P     E   +   LG         D+    GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT--HVMEG--SGKMVVTAVGVNSQAG-IIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEK--------SVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWD--DEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQEL--NAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHP-----EEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300556)

HSP 1 Score: 1003.05 bits (2592), Expect = 0.000e+0
Identity = 627/1155 (54.29%), Postives = 796/1155 (68.92%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX-XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVG-------------DICQVKYGDL-LPADGIIIQSNDIK----VDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVG--LSSQAGIIFALLGAAE-------LXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYTLSQV 3417
            +++ I +K+L ELM  R  E + +I      I+ LC KL TSPN+GLS +  D   RRE FGSNVIPPKPPKTFL L++EALQDVTLI+L  AA++SLGL+ Y     +       E   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDI+VG             D C ++  DL +    +  +S+ +K    VD   L+G   HV +G  +  M+++   V   +G ++ T +G  +  Q   I  +   A+       L  ++            ++ ++V  E     +E ++L         +   KK+K        SVLQ KL KLA  IG  G+ IAVLTV+ILII+FCI+T+ I    W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  LP  +D+P+++ + +   I++NS+YTS ++ G + G+L  Q+GNKTEC+LLGF+ G +G  Y  +R   TEDK  ++YTFNSVRKSM T+I   N    L TKGASE+++ KC+FI G +G+++ FT++    LI+ VIEPMA DGLRTI +AY++FV   +   +      PN D  DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGIL+P DDF+++EGKEFN +IRDS  G I+Q  ID++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTK +ISR M+KNILGQ+LYQLI+ F L++ G+++LD+++ RG     N  P++HFT +FNTFV+MTLFNEIN+RKIHGQRNV  G+  N IF  IWI T + Q++IIQ+G  A ST  L ++ W+WC+FFG G+L+W QL+ SVPT  +PK        P     E   +   LG         D+    GQ LWIRGL+RLQTQ    N+      D  YG     +L++V
Sbjct:    9 AQYGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT--HVMEG--SGKMVVTAVGVNSQAG-IIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSSSGAAETGHKKEK--------SVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWD--DEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDSN-GDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQEL--NAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHP-----EEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFRQG-LDARYGDHTNTSLAEV 1136          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1093.18 bits (2826), Expect = 0.000e+0
Identity = 656/1175 (55.83%), Postives = 840/1175 (71.49%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSDLDK 3522
            F + + EL  LM  R  EA+++I+  + D+  LC +LK+S  DGLS    DL  RR+ FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISL L+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLG A   E+  KE    +     +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ + +M+W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ N +++R+ +P  + +  N  + ++  I++N +YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE+VL KCS I+G +G  +NF   D +E++K VIEPMA +GLRTI + Y++   D            P  + E+E  I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A+ ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  Q+VI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+  +        IS P   + S  + S+   S+L +
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLG-AGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFRE-IPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGD------------PEPEWENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--YAQLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGHGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDVT------NISTPTHVVLSTANASAAPGSELSE 1177          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 649/1140 (56.93%), Postives = 827/1140 (72.54%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F + + EL  LM  R  EA+++I+  + D+  LC +LK+S  DGLS    DL  RR+ FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISL L+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLG A   E+  KE    +     +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ + +M+W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ N +++R+ +P  + +  N  + ++  I++N +YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE+VL KCS I+G +G  +NF   D +E++K VIEPMA +GLRTI + Y++   D            P  + E+E  I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A+ ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  Q+VI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLG-AGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFRE-IPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGD------------PEPEWENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--YAQLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGHGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1148          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1090.49 bits (2819), Expect = 0.000e+0
Identity = 649/1140 (56.93%), Postives = 827/1140 (72.54%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F + + EL  LM  R  EA+++I+  + D+  LC +LK+S  DGLS    DL  RR+ FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISL L+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLG A   E+  KE    +     +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ + +M+W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ N +++R+ +P  + +  N  + ++  I++N +YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE+VL KCS I+G +G  +NF   D +E++K VIEPMA +GLRTI + Y++   D            P  + E+E  I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A+ ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  Q+VI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   28 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLG-AGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFRE-IPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGD------------PEPEWENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--YAQLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGHGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1142          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 1084.32 bits (2803), Expect = 0.000e+0
Identity = 656/1144 (57.34%), Postives = 819/1144 (71.59%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKK-EIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            D  F + V EL  LM  R  EA+++I+  Y +   LC +LKTSP DGLS    DL  RR+VFG N IPPK PKTFL L++EALQD+TLI+L  AA+ISLGL+ Y              E   D  E+DA WIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+  + +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K +D DPMLLSGTHVMEGSGKM+VTAVG++SQ GIIF LLGA E+ E+        +      + + + +K  +         K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ +   + +R ++P  + +     + +   IA+N +YTS+++P   +G L  Q+GNKTEC+LLG +   + +DY  +R    E+ L K+YTFNSVRKSMST+I+  D +  L +KGASE++L KCSFI+ +DG  + F   D +E++K VIEPMA DGLRTI +AY+E   D            P  D ++E +I+ +LTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI+ P DDF+ MEGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +ISR M+KNILG ++YQL++ F L++ GE + D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL++E W+WC+F G G LLW QL++SVPT  +   K+    P P++   E   E +E         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   24 DGDFGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQN-KAKKQDEAVAMEMQPLKSAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQIYIGDQLFR-DIPTPDQINPRTLELISSAIAVNCAYTSKIMPADKEGGLPKQVGNKTECALLGLVLD-LKQDYQAVREQIPEELLYKVYTFNSVRKSMSTVIQMPDGSFRLYSKGASEILLKKCSFILSRDGEARAFRARDKDEMVKKVIEPMACDGLRTICIAYRELPAD------------PLPDWDNETDIVSNLTCITVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFLCMEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISRTMMKNILGHAVYQLVIIFTLLFAGERIFDIDSGR--DAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFAIQIVIVQFGGKPFSCSPLNVEQWLWCLFVGMGELLWGQLISSVPTHQLKCLKEAGHGPAPDEMLDEDLAEDEEEIDY-----AERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1141          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 1080.09 bits (2792), Expect = 0.000e+0
Identity = 651/1127 (57.76%), Postives = 811/1127 (71.96%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ----QSKRNSILD 3363
            D  F + V EL  LM  R  EA+++I+  Y +   LC +LKTSP DGLS    DL  RR+VFG N IPPK PKTFL L++EALQD+TLI+L  AA+ISLGL+ Y              E   D  E+DA WIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+  + +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K +D DPMLLSGTHVMEGSGKM+VTAVG++SQ GIIF LLGA E+ E+        +      + + + +K  +         K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ +   + +R ++P  + +     + +   IA+N +YTS+++P   +G L  Q+GNKTEC+LLG +   + +DY  +R    E+ L K+YTFNSVRKSMST+I+  D +  L +KGASE++L KCSFI+ +DG  + F   D +E++K VIEPMA DGLRTI +AY+E   D            P  D ++E +I+ +LTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI+ P DDF+ MEGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +ISR M+KNILG ++YQL++ F L++ GE + D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL++E W+WC+F G G LLW QL++SVPT  +  +  KE       +   DE+  E      Y E   EL+  GQ LW RGL+R+QTQ    ++ R+S+ D
Sbjct:   24 DGDFGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQN-KAKKQDEAVAMEMQPLKSAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQIYIGDQLFR-DIPTPDQINPRTLELISSAIAVNCAYTSKIMPADKEGGLPKQVGNKTECALLGLVLD-LKQDYQAVREQIPEELLYKVYTFNSVRKSMSTVIQMPDGSFRLYSKGASEILLKKCSFILSRDGEARAFRARDKDEMVKKVIEPMACDGLRTICIAYRELPAD------------PLPDWDNETDIVSNLTCITVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFLCMEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISRTMMKNILGHAVYQLVIIFTLLFAGERIFDIDSGR--DAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFAIQIVIVQFGGKPFSCSPLNVEQWLWCLFVGMGELLWGQLISSVPTHQL--KCLKEAGHGPAPDEMLDEDLAEDEEEIDYAER--ELRR-GQILWFRGLNRIQTQIRVVKAFRSSLYD 1127          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2b1 (Xenopus tropicalis ATPase, Ca++ transporting, plasma membrane 1 (atp2b1), mRNA. [Source:RefSeq mRNA;Acc:NM_001368122])

HSP 1 Score: 1084.71 bits (2804), Expect = 0.000e+0
Identity = 655/1129 (58.02%), Postives = 821/1129 (72.72%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKY---XXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXX-XXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK-------KKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            +F I ++EL  LM  R  +A+++I+ +Y D+  +C +LKTSP++GLS    DL  R+E FG N+IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y      +  E S   E +AGWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ +IE   K  V+R G++ +I V DIVVGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK ++ DP+LLSGTHVMEGSGKMVVTA+G++SQ GIIF LLGA E  E+  KE  +  K  K +  ++E        +   +  +        +   KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I T+ ++   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ+F N K+YR+ +P  + + EN+ D LL  I++N +YTS++LP + +G L   +GNKTEC+LLGF+   + +DY ++R+   E+ L K+YTFNSVRKSMST++K  D +  + +KGASE++L KC   +G +G  + F   D ++++K VIEPMA +GLRTI LAY++F     EP           D E+E++I+  LTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGIL P +DF+ +EGKEFN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL+V F L++ GE L D+D+ R   A  +  PS+H+T VFNTFV+M LFNEIN+RKIHG+RNVF GI  NIIF  I + TF+ QIVI+QFGG   S   L ++ W+W +F G G+LLW QLV S+PTS +   K       K EIP+            +          +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:    4 QFGITIEELRTLMELRSTDALQKIQERYGDVYGICTRLKTSPHEGLSGNLADLERRQEAFGKNIIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYRPPGGDNECEYSCEEEGEAGWIEGGAILVSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVADIVVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTLEKDPLLLSGTHVMEGSGKMVVTAIGVNSQTGIIFTLLGAGENEEEKEKEKEKKDKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGADGDDKKKANLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVINTFWVQKRPWLAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQSFINEKHYRK-VPDPDSISENVLDLLLTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFILD-MKRDYQDVRNEIPEETLFKVYTFNSVRKSMSTVLKNADGSYRMYSKGASEIILKKCFKTLGINGEAKIFRPRDRDDMVKRVIEPMASEGLRTICLAYRDFPAGEHEP-----------DWENENDILTGLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGEDFLCVEGKEFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVCEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLVVVFTLLFVGEKLFDIDSGR--NAPLHAPPSQHYTIVFNTFVMMQLFNEINARKIHGERNVFEGIFNNIIFCSIVLGTFIIQIVIVQFGGKPFSCTELTVDQWLWSIFLGMGTLLWGQLVTSIPTSRLKFLKEAGHGTQKDEIPE-----------EELAEDVEEIDHAERELRR-GQILWFRGLNRIQTQIRVVNAFRSSLYEGL 1104          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1083.94 bits (2802), Expect = 0.000e+0
Identity = 654/1171 (55.85%), Postives = 835/1171 (71.31%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHN---IIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQVAGIVPMLGGRQISCPVGR-LKSANSVSS 3498
            F   ++EL  LM  R  EAI++I++ Y D+N LC +LKTSP +GLS    D   RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    +  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + +VIR+G++ +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA    E+   +  + +        ++E++ L  + E   + +++K   +  + +K          SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+   G  + ++ P  + +   + D L+  IA+N +YT+++LP + +G L  Q+GNKTEC+LLGF+   + +DY  +R    E+ L K+YTFNSVRKSMSTII+  N    L +KGASE+VL KCS I+   G ++ F   D  E++K VIEPMA DGLRTI +AY++F               P +   +  N   I+ DLTCIG+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQLI+ F L++ GEI  D+D+ R   A  +  PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QI+I+QFGG   S APL+ + W+WC+F G G L+W Q++ +VPTS + K  K+    P KDE   +E  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+  +        IS P    L +AN+ SS
Sbjct:   25 FGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKAKKQDGAV----AMEMQPL-KSAEGGEMEEREKKKASVPKKEK----------SVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNI-GDIHNKDKPDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVLD-MQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYRDF---------------PGVPEPEWENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGR--NAPLHAPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTSQL-KCLKEAGHGPGKDEITDEELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDVT------NISTPTHVILSAANATSS 1147          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 659/1192 (55.29%), Postives = 842/1192 (70.64%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHN---IIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSDLDKHTERNKLISTMSLP 3564
            F   ++EL  LM  R  EAI++I++ Y D+N LC +LKTSP +GLS    D   RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    +  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + +VIR+G++ +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+   G  + ++ P  + +   + D L+  IA+N +YT+++LP + +G L  Q+GNKTEC+LLGF+   + +DY  +R    E+ L K+YTFNSVRKSMSTII+  N    L +KGASE+VL KCS I+   G ++ F   D  E++K VIEPMA DGLRTI +AY++F               P +   +  N   I+ DLTCIG+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQLI+ F L++ GEI  D+D+ R   A  +  PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QI+I+QFGG   S APL+ + W+WC+F G G L+W Q++ +VPTS + K  K+    P KDE   +E  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+  +        IS P   ++   +  S     L+K   +  + + M+ P
Sbjct:   25 FGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAVETNQNKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNI-GDIHNKDKPDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVLD-MQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYRDF---------------PGVPEPEWENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGR--NAPLHAPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTSQL-KCLKEAGHGPGKDEITDEELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDVT------NISTPT-HIRVVKAFRSSLYEGLEKPESKTSIHNFMTTP 1181          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 652/1146 (56.89%), Postives = 826/1146 (72.08%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHN---IIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQVAGI 3426
            F   ++EL  LM  R  EAI++I++ Y D+N LC +LKTSP +GLS    D   RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    +  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + +VIR+G++ +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+   G  + ++ P  + +   + D L+  IA+N +YT+++LP + +G L  Q+GNKTEC+LLGF+   + +DY  +R    E+ L K+YTFNSVRKSMSTII+  N    L +KGASE+VL KCS I+   G ++ F   D  E++K VIEPMA DGLRTI +AY++F               P +   +  N   I+ DLTCIG+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQLI+ F L++ GEI  D+D+ R   A  +  PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QI+I+QFGG   S APL+ + W+WC+F G G L+W Q++ +VPTS + K  K+    P KDE   +E  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+  I
Sbjct:   25 FGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAVETNQNKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNI-GDIHNKDKPDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVLD-MQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYRDF---------------PGVPEPEWENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGR--NAPLHAPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTSQL-KCLKEAGHGPGKDEITDEELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDI 1142          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 648/1118 (57.96%), Postives = 814/1118 (72.81%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXX-------XXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTEN------HYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHN---IIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F   ++EL  LM  R  EAI++I++ Y D+N LC +LKTSP +GLS    D   RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    +   + S       E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + +VIR+G++ +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA            E ++ K  K +S+E EK+    +            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I+T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+   G  + ++ P  + +   + D L+  IA+N +YT+++LP + +G L  Q+GNKTEC+LLGF+   + +DY  +R    E+ L K+YTFNSVRKSMSTII+  N    L +KGASE+VL KCS I+   G ++ F   D  E++K VIEPMA DGLRTI +AY++F               P +   +  N   I+ DLTCIG+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQLI+ F L++ GEI  D+D+ R   A  +  PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QI+I+QFGG   S APL+ + W+WC+F G G L+W Q++ +VPTS + K  K+    P KDE   +E  ++         +E EL+  GQ LW RGL+R+QTQ
Sbjct:   25 FGCTLQELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQNCGNVSGGGHDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGG----------EEEEKKDKKGNSLEHEKVNKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNI-GDIHNKDKPDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVLD-MQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYRDF---------------PGVPEPEWENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGR--NAPLHAPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTSQL-KCLKEAGHGPGKDEITDEELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQ 1107          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1093.18 bits (2826), Expect = 0.000e+0
Identity = 650/1140 (57.02%), Postives = 825/1140 (72.37%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++     S     +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    ED+L K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D ++++K +IEPMA DGLRTI +AY++F     EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDF-SAIQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1141          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1088.56 bits (2814), Expect = 0.000e+0
Identity = 642/1111 (57.79%), Postives = 812/1111 (73.09%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++     S     +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    ED+L K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D ++++K +IEPMA DGLRTI +AY++F     EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDF-SAIQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 642/1113 (57.68%), Postives = 813/1113 (73.05%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQS 3342
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++     S     +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    ED+L K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D ++++K +IEPMA DGLRTI +AY++F     EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ +
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDF-SAIQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQAT 1116          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b1 (ATPase, Ca++ transporting, plasma membrane 1 [Source:MGI Symbol;Acc:MGI:104653])

HSP 1 Score: 1075.08 bits (2779), Expect = 0.000e+0
Identity = 650/1130 (57.52%), Postives = 813/1130 (71.95%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRRE-VFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK--------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALL--GAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            D  F I + EL  LM  R  +A+ +I+  Y D+  +C KLKTSPN+GLS     + RRE VFG N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y                 +  E + GWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V DI VGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DP+LLSGTHVMEGSG+MVVTAVG++SQ GIIF LL  G  E  +K  K+  +  K +    ++    K  D         K ++    +E  KKK    KK+ SVLQ KL KLA  IGK G +++ +TV+IL++ F I+T+ ++   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+ N K+Y++ +P+   +P N+   L+  I++N +YTS++LP + +G L   +GNKTEC+LLGF+   + +DY ++R+   E+ L K+YTFNSVRKSMST++K  D +  + +KGASE++L KC  I+  +G  + F   D ++++K+VIEPMA +GLRTI LA+++F     EP+            ++E++++  LTCI +VGIEDPVRPEVP AIKKCQ AGITVRMVTGDN+NTAR+IA KCGIL P +DF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +S  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG + YQL+V F L++ GE   D+D+ R   A  +  PSEH+T VFNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TFV QI+I+QFGG   S + L IE W+W +F G G+LLW QL++++PTS    R K         + E   E +          +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:   24 DGDFGITLTELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKK-VPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFLLD-LKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSFRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPE-----------WDNENDVVTGLTCIAVVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARAIATKCGILHPGEDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR--NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTS----RLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRR-GQILWFRGLNRIQTQIRVVNAFRSSLYEGL 1132          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b4 (ATPase, Ca++ transporting, plasma membrane 4 [Source:MGI Symbol;Acc:MGI:88111])

HSP 1 Score: 1051.58 bits (2718), Expect = 0.000e+0
Identity = 644/1132 (56.89%), Postives = 817/1132 (72.17%), Query Frame = 1
Query:    7 KSV*SRHLNMESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXX------XXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +SV +  +    + +F   + +L +LM  R  +A+ +I   Y  +  +C +LKTSP +GLS    DL  RR VFG NVIPPK PKTFL L++EALQDVTLI+L  AA+ISL L+ Y           +      +  E + GWIEG AIL +V++VV+VTAFNDW KEKQFRGLQ +IE   K ++IR+G++ ++ V +IVVGDI Q+KYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA+E  +   K+    K+       K    D V LE    N++              E+ +KK  +  KK+ SVLQ KL +LA  IGK G +++VLTVVILI+ F ++ + I+   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+  G +YRQ +PQ +  P  + + ++  I++N +YTS++ P + +G L  Q+GNKTEC LLGF+   + +DY  +R+   E+KL K+YTFNSVRKSMST+I+  +    + +KGASE++L +C  I+ K+G I++F   D + ++++VIEPMA +GLRTI LAY++F  DG+EP         + D+E E  I+  L CI +VGIEDPVRPEVP AI KC+ AGITVRMVTGDNVNTAR+IA KCGIL P+DDF+ +EGKEFN+ IR+ K G+++Q K+D+IWP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL++ F L++ G+ L D+D+ R   A  N+ PS+H+T VFNTFV+M LFNEIN+RKIHG++NVF G+ RNIIF  + + TF  QI+I++ GG   S   L +E WMWC+F G G LLW Q+++++PT     +  K + +      + D   D  G       +E EL+  GQ LW+RGL+R+QTQ
Sbjct:    7 QSVSANTVAESHEGEFGCTLMDLRKLMELRGADAVAQISAHYGGVQEICTRLKTSPIEGLSGNPADLEKRRLVFGKNVIPPKRPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGDNEICGHIASSPEEEEEGETGWIEGAAILASVIIVVLVTAFNDWSKEKQFRGLQSRIELEQKFSIIRNGQLIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKTLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGASEEEDDDDKKKKGKKQGAPENRNKAKTQDGVALEIQPLNSQEGL---------DSEDKEKKIARIPKKEKSVLQGKLTRLAVQIGKAGLIMSVLTVVILILYFVVDNFVIQRREWLPECTPVYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGTHYRQ-IPQPDVFPPKVLELIVNGISINCAYTSKIQPPEKEGGLPRQVGNKTECGLLGFVTD-LKQDYQAVRNEVPEEKLFKVYTFNSVRKSMSTVIRKPEGGFRMFSKGASEIMLRRCDRILNKEGEIKSFRSKDRDNMVRNVIEPMASEGLRTICLAYRDF--DGTEP---------SWDIEGE--ILTSLICIAVVGIEDPVRPEVPDAIAKCKRAGITVRMVTGDNVNTARAIATKCGILTPKDDFLCLEGKEFNSLIRNEK-GEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTAGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLRRRPYGRNKPLISRTMMKNILGHAVYQLLIVFLLVFAGDTLFDIDSGR--KAPLNSPPSQHYTIVFNTFVLMQLFNEINARKIHGEKNVFAGVYRNIIFCTVVLGTFFCQIMIVELGGKPFSCTSLTMEQWMWCLFIGIGELLWGQVISAIPT-----KSLKFLKEAGHGSDKEDISRDTEGMDE-IDLAEMELRR-GQILWVRGLNRIQTQ 1104          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q98SH2|AT2B1_CHICK (Plasma membrane calcium-transporting ATPase 1 OS=Gallus gallus OX=9031 GN=ATP2B1 PE=2 SV=2)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 655/1126 (58.17%), Postives = 815/1126 (72.38%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRRE-VFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKY--------XXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            +F + + EL  LM  R  +A+ +I+  Y D+  +C KLKTSPN+GLS     I RRE VFG N IPPK PKTFL+L++EALQDVTLI+L  AAV+SLGL+ Y           S     +  ES+AGWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V DI+VGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA        ++  E K  K    D   +E     +E+             +E  KK+    KK+ SVLQ KL KLA  IGK G +++ +TV+IL++ F I+T  ++   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMM+DNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+ + K+Y++ +P    +PEN+   L+  I++N +YTS++LP + +G L   +GNKTEC+LLGF+   + +DY ++R+   E+KL K+YTFNSVRKSMST++K  D +  + +KGASE+VL KC  I+  DG  + F   D ++++K+VIEPMA +GLRTI LA+++F     EP+            ++E++I+  LTCI +VGIEDPVRPEVP AIKKCQ AGITVRMVTGDN+NTAR+IA+KCGIL P +DF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG + YQL+V F L++ GE + D+D+ R   A  +  PSEH+T VFNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TFV QI+I+QFGG   S + L IE W+W +F G G+LLW QL++++PTS    R K         + E   E +          +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:   25 EFGVTLAELRSLMELRATDALHKIQECYGDVQGICTKLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAVVSLGLSFYQPPGGNEALCGSVNVGEEEEESEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADIIVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDRDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAG---GDEEEKEKEKKDKKTKAQDGAAMEMQPLKSED---------GVDGDEKDKKRSNLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTSWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYISEKHYKK-IPAPEAIPENIMAYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFLLD-LKRDYQDVRNEIPEEKLHKVYTFNSVRKSMSTVLKNSDGSFRIFSKGASEIVLKKCFKILSADGEPKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPE-----------WDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIALKCGILNPGEDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTIFDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKIFDIDSGR--NAPLHAPPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSKLSIEQWLWSVFLGMGTLLWGQLISTIPTS----RLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRR-GQILWFRGLNRIQTQIRVVNAFRSSLYEGL 1117          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q16720|AT2B3_HUMAN (Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3)

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 643/1111 (57.88%), Postives = 819/1111 (73.72%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +S   + +K            K  +    EE +KKK  + KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    EDKL K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D +++++ +IEPMA DGLRTI +AY++F   G EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ
Sbjct:   27 FGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLD-LKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDF-SAGQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64568|AT2B3_RAT (Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2b3 PE=1 SV=2)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 650/1140 (57.02%), Postives = 827/1140 (72.54%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---------XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F   + EL  LM  R  EA+++I+  Y D++ LC +LKTSP +GL+  T+DL  RR+++G N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y+    E  +            E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   K  VIR+G++ ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLG A   E+  K+    ++    +S   + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++    +Y++ +P  + L   + D L+  I++NS+YT+++LP + +G L  Q+GNKTEC+LLGF+   + +D+  +R    ED+L K+YTFNSVRKSMST+I+  D    L +KGASE++L KC+ I+  +G ++ F   D ++++K +IEPMA DGLRTI +AY++F     EP           D ++E+ ++ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P +DF+ +EGKEFN +IR+ K G+I+Q ++D++WP+LRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE+  D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL  E W+WC+F G G L+W Q++ ++PTS + K  K+    P KDE   +E  +          +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   27 FGCTLAELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLG-AGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKE-IPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFILD-LKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDF-SAIQEP-----------DWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEK-GEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGR--NAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQL-KCLKEAGHGPGKDEMTDEELAE---GEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1141          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64542|AT2B4_RAT (Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus OX=10116 GN=Atp2b4 PE=1 SV=1)

HSP 1 Score: 1082.78 bits (2799), Expect = 0.000e+0
Identity = 648/1119 (57.91%), Postives = 812/1119 (72.56%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGA-----AELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            + +F   + +L +LM  R  +A+ +I   Y  +  +CA+LKTSP +GLS    DL  RR VFG N+IPPK PKTFL L++EALQDVTLI+L  AA+ISL L+ Y           +      +  E + GWIEG AIL +V++VV VTAFNDW KEKQFRGLQ +IE   K ++IR+G++ ++ V +IVVGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA      E  +K  K+     + K    D V LE    N++              EE +KK  K  KK+ SVLQ KL +LA  IGK G ++++LTV+ILI+ F ++ + I+  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+  G +YRQ +P+ +DLP N+ D ++ +I +NS+YTS++LP + +G L  Q+GNKTEC LLGF+   + +DY  +RS   E+KL K+YTFNSVRKSMST+I+  +    + +KGASE++L KC  I+ K+G I  F   D + ++++VIEPMA +GLRTIG+AY++F  DG EP             E+E+ I   L CI +VGIEDPVRPEVP AI KC+ AGITVRMVTGDNVNTAR+IA KCGIL P DDF+ +EGKEFN  IR+ K G+++Q K+D++WPRLRVLARSSP DK+TLV GIIDS++   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PT+ LL R PYGR K +ISR M+KNILG ++YQL + F L++ G+ L D+D+ R   A  N+ PS+H+T VFNTFV+M LFNEINSRKIHG++NVF G+ RNIIF  + + TF  QI+I++ GG   S   L +E WMWC+F G G LLW Q+++++PT     +  K + +      + +   D  G       +E EL+  GQ LW+RGL+R+QTQ
Sbjct:   19 EGEFGCTLMDLRKLMELRAADAVTQISAHYGSVQEICARLKTSPVEGLSGNPADLEKRRLVFGKNMIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGENEICGHIVSNPEEDEEGETGWIEGAAILASVIIVVFVTAFNDWSKEKQFRGLQSRIELEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKTLDKDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGANEEEDDEKKKKGKKQGVSENRNKAKTQDGVALEIQPLNSQEGL---------DSEEKEKKASKGPKKEKSVLQGKLTRLAVQIGKAGLIMSILTVLILILYFVVDNFVIQRRAWLPECTPVYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGTHYRQ-IPKPDDLPPNVLDLIVNSICINSAYTSKILPPEKEGGLPRQVGNKTECGLLGFVTD-LKQDYQAVRSEMPEEKLFKVYTFNSVRKSMSTVIRKPEGGFRVFSKGASEIMLRKCDRILNKEGGIVPFKTKDRDNMVRNVIEPMASEGLRTIGIAYRDF--DGEEP-----------SWENENEIFTGLVCIAVVGIEDPVRPEVPDAINKCKRAGITVRMVTGDNVNTARAIATKCGILTPGDDFLCLEGKEFNRLIRNEK-GEVEQEKLDKVWPRLRVLARSSPTDKHTLVKGIIDSNIGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFSGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLRRRPYGRNKPLISRTMMKNILGHAVYQLGIVFLLVFAGDKLFDIDSGR--KAPLNSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFAGVYRNIIFCSVVLGTFFCQILIVEVGGKPFSCTNLTMEQWMWCLFIGIGELLWGQVISAIPT-----KSLKFLKEAGHGSDKEEISKDAEGLEE-IDHAEMELRR-GQILWVRGLNRIQTQ 1103          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P11505|AT2B1_RAT (Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2b1 PE=1 SV=3)

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 650/1130 (57.52%), Postives = 813/1130 (71.95%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRRE-VFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK--------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALL--GAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            D  F I + EL  LM  R  +A+ +I+  Y D+  +C KLKTSPN+GLS     + RRE VFG N IPPK PKTFL+L++EALQDVTLI+L  AA++SLGL+ Y                 +  E + GWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V DI VGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DP+LLSGTHVMEGSG+MVVTAVG++SQ GIIF LL  G  E  +K  K+  +  K +    ++    K  D         K ++    +E  KKK    KK+ SVLQ KL KLA  IGK G +++ +TV+IL++ F I+T+ ++   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+ N K+Y++ +P+   +P N+   L+  I++N +YTS++LP + +G L   +GNKTEC+LLGF+   + +DY ++R+   E+ L K+YTFNSVRKSMST++K  D +  + +KGASE++L KC  I+  +G  + F   D ++++K+VIEPMA +GLRTI LA+++F     EP+            ++E++++  LTCI +VGIEDPVRPEVP AIKKCQ AGITVRMVTGDN+NTAR+IA KCGIL P +DF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +S  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG + YQL+V F L++ GE   D+D+ R   A  +  PSEH+T VFNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TFV QI+I+QFGG   S + L IE W+W +F G G+LLW QL++++PTS    R K         + E   E +          +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:   24 DGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKK-VPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFLLD-LKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSFRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPE-----------WDNENDVVTGLTCIAVVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARAIATKCGILHPGEDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR--NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTS----RLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRR-GQILWFRGLNRIQTQIRVVNAFRSSLYEGL 1132          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: T1J4D2 (Calcium-transporting ATPase OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 1172.53 bits (3032), Expect = 0.000e+0
Identity = 684/1114 (61.40%), Postives = 841/1114 (75.49%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXA--------GWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR------KKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            +++ + +K+L ELM  R  E I+++  ++  I  LC KL TSPN+GLS +T+DL  RR+ FGSNVIPPKPPKTFL+L++EA+QDVTLI+L  AAVISL L+L  K+  ++ ++   + A        GWIEGVAIL +VVVVV+VTAFND+ KE+QFRGLQ++IE  HK AVIR   + +I VGD+VVGDICQVKYGDLLP DG++IQSND+KVDESSLTGE DHVKKG + DPMLLSGTHVMEGSG+M+VTAVG++SQAGIIFALLGA +            +     +    E E +T N+      D       +E++K  +  S +K+ SVLQ KL KLA  IG  G+ IAV TVVILIIRFCI +Y +K  +W   H++  + F IIGVTVLVVAVPEGLPLAVT++LAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F  G +Y++ +P+  D+P  + D +++ IA+NS+YTSR++  ++ GEL TQ+GNKTECSLLGF+   IGKDY  +R    ED+LIK+YTFNS RKSMST++  +     + TKGASE+++ KCSFI  KDG I+ FT+   + L+K VIEPMA DGLRTI +A+++FV    E QK Q  Y    + +DE NI+ +LTC+ +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSI++KCGI+KP DDF+++EGKEFN +IRD+   +I+Q  +D++WPRL+VLARSSP DKYTLV GIIDS L+  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVN+VAVIVAFVGAC + DSPLKAVQMLWVNLIMDTLASLALATELPT +LL R PYGRTK +ISR M+KNILGQ++YQLIV F L++ G    D++   GM A  ++ PS+HFT +FN FV+MTLFNEIN+RKIHGQR+VF GI  N IF +IWI T   Q++IIQ+G  A ST  L ++ WMWC+FFG G L+W QLV SVPT  +PKR        +E+P               LG     G    E K  GQ LWIRGL+RLQTQ
Sbjct:   42 AQYGVTLKQLRELMEVRGREGIQKMNTEFGGIQELCKKLYTSPNEGLSGSTNDLEHRRQTFGSNVIPPKPPKTFLQLVWEAIQDVTLIILQIAAVISLVLSL-CKFPKDKEAEEDRTSASLEEEGEHGWIEGVAILISVVVVVLVTAFNDYTKERQFRGLQNRIEHEHKFAVIRGAEVQQIPVGDLVVGDICQVKYGDLLPTDGVVIQSNDLKVDESSLTGESDHVKKGENRDPMLLSGTHVMEGSGRMLVTAVGINSQAGIIFALLGATQ------------EVEVPKEKKKNEEEIVTGNSHISVPDDSNAIPNKQEKSKVDESSSPRKEKSVLQAKLTKLAIQIGYAGSFIAVCTVVILIIRFCITSYVVKKKTWTPGHIEHFVKFFIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFICGIHYKR-VPKLTDIPSQVMDIIIQGIAINSAYTSRVIAPENPGELPTQLGNKTECSLLGFIVD-IGKDYQSIRDDLPEDRLIKVYTFNSERKSMSTVVPREGGGYRVYTKGASEIIMKKCSFIYAKDGKIEKFTRGMQDHLVKEVIEPMASDGLRTISVAFRDFVP--GEAQKNQVHYEITPNWDDEDNIVANLTCLAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARSISMKCGIIKPGDDFLILEGKEFNRRIRDAN-DEIQQHLLDKVWPRLKVLARSSPTDKYTLVKGIIDSKLNPNREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNIVAVIVAFVGACAIEDSPLKAVQMLWVNLIMDTLASLALATELPTSDLLLRKPYGRTKPLISRTMMKNILGQAIYQLIVIFLLLFFGHAFFDIET--GMYAPLHSAPSQHFTIIFNVFVMMTLFNEINARKIHGQRDVFTGIFTNPIFYLIWIGTVAAQVIIIQYGDRAFSTEGLTLDQWMWCLFFGCGVLVWGQLVTSVPTRRLPKRLSWGSGAPEEMP-----------ANVSLGDDGS-GMDSKETKRTGQILWIRGLTRLQTQ 1123          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0X3PD52 (Calcium-transporting ATPase OS=Schistocephalus solidus OX=70667 GN=TR110591 PE=3 SV=1)

HSP 1 Score: 1170.99 bits (3028), Expect = 0.000e+0
Identity = 693/1146 (60.47%), Postives = 857/1146 (74.78%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXX-XXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSV---------------ELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD-HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGS-EPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYG-ESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRT--DGVYGGVRRYTLSQVA 3420
            F I V +L  LM  R   A++ ++  Y  I  LC KLKTS ++GLS TD L  RREVFG+NVIPPKPPK F  L++EA+QDVTLI+L+ AA +SL L+LY+KY   E + D +ES+AGWIEGVAILGAV+VVV+V AFNDW KE+QFRGLQ+KIE +HK AVIR+G++ ++ V DI+VGDICQVKYGDLLPADGI++QSND+K+DES+LTGE D VKK    DP+LLSGTHV+EGSG++V+TAVG++SQAGIIF LLGA E ++   K  + +K     ++                  E E LT+ TE               E KKKKK   +K+ SVLQTKL KLA  IG  GTVIAVLTV IL+++F I T+ ++   W+   HLK+++ F+I GVTVLVVAVPEGLPLAVT++LAYSV+KMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ +   ++YR  LP  + LP   ++ LL+ I +NS YTS++LP    G L+ Q+GNKT+C+LLGF+N ++G +Y  +R  W E++L K+YTFNSVRKSMST+I+D     L+ TKGASEMV+ +C +I+  DG  + F+  D   L +SVIE MA DGLRTI LAYK F    S  P +      PN D  DE  II DLTC+ IVGIEDPVRPEVPPAI++CQ AGITVRMVTGDNVNTARSIA KCGIL+P ++F+VMEG+EFN +IRD  TG++KQ   D++W  LRVLARSSPQDKY LV+GII S     R+VVAVTGDGTND PALK+ADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVA++VAF+GA V++DSPLKAVQMLWVNLIMDTLASLALATELPT ELL R PYGRT  +++R M+KNIL  SLYQL V   L++ GE +L+VD+AR     GN++P++HFT++FNTFV+MTLFNE+N+RKIHGQRN+F G+ RN IF++IWI+TF+ QI+I+QFGGYA ST  LDI+ WMWC+FFG G L+W QL+  +P SI+P+ KKK   +P + E E +EE D    + P G  SE+E    GQ LWIRGL+RLQTQ      +   R   D  Y   +R +LS +A
Sbjct:   22 FDITVNDLQRLMETRGANAVKYLRECYGGIQGLCTKLKTSTHNGLSGTD-LPDRREVFGTNVIPPKPPKGFCVLVWEAIQDVTLIILIIAAFVSLALSLYTKYVDAEAAGDETESEAGWIEGVAILGAVLVVVLVVAFNDWSKERQFRGLQNKIESDHKFAVIRNGQLEQLPVSDILVGDICQVKYGDLLPADGILVQSNDLKIDESALTGESDQVKKSESKDPILLSGTHVVEGSGRIVITAVGVNSQAGIIFTLLGATEEDQSRKKSGSISKGQDGVEAGRGKKKGGVKSNPLETVPEAEALTNKTEGQ------------SEEKKKKKTRVRKEKSVLQTKLTKLAIQIGYAGTVIAVLTVFILVLKFSILTFAVEQQHWNTSKHLKRLVGFIITGVTVLVVAVPEGLPLAVTLALAYSVRKMMDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYVGEQHYR-TLPTASQLPNLTSELLLQGIPINSGYTSKVLPPPQPGGLIIQVGNKTDCALLGFVN-SLGGNYETVRQEWPEEQLYKVYTFNSVRKSMSTVIRDSKGGFLMFTKGASEMVVKRCKWILDADGKPKPFSDADQEILTRSVIEVMAGDGLRTICLAYKRFTTAPSGMPNEVTSPQEPNWD--DEDAIISDLTCLAIVGIEDPVRPEVPPAIRQCQEAGITVRMVTGDNVNTARSIATKCGILQPGENFLVMEGQEFNRRIRDKTTGQVKQELFDKVWLNLRVLARSSPQDKYVLVSGIIKSRAGPTRQVVAVTGDGTNDAPALKRADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAILVAFIGAAVVSDSPLKAVQMLWVNLIMDTLASLALATELPTPELLKREPYGRTTPLVNRMMIKNILFHSLYQLAVILSLLFAGEYILEVDSARASVEHGNSRPTQHFTSIFNTFVLMTLFNEMNARKIHGQRNIFSGLFRNWIFVVIWISTFILQILIVQFGGYAFSTKALDIDQWMWCLFFGIGELIWGQLIICIPDSIIPECKKKPTVKPGEVEEEEEEEEDI--EAEPSGIPSEEETAVKGQILWIRGLNRLQTQMQTLKVVNAFRMGLDARYDRDQRKSLSAIA 1148          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4D5R9F7 (Calcium-transporting ATPase OS=Scolopendra viridis OX=118503 PE=3 SV=1)

HSP 1 Score: 1170.22 bits (3026), Expect = 0.000e+0
Identity = 681/1123 (60.64%), Postives = 840/1123 (74.80%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXA-------GWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSI---LDNRTD 3375
            +++ I +K+L ELM  R  EAI++I  ++  +  LC KL TSPN+GLS +  DL  RR+ FGSNVIPPKPPKTFL+L++EALQDVTLI+L  AA+ISL L+L    S E+        A       GWIEGVAIL +VVVVV+VTAFND+ KE+QFRGLQ +IE  HK +VIR G + +I VGDIVVGDICQVKYGDLLP DGI+IQSND+KVDESSLTGE DHVKKG   DPMLLSGTH+MEGSG+M+V+AVG++SQAGIIF+LLGA +   +  K+  + ++     +  + +   T+  E               + +K ++   +K+ SVLQ KL KLA  IG  G+ IA+ TV+ILIIRFCI+ Y I+   W   HL+  + F IIGVTVLVVAVPEGLPLAVT++LAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+F  G +Y++  P Y+++P  + + ++  IALNS+YTSR++  ++ GE+  Q+GNKTEC+LLGF+   IG+DY  +R    ED+L K+YTFNSVRKSMSTI+  +     + TKGASE+++ KC+FI GK+G ++ FT++  + L+K VIEPMA DGLRTI LAY++FV   +E  +      PN D  DE  I+ +LTC+ +VGIEDPVRPEVP AI+KCQ +GITVRMVTGDN+NTARSI++KCGI+KP +DF+++EGKEFN +IRD+ +G+++Q  +D++WPRLRVLARSSP DKYTLV GIIDS L+  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVN+VAVIVAFVGAC + DSPLKAVQMLWVNLIMDTLASLALATELPT +LL R PYGRTK +ISR M+KNILGQ++YQL V F L++ G    D+D+  GM A     PS+HFT +FNTFV+MTLFNEIN+RKIHGQR+VF G+  N IF IIWI T   Q+VIIQFGG A ST  L ++ WMWC+FFG G L+W Q+V S+PT  +PKR       P     E       LG     G    E K  GQ LWIRGL+RLQTQ    N+    LD+R D
Sbjct:    9 AQYGITLKQLRELMEVRGREAIQKINTEFGGVQELCKKLYTSPNEGLSGSASDLEHRRQTFGSNVIPPKPPKTFLQLVWEALQDVTLIILQLAALISLILSLCKFSSDEDDHSEDRVGAVEDEGEHGWIEGVAILVSVVVVVLVTAFNDYTKERQFRGLQSRIEHEHKFSVIRGGEVQQIPVGDIVVGDICQVKYGDLLPTDGILIQSNDLKVDESSLTGESDHVKKGDTKDPMLLSGTHIMEGSGRMLVSAVGINSQAGIIFSLLGATQAEGEGQKKKKKDEELIMTGNSHMPIPDDTNALEK-----------PSGKDEKVEEGPPRKEKSVLQAKLTKLAIQIGYAGSCIAICTVIILIIRFCIKFYVIQKKEWKTSHLEHFVKFFIIGVTVLVVAVPEGLPLAVTLALAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFICGIHYKRT-PNYSEIPPQIGELIVHGIALNSAYTSRVMLPENPGEVPKQLGNKTECALLGFVL-EIGRDYQTIRDELPEDRLFKVYTFNSVRKSMSTIVHREGGGYRIYTKGASEIIMKKCTFIYGKEGKLEKFTRDMQDRLVKEVIEPMASDGLRTISLAYRDFVPGKAEVNQVHYDTEPNWD--DEDYIVNNLTCVCLVGIEDPVRPEVPEAIRKCQRSGITVRMVTGDNINTARSISMKCGIVKPGEDFLIIEGKEFNKRIRDA-SGEVQQHLLDKVWPRLRVLARSSPTDKYTLVKGIIDSKLNANREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNIVAVIVAFVGACAVEDSPLKAVQMLWVNLIMDTLASLALATELPTSDLLLRKPYGRTKPLISRTMMKNILGQAVYQLTVIFMLLFFGHKFFDIDS--GMGAPLRAPPSQHFTIIFNTFVMMTLFNEINARKIHGQRDVFTGVFTNPIFYIIWIGTAAAQVVIIQFGGLAFSTKELTLDQWMWCLFFGCGVLVWGQVVTSIPTRRLPKRLSWGSGTP-----EDIAANVSLGDDAA-GADAKETKRTGQILWIRGLTRLQTQIRVVNAFRMGLDSRYD 1107          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A067QGX4 (Calcium-transporting ATPase OS=Zootermopsis nevadensis OX=136037 GN=L798_02687 PE=3 SV=1)

HSP 1 Score: 1168.68 bits (3022), Expect = 0.000e+0
Identity = 685/1119 (61.22%), Postives = 842/1119 (75.25%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXA--GWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEK----------------LTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKS-PGQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E I +++ +Y  +  +C KL TSP++GLS +  D+  RR+ FGSN IPPKPPKTFL+L++EALQDVTLI+L  AA+ISL LA Y      E     E +   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ++IEG HK +VIR G + +I VGDIVVGDICQVKYGDLLPADGI+IQSND+KVDESSLTGE DHVKKG   DPMLLSGTHVMEGSGKM+V AVG++SQAGIIF LLGAA   +++  +  + +  K+ K  S+  E+                + DNT N +      DD  +        +S KK+ SVLQ KL KLA  IG  G++IA+LTVVIL+I+FCI+TY  +   W   H  +++ + IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVV+++   K  +  +P+++D+P ++ + L++ I++NS+YTS ++PG   GEL  Q+GNKTEC+LLGF+  A+GK Y  +R    E+   ++YTFNSVRKSMST++  +     L TKGASE+VL KC+FI G+DG ++ FT+   + L++ VIEPMA DGLRTI +AY+EFV   +E  +      PN D  DE N + +LTC+G+VGIEDPVRPEVP AIKKCQ AGITVRMVTGDN+NTARSIA KCGILKP DDFI++EGKEFN +IRDS  G+++Q  +D++WP+LRVLARSSP DKYTLV GIIDS +S +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE+PT +LL R PYGRTK +ISR M+KNILGQ++YQL V F L++ G+ +LD+   RG  A    KPS+HFT +FNTFV+MTLFNEIN+RKIHGQRNVF GI  N IF  IW+ T + Q++IIQ+G  A STA L +E WMWC+FFG G+LLW QLV +VPT  +PK        P     E   E   LG      +S+D  K   GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGISLKQLRELMETRGREGIAKMQ-EYGGVQEVCKKLYTSPSEGLSGSKVDVEHRRDTFGSNTIPPKPPKTFLQLVWEALQDVTLIILEVAAIISLALAFYPHDDSAEGPQLDEDEGNHGWIEGLAILISVIVVVIVTAFNDYTKERQFRGLQNRIEGEHKFSVIRGGEVKQISVGDIVVGDICQVKYGDLLPADGILIQSNDLKVDESSLTGESDHVKKGEHVDPMLLSGTHVMEGSGKMLVAAVGVNSQAGIIFTLLGAAVDQQEAEIKKRKKEAKKQRKKKSLTGEEDVAPVTGNSHVSVPAPIADNTPNKH------DDALENHKPAPASESHKKEKSVLQAKLTKLAIQIGYAGSMIAMLTVVILVIQFCIKTYVFEESGWKSSHASELVKYFIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVESYICEKLSK-TIPKFSDIPPHVANTLIQAISINSAYTSCIMPGDGAGELPKQVGNKTECALLGFVE-ALGKRYQTIRDDIPEEVFTRVYTFNSVRKSMSTVVPRQGGGYRLFTKGASEIVLKKCAFIYGRDGHLEKFTREMQDRLVRQVIEPMACDGLRTISIAYREFVPGKAEINQVHIDSEPNWD--DEENTVNNLTCVGLVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARSIATKCGILKPGDDFIILEGKEFNRRIRDSN-GEVQQHLLDKVWPKLRVLARSSPTDKYTLVKGIIDSKVSESREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEMPTSDLLLRKPYGRTKPLISRTMMKNILGQAIYQLTVIFALLFVGDKMLDIPTGRG--AEYGAKPSQHFTIIFNTFVMMTLFNEINARKIHGQRNVFEGIFTNPIFYTIWVCTCLAQVLIIQWGRMAFSTASLSLEQWMWCLFFGIGTLLWGQLVTTVPTRKIPKILSWGRGHP-----EEYTEAITLGEEKYDPDSQDGKKPRAGQILWIRGLTRLQTQ 1108          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A2J7R4L4 (Calcium-transporting ATPase OS=Cryptotermes secundus OX=105785 GN=ATP2B3_6 PE=3 SV=1)

HSP 1 Score: 1167.14 bits (3018), Expect = 0.000e+0
Identity = 691/1108 (62.36%), Postives = 838/1108 (75.63%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXA--GWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAA----ELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN--VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSP--GQKLWIRGLSRLQTQ 3336
            +++ I +K+L ELM  R  E I +I++ Y  +  +C KL TSP++GLS +  D+  RR+ FGSN IPPKPPKTFL+L++EALQDVTLI+L  AAVISL LA Y      E     E +   GWIEG+AIL +V+VVV+VTAFND+ KE+QFRGLQ +IEG HK +VIR+G + +I VGDIVVGDICQVKYGDLLPADGI+IQSND+KVDESSLTGE DHVKKG   DPMLLSGTHVMEGSGKM+V AVG++SQAGIIF LLGAA    E   K  K+  E        S       + DNT N +      DD  +        +S KK+ SVLQ KL KLA  IG  G++IA+LTVVILIIRFCIETY ++   W   H  +++ + IIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++   K  +  +P+++D+P ++ + L++ IA+NS+YTSR++P    GEL  Q+GNKTEC+LLGF+  A+GK+Y  +R    E+   ++YTFNSVRKSMST+I  +     L +KGASE+VL KC+FI G+DG ++ FT+   + L++ VIEPMA DGLRTI +AY++FV   +E  +      PN D  DE + + +LTC+G+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTARSIA KCGILKP DDF+++EGKEFN +IRDS  G+++Q  +D++WP+LRVLARSSP DKYTLV GIIDS +S  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATELPT +LL R PYGRTK +ISR M+KNILGQ++YQL V F L++ G+ +LD+ + RG T  G +KPS+HFT +FNTFV+MTLFNEIN+RKIHGQRNVF GI  N IF  IWI T + Q++IIQ+G  A STA L +E W+WC+FFG G+LLW QLV +VPT  +PK        P     E   E   LG    +     E K P  GQ LWIRGL+RLQTQ
Sbjct:    9 AQYGITLKQLRELMETRGREGIAKIQD-YGGVQEICKKLYTSPSEGLSGSKVDIEHRRDTFGSNTIPPKPPKTFLQLVWEALQDVTLIILEIAAVISLALAFYPHDDSSEGPKIDEDEGQHGWIEGLAILISVIVVVIVTAFNDYTKERQFRGLQSRIEGEHKFSVIRAGEVKQISVGDIVVGDICQVKYGDLLPADGILIQSNDLKVDESSLTGESDHVKKGEHYDPMLLSGTHVMEGSGKMIVAAVGVNSQAGIIFTLLGAAVDEQEAEIKKRKKGEEETAPVTGNSHVSVPAPIADNTPNKH------DDALENHKPAPASESHKKEKSVLQAKLTKLAIQIGYAGSMIAMLTVVILIIRFCIETYVVEQRGWMSSHASELVKYFIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLSK-TIPKFSDIPSHVGNLLIQAIAVNSAYTSRVMPPDGPGELPKQVGNKTECALLGFVQ-ALGKNYQTVRDDIPEEMFTRVYTFNSVRKSMSTVIPRQGGGYRLFSKGASEIVLKKCAFIYGRDGHLEKFTREMQDRLVRQVIEPMACDGLRTISIAYRDFVPGKAEINQVHIDSEPNWD--DEEHTVNNLTCLGLVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARSIATKCGILKPGDDFLILEGKEFNRRIRDS-NGEVQQHLLDRVWPKLRVLARSSPTDKYTLVKGIIDSKVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVRDSPLKAVQMLWVNLIMDTLASLALATELPTPDLLLRKPYGRTKPLISRTMMKNILGQAIYQLGVIFALLFVGDKMLDIPSGRG-TEYG-SKPSQHFTIIFNTFVMMTLFNEINARKIHGQRNVFEGIFTNPIFYSIWICTCLAQVLIIQWGRMAFSTATLSLEQWLWCLFFGIGTLLWGQLVTTVPTRKIPKILSWGRGHP-----EEYTEAITLGEEK-FDPDSQEGKKPRAGQILWIRGLTRLQTQ 1096          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:103024646])

HSP 1 Score: 1075.46 bits (2780), Expect = 0.000e+0
Identity = 654/1140 (57.37%), Postives = 823/1140 (72.19%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            F + + EL  LM  R  EA+++I+  Y D   LC +LK+S  DGLS    DL  R + FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V D+VVGD+ QVKYGDLLP DGI+IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLG A   E+  KE    +     +++  + +K            K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ   N +++R+ +P+ + +  N  + ++  IA+NS+YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE++L KCS I+G  G  ++F   D +E++K VIEPMA +GLRTI +AY++   D            P  + E+E +I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:   34 FGVSLDELRSLMELRGAEALQKIQENYGDTEGLCQRLKSSTTDGLSDNPADLERRAQAFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYQPPGEESEACGNVSGGGEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNGNVIQIPVADMVVGDVAQVKYGDLLPTDGILIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLG-AGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVQRRTWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQVHLNDQHFRE-IPEPSQVNPNTLEMVVNAIAINSAYTSKIMPPDVEGGLPKQVGNKTECGLLGFVLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQLPDGSFRLYSKGASEILLKKCSSILGAGGETRSFRPRDRDEMVKKVIEPMACEGLRTICIAYRDLPGD------------PEPEWENEADIVTDLTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--NAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQIVIVQFGGKPFSCAPLNMEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGTGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1148          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:103024646])

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 643/1127 (57.05%), Postives = 816/1127 (72.40%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELE-KLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            F + + EL  LM  R  EA+++I+  Y D   LC +LK+S  DGLS    DL  R + FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V D+VVGD+ QVKYGDLLP DGI+IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLGA E  E+  ++    +  +  +  +V +E +   + E   + +++K      + +K          SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ   N +++R+ +P+ + +  N  + ++  IA+NS+YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE++L KCS I+G  G  ++F   D +E++K VIEPMA +GLRTI +AY++   D            P  + E+E +I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ     +   +  DG+
Sbjct:   28 FGVSLDELRSLMELRGAEALQKIQENYGDTEGLCQRLKSSTTDGLSDNPADLERRAQAFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYQPPGEESEACGNVSGGGEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNGNVIQIPVADMVVGDVAQVKYGDLLPTDGILIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLGAGEGEEEKKEKKGRCEVEEAKQDGAVAMEMQPLKSAEGGEVEEREKKKANVPKKEK----------SVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVQRRTWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQVHLNDQHFRE-IPEPSQVNPNTLEMVVNAIAINSAYTSKIMPPDVEGGLPKQVGNKTECGLLGFVLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQLPDGSFRLYSKGASEILLKKCSSILGAGGETRSFRPRDRDEMVKKVIEPMACEGLRTICIAYRDLPGD------------PEPEWENEADIVTDLTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--NAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQIVIVQFGGKPFSCAPLNMEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGTGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMRVVKAFRSSLYDGI 1122          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b4 (ATPase plasma membrane Ca2+ transporting 4 [Source:NCBI gene;Acc:103040534])

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 632/1130 (55.93%), Postives = 802/1130 (70.97%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSAT-DDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXX---------XXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKN---VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            D  F   V +L ELM  R  EA+ +I++ + D+  +C +LKTSP +GLS    DL  R   FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y    G+  +             S AGWIEG AIL +V++VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V +IVVGDI Q+KYGDLLPADGI+IQ ND+K+DESSLTGE D V+K ++ DPMLLSGTHVMEGSG+MVVTAVGL+SQ GIIF LLGA         E  E K  K    D + LE      ++   ++ ++ +  + + + KK    KK+ SVLQ KL +LA  IGK G +++ +TV+ILI+ F I T+ +    W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+    +Y++ +P+   +     + ++ +I++NS+YT+++L  + +G L   +GNKTEC+LLG +   + +DY  +R    E+KL K+YTFNS RKSMST++K+ +     + +KGASE++L KCS+I+   G  + F   D +E+++ VIEPMA DGLRTI +A ++F  D            PN D  +E +I+ DLTCI +VGIEDPVRPEVP AI KCQ AGITVRMVTGDN+NTAR+IA KCGIL P +DF+ +EGKEFN +IR+ K G+++Q ++D++WP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL VTF L++ GE + ++D+ R      ++ PSEH+T +FN FV+M LFNEIN+RKIHG+RNVF GI RN IF  + I TF  QI+I+QFGG   S   L ++ W+WC+F G G LLW Q + ++PT     R K           E  ++ ++         +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:   20 DGDFGCTVMDLRELMELRSAEAVNKIRDTHGDVQGICRRLKTSPIEGLSGNPSDLEKRHTAFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPQGGDSNACGQAVGGVEDEGESQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQISVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDQVRKSLEKDPMLLSGTHVMEGSGRMVVTAVGLNSQTGIIFTLLGAG-------GEEEEKKVKKAKTQDGIALE--IQPLKSDEGAEAEEKEEKEPQKEVKKVNVTKKEKSVLQGKLTRLAVQIGKAGLIMSAVTVIILILYFVISTFGVNKQEWKAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYVGDTHYKK-VPEPEAINPETLELMVNSISINSAYTTKILSPEREGGLPRHVGNKTECALLGLVLD-LKRDYQPIRDEVPEEKLYKVYTFNSSRKSMSTVLKNPDGSGFRMYSKGASEIILRKCSYILDAAGQPRVFKPKDRDEMVRKVIEPMACDGLRTICVAKRDFTGDE-----------PNWD--NEADILTDLTCICVVGIEDPVRPEVPEAISKCQRAGITVRMVTGDNINTARAIATKCGILLPGEDFLCLEGKEFNQQIRNDK-GEVEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRKPYGRDKPLISRTMMKNILGHAVYQLSVTFTLLFAGEKIFNIDSGRNSPL--HSPPSEHYTIIFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVIGTFALQIIIVQFGGKPFSCTGLTLDQWLWCVFIGVGELLWGQFITAIPT----HRLKFLKEAGHGITKEEIQQEEQTEDVDEIDHAEMELRR-GQILWFRGLNRIQTQIKVVNAFRSSLYEGL 1117          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 1018.07 bits (2631), Expect = 0.000e+0
Identity = 635/1146 (55.41%), Postives = 796/1146 (69.46%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKA------VQMLWVNL------------IMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKK-EIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ----QSKRNSILD 3363
            +  F + ++EL  LM FR  E++++I+  Y D   LC +LKTSP DGLS    DL  R+EVFG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V ++VVGD+ QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K VD DPMLLSGTHVMEGSGKMVVTAVG++SQ GIIF LLGA E+ E+  +     +      + +  L K  +         K  +    EE +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ I+   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ +   ++Y + +P    +  +  + L   I+LNS+YTS+++    +G L  Q+GNKTEC+LLG +   + +DY  +R    E+KL K+YTFNSVRKSMST+++  D +  + +KGASE++L KCS I+ +DG+ + F   D ++++K VIEPMA DGLRTI +AY++   D            P  D ++E +II +LTCI +VGIEDPVRPEVP AI KCQ AGITVRMVTGDN+NTAR+IA KCGI++  DDF+ MEGK+FN +IR+ K G+++Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKA         L V L            IMDT ASLALATE PTE LL R PYGR   +ISR M+KNILG  +YQL++ F L++ GE + D+D+ R   A  +  PSEH+T +FNTF             IHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S +PL++E W+WC+F G G LLW QL++SVPTS +   K+    P P+    E   E            +E EL+  GQ LW RGL+R+QTQ    ++ R+S+ D
Sbjct:   24 EGDFGVSLEELRTLMEFRGAESLQKIQESYGDTEGLCQRLKTSPTDGLSDDPADLEKRKEVFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYQPPGGDTEACGNVSSGVEDEGEAEAGWIEGAAILLSVLCVVIVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNGTVLQIPVAEMVVGDVAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKAVDRDPMLLSGTHVMEGSGKMVVTAVGINSQTGIIFTLLGAGEMEEEKKENKKGKQDGALENNQNKAL-KQDEAVAMEMQPLKSAEGGEVEEREKKKSNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIETFVIQDRPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQIYVGDQHYHE-IPSPQHISHHTLELLTTAISLNSAYTSKIMAADKEGGLPKQVGNKTECALLGLVLD-LKRDYQCVREQIPEEKLYKVYTFNSVRKSMSTVVQLPDGSFRIYSKGASEILLKKCSSILSRDGAARPFRPRDRDDMVKKVIEPMACDGLRTICVAYRDIPGD------------PLPDWDNEADIINNLTCITVVGIEDPVRPEVPDAISKCQRAGITVRMVTGDNINTARAIAAKCGIIQAGDDFLCMEGKDFNRRIRNEK-GEVEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTICEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKADSTVNKCVFLCVGLSPEGGPDVMGESIMDTFASLALATEPPTEALLLRKPYGRNNPLISRTMMKNILGHGVYQLVIIFTLLFVGEQIFDIDSGR--EAPLHAPPSEHYTIIFNTF-------------IHGERNVFDGIFANPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLNVEQWLWCLFVGLGELLWGQLISSVPTSQLKCLKEAGHGPAPDDIMDEDLAE-----DEDEIDHAERELRR-GQILWFRGLNRIQTQIRVVKAFRSSLYD 1132          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:103024646])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 484/808 (59.90%), Postives = 606/808 (75.00%), Query Frame = 1
Query: 1018 SVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYT--LSQV 3417
            SVLQ KL KLA  IGK G V++ +TV+IL++ F IET+ ++  +W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ   N +++R+ +P+ + +  N  + ++  IA+NS+YTS+++P   +G L  Q+GNKTEC LLGF+   + +DYA +R    E+KL K+YTFNSVRKSMST+++  D +  L +KGASE++L KCS I+G  G  ++F   D +E++K VIEPMA +GLRTI +AY++   D            P  + E+E +I+ DLTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI++P DDF+ +EGK+FN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+QFGG   S APL++E W+WC+F G G LLW Q++ +VPTS + K  K+    P  DE   DE  ++         +E EL+  GQ LW RGL+R+QTQ    ++    R+    G VRR +  LSQ+
Sbjct:  383 SVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVQRRTWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQVHLNDQHFRE-IPEPSQVNPNTLEMVVNAIAINSAYTSKIMPPDVEGGLPKQVGNKTECGLLGFVLD-LKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQLPDGSFRLYSKGASEILLKKCSSILGAGGETRSFRPRDRDEMVKKVIEPMACEGLRTICIAYRDLPGD------------PEPEWENEADIVTDLTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGDDFLCLEGKDFNRRIRNEK-GEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGR--NAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQIVIVQFGGKPFSCAPLNMEQWLWCLFVGVGELLWGQVIATVPTSHL-KCLKEAGTGPGTDEMTEDELAEDEEEID---HAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1166          

HSP 2 Score: 278.1 bits (710), Expect = 4.394e-76
Identity = 158/268 (58.96%), Postives = 195/268 (72.76%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK---------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGA 825
            F + + EL  LM  R  EA+++I+  Y D   LC +LK+S  DGLS    DL  R + FG N IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y                  D  E++AGWIEG AIL +V+ VV+VTAFNDW KEKQFRGLQ +IE   + AV+R+G + +I V D+VVGD+ QVKYGDLLP DGI+IQ ND+K+DESSLTGE DHV+K  D DPMLLSGTHVMEGSG+M+VTAVG++SQ+GIIF LLGA
Sbjct:   34 FGVSLDELRSLMELRGAEALQKIQENYGDTEGLCQRLKSSTTDGLSDNPADLERRAQAFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYQPPGEESEACGNVSGGGEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNGNVIQIPVADMVVGDVAQVKYGDLLPTDGILIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLGA 301          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007912.1 (pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 gene:ENSPMAG00000007146.1 transcript:ENSPMAT00000007912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 436.802 bits (1122), Expect = 3.850e-140
Identity = 233/401 (58.10%), Postives = 295/401 (73.57%), Query Frame = 1
Query: 1018 SVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSK 2202
            SVLQ KL KLA  IGK G V++ +TVVIL++ F IET+ ++ M W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQA+    +Y  ++P  + L   + D L   IA+N +YT+++LP + +G L  Q+GNKTEC+LLG +   + +DY  +R    E++L K+YTFNSVRKSMST++   D    L +KGASE++L KCS I+G  G  + F   D +E+++ VIEPMA DGLRTI LAY++F   GSEP+            +DE+ I+ +LTC+ +VGIEDPVRPEVP AIK CQ AGITVRMVTGDN+NTAR+IA KCGIL P +DF+ +EGKEFN +IR+ K
Sbjct:   39 SVLQGKLTKLAVQIGKAGLVMSAITVVILVLYFVIETFWVQGMPWLPECTPIYVQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHY-CSVPSPDALAPAIMDVLTTGIAVNCAYTTKILPPEKEGGLPRQVGNKTECALLGLL-AEMRRDYQAVRDELPEERLYKVYTFNSVRKSMSTVLHNADGGFRLYSKGASEILLKKCSRILGATGETRGFRLRDRDEMVRKVIEPMACDGLRTICLAYRDF-PIGSEPK-----------WDDENAIVNELTCVTVVGIEDPVRPEVPNAIKMCQRAGITVRMVTGDNINTARAIASKCGILHPNEDFLCIEGKEFNRRIRNDK 425          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001468.1 (pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 gene:ENSPMAG00000001326.1 transcript:ENSPMAT00000001468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.136 bits (640), Expect = 9.769e-76
Identity = 139/241 (57.68%), Postives = 166/241 (68.88%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX---------XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSG 735
            D  F + V EL  LM  R  EAI  ++  Y     +C +L TSPNDGL  T  DL  RR VFG N IPPK PKTFL L++EALQDVTLI+L  AA++SLGL+ Y                  D  ES AGWIEG AIL +V  VV+VTAFNDW KE+QFRGLQ +IE   + +VIR G++ ++ V DIVVGDI QVKYGDLLPADG++IQSND+K+DESSLTGE DHV+K +D DPMLLSG
Sbjct:   23 DGDFGLSVDELRALMELRGPEAIAMVQEAYGGKEGVCRRLHTSPNDGLPGTAADLEKRRLVFGQNFIPPKKPKTFLELVWEALQDVTLIILEIAAIVSLGLSFYQPPGQNSDMCGSVSGGAEDEGESAAGWIEGAAILLSVACVVLVTAFNDWSKERQFRGLQSRIEQEQRFSVIRGGQLLQLPVADIVVGDIAQVKYGDLLPADGMLIQSNDLKIDESSLTGESDHVRKSIDRDPMLLSG 263          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010087.1 (pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 gene:ENSPMAG00000009128.1 transcript:ENSPMAT00000010087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.751 bits (639), Expect = 1.075e-75
Identity = 137/240 (57.08%), Postives = 172/240 (71.67%), Query Frame = 1
Query:   49 KFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLS-ATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXX----------XXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSG 735
            +F   + EL  LM  R   A+ +I+ KY D+  LC +LKTSP DGLS +  DL  RR+ FG NVIPP+  K+FL L++EALQDVTLI+L  AA++SLGL+ Y                   D  E++AGWIEGVAIL +V VVV+VTAFNDW KE+QFRGLQ++IE   K AV+R+G++ +I V +I VGD+ QVKYGDLLPADG++IQSND+K+DESSLTGE DHVKK  D DPMLLSG
Sbjct:   21 QFGCSLMELRSLMELRGETALHDIQQKYTDVPGLCRRLKTSPTDGLSDSVSDLERRRQAFGRNVIPPQKAKSFLELVWEALQDVTLIILEIAAIVSLGLSFYRPPEESSDECGMLAGGGGGDDGEAEAGWIEGVAILFSVAVVVLVTAFNDWSKERQFRGLQNRIEQEQKFAVVRNGQVVQIPVAEISVGDVAQVKYGDLLPADGVLIQSNDLKIDESSLTGESDHVKKSADRDPMLLSG 260          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002775.1 (pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gene:ENSPMAG00000002528.1 transcript:ENSPMAT00000002775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.21 bits (635), Expect = 2.153e-75
Identity = 137/225 (60.89%), Postives = 169/225 (75.11%), Query Frame = 1
Query:  181 GLSA-TDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKY---------XXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGA 825
            GLS   +DL  RR+ FG N IPPK PK+F+ L++ ALQDVTLI+L  AAV+SLGL+ Y                + + + SD GWIEG AIL  VVVVV+VTAFNDW KE+QFRGLQ +IE   K +VIR G++ E+ V ++VVGD+ QVKYGDLLPADG+++Q N++ VDESSLTGE DH+ K  D DPMLLSGTHVMEGSG+MVVTAVG++SQ+GIIF LLGA
Sbjct:    1 GLSGDPEDLEWRRKTFGRNHIPPKKPKSFVALVWHALQDVTLIILEVAAVVSLGLSFYRPPEGENTELCGQSSGSIEEAGSDTGWIEGTAILLTVVVVVLVTAFNDWSKERQFRGLQSRIEQEQKFSVIRGGQLVEVHVAELVVGDVAQVKYGDLLPADGVLLQGNELSVDESSLTGESDHLSKSPDCDPMLLSGTHVMEGSGRMVVTAVGINSQSGIIFTLLGA 225          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007505.1 (pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gene:ENSPMAG00000006781.1 transcript:ENSPMAT00000007505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 1.525e-59
Identity = 129/154 (83.77%), Postives = 138/154 (89.61%), Query Frame = 1
Query: 2353 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHG 2814
            DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K ++SR M KNILG ++YQL V F L++ G
Sbjct:    1 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRRPYGRNKPLVSRTMTKNILGHAIYQLTVIFTLLFAG 154          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 363.614 bits (932), Expect = 1.139e-105
Identity = 292/761 (38.37%), Postives = 409/761 (53.75%), Query Frame = 1
Query: 1171 KMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF-FNGKY---------YRQNLPQYNDLPEN----LTDKLLKNIALNSS-YTSR-------------------------------------------LLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTE-------DKLIKIYTFNSVRKSMSTIIKDKN-------VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVD-DGSEPQKGQDIYLPNID-LEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPE---DDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTD--SPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIH--------------GQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPK 3174
            K ++  I  +TV+VVAVPEGLPLAVT++LA++  +M KD NLVR L +CETMG+ATA+CSDKTGTLT N MTVV+ F  N K+          ++ L       EN    L + LL NI LNS+ + +R                                           L    ++G     IG+KTE +LL     ++G    EL+ +  +       +K+++   F S RK    ++K K             KGA+E+V   CS+    D +++   +++  E     I+ +A D LR I +A+K+F + D   P++ +D   PNI  L+   N  K L   G++GI+DP+R  V  ++++CQ AG+TVRMVTGDN+ TA++IA  C IL  +   + +  MEG EF          K+ +++  +I P LRVLARSSP+DK  LV       L    +VVAVTGDGTND PALK ADVGF+MGI+GT+VA+EASDIIL  D+F++IV A+ WGR V  SI KF+QFQL VN+ AVI+ FV +   +D  S L AVQ+LW+NLIMDTLA+LALAT+ P   ++DR P GR+ S+IS    K IL Q+  QLIVTF L ++G  L    +   +T+    + +      FNTFV +  F  + SRK+                  N F  + RN  F+ I       Q++I+ FGG   S A      W+  +  G  SL+   LV   P  +  K
Sbjct:  385 KFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKE-TDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFR---------KLTKNERIRILPNLRVLARSSPEDKRLLV-----ETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLN---AMTFNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQVLIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVK 1127          

HSP 2 Score: 118.627 bits (296), Expect = 3.593e-27
Identity = 94/269 (34.94%), Postives = 143/269 (53.16%), Query Frame = 1
Query:  142 NNLCAKLKTSPNDGLSATDDLILRR----EVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXX---XXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKK--------------GVDT--------------------DPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGA 825
            N+L   LKT  N G+S  +    R+    + +G N +P + PK+FL+L++ A  D T+ +L  AAV+S  L LY  +      D   +      WIEGVAI+ AV VVV+V+A ND+QKE QF  L  K E N KI VIR+ +   I +  ++VGD+  ++ GD++PAD ++I S   + DESS+TGE + ++K               +D+                    D ML+SG+ ++ G G+ V+T+VG++S  G     L A
Sbjct:   60 NSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKE-NRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNA 326          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 249.98 bits (637), Expect = 8.162e-69
Identity = 194/604 (32.12%), Postives = 305/604 (50.50%), Query Frame = 1
Query: 1192 IGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFF---------------NGKYYRQNLPQYNDLPENLTDKL-LKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII---KDKNVLLLTKGASEMVLS-KCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSR 2943
            I V++ V A+PEGLP+ VT++LA  V +M K   +VR L + ET+G+   ICSDKTGTLT+N MTV + +                N K    N    N L E++ + L + N+  N+S++          E    +GN T+ +LL  +         E+  I    + ++   FNS RK M+T I    D    +  KGA E +L    S++  K    +  T+      I      MA +GLR  G A K  + D S P                 ++IKDLT  G++G+ DP RP V  AI++    G+ + M+TGD+ NTA +IA + GI   +    V+ G          K  ++   ++  +   + + AR++P+ K  +V       L    +VVA+TGDG ND PALK +D+G +MG  GTDVAKEASD++LTDD+F++I+ A+  G+ ++++I  FL FQL+ +V A+ +  +       +PL A+Q+LW+N++MD   + +L  E    E++ + P  RT  I++  ++K +L  +   ++ T Y I+  E+  D      +TAR         T  F  FV   +FN +  R
Sbjct:  318 ISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFSQ---------EHAIFLGNPTDVALLEQLANF------EMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQ-KATINECANSMASEGLRVFGFA-KLTLSDSSTPLT--------------EDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSG---------DKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRA-----LRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVY-IFVKEMAED----GKVTARDT-------TMTFTCFVFFDMFNALACR 864          

HSP 2 Score: 76.6406 bits (187), Expect = 2.166e-14
Identity = 59/245 (24.08%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  157 KLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKT-FLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDT-------------------DPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAE 831
            KL T  N GL ++++   RR ++G N I  +  ++ F + +   ++D  +++L+G+AV+SL +           +       G+++                  +++ EK    L   +    +  ++R G+   +L   +V GD+   + GD +PAD  II++ D+ +DES+LTGE + V K   T                     +   GT V EG GK +V   G ++  G +F ++   E
Sbjct:   49 KLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQ------------------EYRSEKSLEALNKLVPA--ECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIE 273          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 197.978 bits (502), Expect = 8.042e-52
Identity = 191/657 (29.07%), Postives = 285/657 (43.38%), Query Frame = 1
Query: 1189 IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF-----------------------------------------------FNGKYYRQNLPQYNDLPENLTDKLLKN--------------------------IALNSSYTSRLLPGKS-QGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII---KDKNVLLLTKGASEMVLSKCSFIVGKDG-SIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPED---------DFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDS------PLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNIL-------GQSLYQLIVTFYLIWHGEILLDVDNARGMTAR 2859
            I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q +                                               F  + Y ++LP+  D+  +L  K L+                           IA+    T   LP  +  GE  T   N+ + S L   N   G    E          I  + F+S  K MS++     ++   +  KGA E ++S CS   GKDG  I   T  D  E I+  +  ++ +GLR +G A K F  D     +  D  L NI   +      DL  +G++GI DP R E   A+KK   AGI V M+TGD V TA++IA + GIL P +         D +VM G +F+          + + ++D +     V+AR SPQ K  ++       L   ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+  QL    VA  +  +   V  D       PL  V++LW+ ++     ++ L  E    +L+DR P      I +  ++ +         G  +     + Y I  G +  D D     + R
Sbjct:  315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPE--DIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH---------IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV-ETIRKNVYSLSNEGLRVLGFASKSFTKD-----QVNDDQLKNI-TSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCR 937          

HSP 2 Score: 56.6102 bits (135), Expect = 2.679e-8
Identity = 60/227 (26.43%), Postives = 100/227 (44.05%), Query Frame = 1
Query:  166 TSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGV-------------DTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGII 807
            TS  +GL+  D+ + R +  G N +       +  ++   + +  ++VL    VIS+ ++   +               WI G  I   + V V++    +++  K    L++    N    VIR+G+   I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K               D   +  S + V++G  K +V    L+S+ G I
Sbjct:   31 TSLTEGLTQ-DESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVL----VISMAISFAVR--------------DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKI 236          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 190.66 bits (483), Expect = 1.595e-49
Identity = 189/657 (28.77%), Postives = 288/657 (43.84%), Query Frame = 1
Query: 1189 IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKT------------------GTLTTNR-----------MTVVQAF------------------FNGKYYRQNLPQYNDLPENLTDKLLKN--------------------------IALNSSYTSRLLPGKS-QGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII---KDKNVLLLTKGASEMVLSKCSFIVGKDG-SIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPED---------DFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDS------PLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNIL-------GQSLYQLIVTFYLIWHGEILLDVDNARGMTAR 2859
            I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKT                  GT+T +            ++++  F                  F  + Y ++LP+  D+  +L  K L+                           IA+    T   LP  +  GE  T   N+ + S L   N   G    E          I  + F+S  K MS++     ++   +  KGA E ++S CS   GKDG  I   T  D  E I+  +  ++ +GLR +G A K F  D     +  D  L NI   +      DL  +G++GI DP R E   A+KK   AGI V M+TGD V TA++IA + GIL P +         D +VM G +F+          + + ++D +     V+AR SPQ K  ++       L   ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+  QL    VA  +  +   V  D       PL  V++LW+ ++     ++ L  E    +L+DR P+     I +  ++ +         G  +     + Y I  G +  D D     + R
Sbjct:  315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPE--DIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH---------IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV-ETIRKNVYSLSNEGLRVLGFASKSFTKD-----QVNDDQLKNI-TSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCR 937          

HSP 2 Score: 56.9954 bits (136), Expect = 2.380e-8
Identity = 60/227 (26.43%), Postives = 100/227 (44.05%), Query Frame = 1
Query:  166 TSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGV-------------DTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGII 807
            TS  +GL+  D+ + R +  G N +       +  ++   + +  ++VL    VIS+ ++   +               WI G  I   + V V++    +++  K    L++    N    VIR+G+   I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K               D   +  S + V++G  K +V    L+S+ G I
Sbjct:   31 TSLTEGLTQ-DESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVL----VISMAISFAVR--------------DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKI 236          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 189.504 bits (480), Expect = 4.315e-49
Identity = 188/657 (28.61%), Postives = 287/657 (43.68%), Query Frame = 1
Query: 1189 IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKT------------------GTLTTNR-----------MTVVQAF------------------FNGKYYRQNLPQYNDLPENLTDKLLKN--------------------------IALNSSYTSRLLPGKS-QGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII---KDKNVLLLTKGASEMVLSKCSFIVGKDG-SIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPED---------DFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDS------PLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNIL-------GQSLYQLIVTFYLIWHGEILLDVDNARGMTAR 2859
            I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKT                  GT+T +            ++++  F                  F  + Y ++LP+  D+  +L  K L+                           IA+    T   LP  +  GE  T   N+ + S L   N   G    E          I  + F+S  K MS++     ++   +  KGA E ++S CS   GKDG  I   T  D  E I+  +  ++ +GLR +G A K F  D     +  D  L NI   +      DL  +G++GI DP R E   A+KK   AGI V M+TGD V TA++IA + GIL P +         D +VM G +F+          + + ++D +     V+AR SPQ K  ++       L   ++   +TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+  QL    VA  +  +   V  D       PL  V++LW+ ++     ++ L  E    +L+DR P+     I +  ++ +         G  +     + Y I  G +  D D     + R
Sbjct:  315 IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPE--DIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEH---------IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDV-ETIRKNVYSLSNEGLRVLGFASKSFTKD-----QVNDDQLKNI-TSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFV-LQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCR 937          

HSP 2 Score: 60.4622 bits (145), Expect = 2.210e-9
Identity = 59/227 (25.99%), Postives = 99/227 (43.61%), Query Frame = 1
Query:  166 TSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGV-------------DTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGII 807
            TS  +GL+  D+ + R +  G N +       +  ++   + +  ++VL+ + +IS  +                    WI G  I   + V V++    +++  K    L++    N    VIR+G+   I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K               D   +  S + V++G  K +V    L+S+ G I
Sbjct:   31 TSLTEGLTQ-DEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMH------------------DWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAH--VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKI 236          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 991.104 bits (2561), Expect = 0.000e+0
Identity = 608/1102 (55.17%), Postives = 758/1102 (68.78%), Query Frame = 1
Query:   58 IGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSA-TDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAA--ELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTS-TPYG---ESEDELKSPGQKLWIRGLSRLQTQ 3336
            I V +L +LM  R  EA + + +    ++ L  KL TS   G+S   +D+  R+ VFG NVIPPKPPKTF   + +A +D TLI+L  AAV+SL L +++     E    SE++ GWI+G AIL AV +V +VTA ND+QKE+QFRGLQ KIE  HK  VIR+G   EIL  +IVVGD+CQ+KYGDLLPADG+++QSND+KVDESSLTGE D VKKG + DP+ L+GTH+MEGSGKM+VTAVGL+SQ+GIIF LLGA   +  +     P ++   K    D  E   L D+ E+               ++  K++  K++ SVLQ KL KLA  IG  G   A+LT++++ ++F I  Y  +  SW   HL   ++  I G+TVLVVAVPEGLPLAVTISLAYSVKKM+ DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ +  G++++       +    L + L K IALNSSY S  +    +  L  Q+GNKTEC+LLG +   +G  Y + R    E   +K+YTFNS RKSMST I+  D    L +KGASE++LS+C+ I+G++G  + F+  D   L++SVIEPMA DGLRTI +AY++F      P  G+D      D +DE  I+ ++T I I GIEDPVR EVP AIKKCQ AGI VRMVTGDNVNTARSIA KCGIL+P+ DF+V++GKEFN  IRDS  G++ Q K D+IWPRLRVLARSSP+DKYTLV GIIDS L+ ARE+VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF SIV AV+WGRNVYDSISKFLQFQLTVN+VA+++AFVGACV+  SPL   Q+LWVNLIMD+ ASLALATE PTEELL R PYGRTK +I+R M++NILG  +YQ+IV F L++ G    D+++  G       KP++H   +FNTFV+M LFNEINSR +HG+RNVF GI RN IF+ I   TF+ QI+II+  G A     L+ E WMWC+F GF  LLW QLV ++P    PK  +                    GT   P     E +    S  + LWIRGL+RLQ Q
Sbjct:   30 ISVGDLKQLMKCRGLEAKDHLAST-GGLHGLVRKLHTSTEKGISGFPEDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFAP----EECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKG-EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDDAPPQSPAIKGAPGDDFEDVNLDDDQES---------------SENGKERKDKQEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQNTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMGQHHKTIPENPKEFSPELLEILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLG-LVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSMSTAIRMPDGGYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRDF------PPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDSN-GRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVYQIIVLFVLVFKGAEFFDIED--GFLEETRCKPTQHSAVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIELTGKAFHVVGLNWEQWMWCIFLGFTELLWGQLVLTIPKESFPKLCR-------------------FGTEGVPIATIIEPDGARDSRARLLWIRGLTRLQHQ 1081          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H9])

HSP 1 Score: 537.339 bits (1383), Expect = 4.231e-169
Identity = 315/721 (43.69%), Postives = 474/721 (65.74%), Query Frame = 1
Query: 1018 SVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQY-NDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII-KDKN-VLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVP 3171
            + L+ K+N++A  +G +G  +A++T++++++ F +  Y+        + +   +   I+G+ VLVV+VPEGLPLAVT +LA+  K M    +LV+H+D  ETMGN + I  +KTG LT +RM V + F   +    +   Y + +P  L D L K I+LN+SY+S++ P   +  L  Q+GNKT+CSLL  M   +G+ Y   R    ED+ +K++ F S RKSM+T++ K+K+   + TKGA+E++L +C+  +  DG ++ FT  D   L K V+E M K  L+ + LA +      S+  KG         LEDE  +++DLT + +VGIEDP+R +VP AI KC  AGI V MV+GD++ TAR++A + GILKP++D ++  G+EFN+ IRD   GK+   + + +WP+L+VLAR++ +DKYTLV  ++ S ++   E+VAVTG G +DGP L+KADVGF MG++G+DVAK+++D++L DDNF SIV A+ WGRNVY+++ KFL FQ TV   A IV  +GACV   SPL A Q+LWVNLIMD+LASLAL  + PT++LL   PYGR K++I R +++N++G  ++QL+V F LI+     LD+ +  G       +PS+H + VF TFV M +FNEINSR +HG+ N+F GI+RNI+FI IWI     Q++I++    A +T  +D E W+WC+F G   L+WAQ++ + P + +P
Sbjct:  300 ATLEGKVNRVAVALGYIGIAVALITMIVIMVHFSVTNYYTNEKPAKPEDVNMYVRAFIMGMVVLVVSVPEGLPLAVTFALAFCTKMMYNKQSLVKHMDIIETMGNVSNIYCNKTGVLTEHRMRVDRMFIADQLLDGDPKVYKHKIPSELLDDLFKAISLNTSYSSQIQPA-GRDHLPVQVGNKTDCSLLQLML-EMGETYQYWRDDHPEDRFVKVFAFTSERKSMTTVLEKEKDGFYVYTKGAAEILLPRCTSTITTDGKMRPFTDEDRERLRKEVMEEMHKQALKILVLACRSL----SDSDKGL--------LEDEAKVLEDLTLMAVVGIEDPIREKVPEAIWKCDRAGIRVCMVSGDSIQTARAVAARVGILKPDEDILMYTGQEFNSYIRDPD-GKVNTDRFNSMWPKLKVLARATARDKYTLVKHVMGSGVNRQGEMVAVTGAGVHDGPVLRKADVGFTMGVSGSDVAKDSADVVLLDDNFGSIVWAIKWGRNVYNTVVKFLMFQFTVTWSAFIVVVIGACVTGRSPLGATQLLWVNLIMDSLASLALTRDFPTDDLLRHQPYGRHKALIGRTLIRNVVGHVIFQLVVMFVLIFKAHEWLDIKD--GFQTDTICQPSQHSSLVFTTFVFMQVFNEINSRSVHGR-NMFKGIHRNIVFICIWIAQVSIQVLIVEVFTRAFNTKGMDAEQWLWCIFLGLSELIWAQVIYTFPKTWLP 1002          

HSP 2 Score: 141.354 bits (355), Expect = 9.175e-34
Identity = 89/246 (36.18%), Postives = 147/246 (59.76%), Query Frame = 1
Query:   67 KELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSA-TDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIR-SGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQA 798
            ++L E+M  +   A + I   +  +  L   L+TS   GL+   D+L  RR+V+GSN +P    ++    +  +++D  LIVL+  A+ISL L L   Y        +   A W EGV IL  VV++++++A +D+ ++  FR  Q ++    ++ VIR SG + +IL  ++VVGD+C +K G L+ ADG+++QS+D+ VDE+  +    H  K V  DP++ +GTHV++G+GK +V AVG S+QA
Sbjct:   18 QKLEEVMTSQSEHAKQFIDQNFDGMQTLIRNLRTSAFKGLTGFADNLAHRRQVYGSNEMPLARRRSLFHFLLYSMKDWILIVLVIGAIISLVLGLV--YPESCKGVINGEVA-WYEGVGILVMVVLMILISALSDYLRDADFRCQQKRVHMEERVTVIRDSGAVKDILKSELVVGDLCLLKAGSLVAADGVVVQSSDLVVDETLFSRSERH--KSV-VDPLVFAGTHVVKGTGKFIVLAVGASTQA 257          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO44517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVV7])

HSP 1 Score: 412.92 bits (1060), Expect = 5.279e-124
Identity = 262/719 (36.44%), Postives = 421/719 (58.55%), Query Frame = 1
Query: 1114 FCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT-----VVQAFFNGKYYRQNLPQY-NDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLT-----QIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVL-LLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANEL--IKSVIEPM-AKDGLRTIGLAYKEFVDDGSEPQKGQ--DIYL-------PNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKP-------EDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNAR-GMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPK 3174
            F ++TY I ++ +   H  ++I   II V +++VA PEGL +AVTI+L+ S++ M   +  VR+ D  ETMG+ T +C +KTG LT          V + F  GK++R +   Y +D+   +  ++ K IA+N+SY S +   + + +L++     Q+G+ TEC+LL F    +G  Y  +R     ++  K++ F+   +SM+T++K+     +  KG+ E+VL +C  ++  D   +     DA+ L  +  +I  M  K  L+ + LAY      G+ P KG+  D+ +       PN D  +E+ I+ D+  +G VG+E+ VR EV  AI +C+ AG+ + MVTG ++ TA S A  CGIL P       E   I  + K  N +I D  +GKI Q + D++WP +RV++R +P+ K + +  I  S +    EVVAV   G +D   L+ ADVG +MG  GTD+A+EASDI+L  D F+S++  + WGR++Y+++ KFLQFQLT   V +IV  +GA +   S   A Q+LW+NLIMD LASLAL  + PT+++L   PYGR K +ISR +++N++G ++YQ+ V F +I+   ++ D  + R G +A    +P++H T VF TF++M LFNE+N R++  +         + +F+I+ +     QI+I+QF   +    PLD + W+WC FFGF  L+W Q++ SVP  ++P+
Sbjct:  314 FLVKTYEIDNIPYDASHWNEIIKTFIIAVVIIIVAEPEGLSMAVTITLSRSLRNMCAQDIFVRNADVLETMGSVTTLCCNKTGVLTAVSKIPLYEEVAECFVGGKHFRGDTSHYKSDIAVKVVHEVAKGIAINTSYNSNI---QVRTQLVSSSERNQVGDITECALLQF-TADLGVYYPFIREANPCEEFSKVFPFSPETRSMTTVVKENATYKVYCKGSPEVVLPRCVRLLNMDEQEETL---DADRLKKVNDIITAMQEKSQLKVMCLAY------GTTPFKGRSRDVCMEPRLSKEPNWD--EENRILSDMHFVGFVGMEESVRGEVSEAILRCRRAGLMITMVTGASLQTAGSFAQNCGILTPNKYWPAVEKTIIGYDSKLLNEEISDD-SGKISQVEFDKLWPDVRVVSRCTPEGKRSFMQAIRRSRVRREGEVVAVVASGVHDANFLRDADVGLSMGATGTDIAQEASDIVLKGDKFSSVLDTIKWGRHIYETVLKFLQFQLTATWVTMIVLIIGAILFQKSIFSAAQLLWLNLIMDALASLALTGDHPTDDILRHKPYGRNKPLISRAVLRNVIGHAIYQIAVVFIVIY---LIADFTDTRFGYSAESLCRPTQHSTMVFTTFILMQLFNEVNCRRVSSR--NVFSGPFDWVFLIVLLLCIGVQIIIVQFFTNSFRVEPLDWQQWLWCFFFGFSELIWGQIIFSVPKGVIPR 1011          

HSP 2 Score: 140.969 bits (354), Expect = 1.202e-33
Identity = 81/248 (32.66%), Postives = 137/248 (55.24%), Query Frame = 1
Query:   70 ELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRR-EVFGSNVIPPKPPKT-FLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGII 807
            +L E++  +  + ++ + + +  +  +  +L+TS   G+  T D + RR + FGSN I  +  +  F R +  ++ D+ LI+L+   + S+ L  Y +   +           W+EG  ILG   V+V+++  +D+ +EK F  LQ +IE   K  V+R G + EI   D+ VGD+C +  G ++PADGI++++ ++  DESSL  E    K     DP + + THV EGSGKM++ AVG S+Q   I
Sbjct:   17 KLVEILTQKDGKGLQMLDDDFGGVRGIIHRLQTSSKKGILDTSDALARRTKSFGSNRISGQAKRRGFFRALLYSMTDIVLILLVLGGIASVILGYYYREVCKGKYIPDSEKNAWMEGAGILGTAAVIVLLSTLSDYLREKSFYRLQKRIESERKTRVMRGGEMKEICYQDVKVGDLCVIGPGSIIPADGILVENTELTTDESSLNKESRASK--TSRDPFVFASTHVTEGSGKMIILAVGDSTQIAAI 262          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 233.802 bits (595), Expect = 2.377e-63
Identity = 190/610 (31.15%), Postives = 302/610 (49.51%), Query Frame = 1
Query: 1168 KKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF-FNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGK-------SQGELLTQIGNKTECSLLGFMNGA----IGKDYAEL--RSIWTEDKLIKIYTFNSVRKS-MSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGIL---KPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSR 2943
            + ++    IGV++ V A+PEGLP+ VT++LA  V +M K N +V+ L   ET+G ++ ICSDKTGTLT N MTV Q F  +G Y       Y+ L E + ++       NSS    +  G          G L    G  TE +++     A     G D+  +  R   +E KL+ +      R S M+ I +D   +   KGA E V+ +C+    K+GS    T  D  E I   +  M+  GLR I  A+            G+D+              + LT +GI+G+ DP R  V  A++   ++G+ V+M+TGD+  TA +IA   GI    +P      + G+E      ++  G    + IDQ+     V  R SP+ K  +V       L     VVA+TGDG ND  ALK+AD+G AMG +GTDV+KEA+++IL DD+F +I+ A+  G+ ++ +I  F++FQL+ ++ A+ +  +   +   +PL A+Q+LW+N+IMD   + +L  E    +++ R P      +I++ ++  ++  +L  +  T ++ W           R M  R N       T  F  FV   +FN ++ R
Sbjct:  275 RAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVILNEDPITYTSNSSIAKTVEAGYLCNNASIRNGVLY---GQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSEKKLMAVKCRRKHRSSAMAEIARD---IYYVKGAPENVMRQCTSYY-KNGSAVPMTAKDV-ERIGDAVLAMSSRGLRVIAFAH------------GEDL--------------QQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRP-----TLSGEEL-----EALDGLQLSTIIDQV----SVFYRVSPRHKVAIVKA-----LQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTLWVFW-----------REM--RDNIITPRDTTMTFTCFVFFDMFNALSCR 818          

HSP 2 Score: 56.6102 bits (135), Expect = 8.059e-8
Identity = 38/112 (33.93%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  535 IRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLS-------------GTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAE 831
            +R+G++   L   +V GD+  +  GD +PAD  + ++ D+++DESS TGE +   K     P + S             GT V  G GK VV   G +S+ G IF L+ A E
Sbjct:  127 VRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTTLPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEE 238          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 225.713 bits (574), Expect = 3.706e-60
Identity = 193/606 (31.85%), Postives = 304/606 (50.17%), Query Frame = 1
Query: 1174 MIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYND---LPENLTDKLLKNIALNSSYTSRLLPGKSQGELL---TQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTI--IKDKNVL----LLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLE---DEHNI-IKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGIL----------------------KPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLR--VLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYG-RTKSIISRRMVKNILGQSLYQL----IVTFYLIW--HGEILLDVDNARGM 2850
            ++  +I  + ++V  VPEGL   VT+ L  + K+M   N LV++L+A ET+G+ + ICSDKTGTLT NRMTV   +F+ K +  +  +      + +  T   L  IA      +  + G+    +L   T  GN +E +LL  +   +G     +  +  E   +    FNS  K   +I  I D+N      LL KGA E VL +CS I+ K G ++    +D  +  +     +   G R +G A + ++D  + P          I  E   DE N  ++ L  +G++ + DP R  VP A+ KC++AGI V MVTGD+  TA++IA   GI+                      K + D IV+ G E  +         +    ID I    +  V AR+SPQ K  +V G           +VAVTGDG ND PALKKAD+G AMGI+G+DV+K+A+D+IL DDNF SIV  V  GR ++D++ K + + LT N+  +    +        PL  + +L ++L  D + +++LA E    +++ R P   RT+ +++ R++    GQ  +       +T+++I   +G +  D+ N RG+
Sbjct:  352 ILQAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQSGTAMEKTETWTALGRIA-GLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGS----VTKMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTILIK-GELKPL-DDDMKQAFEMAYLDLGGMGERVLGFA-QHYLDKENFP----------IGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKD---------MTDKDIDDILKNHKEIVFARTSPQQKLIIVEG-----CQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFMQASAGFLTYFVIMAENGFLPGDLFNIRGL 925          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:101161727])

HSP 1 Score: 1086.63 bits (2809), Expect = 0.000e+0
Identity = 646/1111 (58.15%), Postives = 799/1111 (71.92%), Query Frame = 1
Query:   52 FSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSA-TDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXX---------XXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            F + VKEL ELM  R  +A+++I+  Y D   LC +L+++  DGLS    DL  R +++G N IPPK PKTFL L++EALQDVTLI+L  AA+ISLGL+ Y   + E                +DAGWIEG AIL +VV VV VTAFNDW KEKQFRGLQ +IE   K  V+R G + +I V D+VVGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHV+K VD DPMLLSGTHVMEGSG+M+VTAVG++SQ GIIF LLGA E+ E   ++  + +        ++E++ L                   E+ +KKK    KK+ SVLQ KL KLA  IGK G V++ +TV+IL++ F I T+ +K  SW  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF  G  + + +P    +     D L+  IA+NS+YTS++LP   +G L  Q+GNKTEC LLGF+   + +DY  +R    E+KL K+YTFNS RKSM+T+IK  D    L +KGASE++L KCS+I+  +G  + F   D +E++K VIEPMA +GLRTI +AY++   +            P  D E+E  I+ +LTCI +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGI+ P DDFI +EGKEFN +IR+ K G+I+Q +ID+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR   +IS  M+KNILG  +YQL++ F L++ GE + ++D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI  N IF  I + TF  QIVI+Q+GG   S APL++E W+WC+F G G LLW Q++++VPT  +P  K+  +     +E   +   DE         +E EL+  GQ LW RGL+R+QTQ
Sbjct:   35 FGVTVKELRELMELRSTDALQKIQESYGDTKGLCQRLQSNVTDGLSGDPADLERRGQIYGQNFIPPKKPKTFLELVWEALQDVTLIILEAAAIISLGLSFYQPPNQESAICGESTGGAEDEGEADAGWIEGAAILLSVVCVVFVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRKGNVIQIPVADMVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGEIEEDVKEKKAKKQDGGV----AMEMQPLKSAEGGEV-----------EDREKKKTNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLFFVINTFVVKERSWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFI-GDVHHRVVPDPGLISPRTLDVLVHAIAINSAYTSKILPPDVEGGLPKQVGNKTECGLLGFILD-LQQDYVPVREQIPEEKLYKVYTFNSARKSMTTVIKLPDGTFRLYSKGASEIMLKKCSYILDANGEPRIFRPRDRDEMVKQVIEPMACEGLRTICIAYRDLSPN------------PEPDWENEAEIVTELTCISLVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFICLEGKEFNRRIRNEK-GEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFIGERIFNIDSGR--HAPLHSPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFAVQIVIVQWGGKPFSCAPLNMEQWLWCLFVGVGELLWGQVISAVPTERLPCLKEAGLGLEPGEEEGEELAEDEEEIDC----AERELRR-GQILWFRGLNRIQTQ 1108          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 638/1136 (56.16%), Postives = 806/1136 (70.95%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSK----------YXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK-------KKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGV 3381
            + F   V +L  LM  R  E + +++  Y  +  LC +LKTSP +GL     DL  R+E+FG N+IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ Y             +     D  E+DAGWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ +IE   K  V+R  ++ ++ V DI+VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK  D DPMLLSGTHVMEGSG+MVVTAVG++SQ GIIF LLGA    E+  ++  + +        ++E++ L                   +E +KKK  + KK+ SVLQ KL KLA  IG  G V++ +TV IL++ F I+ + +K   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ +    +Y++ +P    LP    D L+  IA+NS+YT+++LP   +G L  Q+GNKTEC LLG +   + +DY  +R+   E+KL K+YTFNSVRKSMST+IK  D +  + +KGASE+VL KCS I+ + G ++ F   D +E++K VIEPMA +GLRTI +AY++F +D            P  + +DE+NI+ DLT I +VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IAIKCGI+ P +DF+ ++GKEFN +IR+ K G+++Q +ID++WP+LRVLARSSP DK+TLV GIIDS ++  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR K +IS  M KNILG ++YQL++ F L++ GE + D+D+ R   A  ++ PSEH+T +FNTFV+M LFNEIN+RKIHG+RNVF GI RN IF  I   TFV QIVI+QFGG   S  PL++E WMWC+F G G L+W Q++ ++P   +   +       K E+P+            D    +     +E EL+  GQ LW RGL+R+QTQ    N+   +  +G+
Sbjct:   22 ADFGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKVKKQDGAA----AMEMQPLKSAEGGE-----------ADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYKK-IPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLIL-ELKRDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPDGSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRDFSND------------PEPNWDDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNEK-GEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGR--DAPLHSPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNLKLRFLRRAGQLTHKDELPE-----------EDVNEENEEIDHAERELRR-GQILWFRGLNRIQTQIRVVNAFRSSLYEGL 1113          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000024208.2 (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:101173614])

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 639/1129 (56.60%), Postives = 807/1129 (71.48%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSA-TDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXX---------XAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAE-----LXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDN 3366
            +++FS  + EL  LM  R  EAI  I+  Y D+N LC KL+TS  +GL   ++D+  R+E FG N+IPPK PKTFL+L++EALQDVTLI+L  AA+ISLGL+ YS  + E       +         + GWIEG AIL +VV VV+VTAFNDW KEKQFRGLQ++IE   K  V+R G++ +I V +IVVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHVKK +D DPMLLSGTHVMEGSGKMVVTAVG++SQ GIIF LLGA++       ++  K+  + KK K     +VE++ L ++ +                             SVLQ KL KLA  IG+ G +++ LT +ILI RF I+++ I+ + +  +    +++ ++ F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRM VVQ +  G ++++ +P  + LP  + D L+ +I +NS+YT++++P + +G L  QIGNKTEC+LLG     + +DY  +R+ + E+KL K+YTFNSVRKSMST+++  D +  + +KGASE++L KC  I+   G  + F  +D  +L+K VIEPMA +GLRTI +AY++F     EP           D ++E  I+  LTCIG+VGIEDPVRPEVP AI+KCQ AGITVRMVTGDN+NTAR+IA KCGIL+P DDF+ MEGKEFN +IR+ + G+I+Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAV VAF GAC+  DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR K +ISR M+KNILG ++YQL + F L++ GE + D+D  R      +  PSEH+T VFNTFV+M +FNE N+RKIHG+RNVF G+ RN IF  I + T + Q VI+QFGG   S  PL +E W+WC+  G  SLLW QLV+SVPT  +   K        + E   +EE +E+        +E EL+  GQ LW+R L+R+QTQ    N+  D+
Sbjct:   20 EAEFSCSLLELRSLMELRGVEAITRIQESYGDVNGLCLKLRTSSVEGLEGNSEDINRRKEEFGQNLIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYSPPNAERQQCGKAAGGVEEDGEAETGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQNRIEQEQKFTVVRGGQVVQIKVSEIVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKSLDKDPMLLSGTHVMEGSGKMVVTAVGVNSQTGIIFTLLGASDEGDSEEKKEKKKKEKKDKKRKNKDGATVEMQPLNEDGDLEKKKKNLPKKEK----------------SVLQGKLTKLAVQIGQAGLLMSALTFIILITRFLIDSFWIQGVPFAPECVPVYVQYLVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMRVVQIYIAGLHFKK-VPDPDLLPAKILDLLILSIGVNSAYTTKIMPPEREGGLPRQIGNKTECALLGLCLD-LRRDYQTIRNEFPEEKLFKVYTFNSVRKSMSTVLRHHDGSYQMFSKGASEILLKKCCQILMASGKPKVFKPHDREDLVKKVIEPMASEGLRTICIAYRDFPVSEGEP-----------DWDNEAEILTGLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIATKCGILQPGDDFLCMEGKEFNRRIRNEQ-GEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVTVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRNPYGRKKPLISRTMMKNILGHAVYQLTIIFTLLFVGEEIFDIDCGRNTPL--HAPPSEHYTIVFNTFVLMQIFNEFNARKIHGERNVFDGVFRNPIFCSIVLGTIIAQFVIVQFGGKPFSCFPLTLEQWLWCVLLGLSSLLWGQLVSSVPTRWLTFLKTAG--HGTQQEEIPEEELEEMKDKDEIDHAEMELRK-GQVLWVRSLNRIQTQIRVVNAFRDS 1113          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000036123.1 (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:101172706])

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 632/1152 (54.86%), Postives = 808/1152 (70.14%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLG---------------------LALYSKYXXXXXXXXX-------------------XXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK-------KKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            D  F + +++L  +M  R  EA+  I+ K+ D+ ++C +LKTSP +GLS    DL  R   FG N+IPPK  KTFL+L++EALQDVTLI+L  AA+ISLG                     + ++  +  +    S                    E+ AGWIEG AIL +V++VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V +IVVGDI Q+KYGDLLPADGI+IQ ND+K+DESSLTGE DHV+K ++ DPMLLSGTHVMEGSG+MVV+AVGL+SQ GIIF LLGA+E          E K  K    D + LE     +E    ++ +  +  +E  + KK    KK+ SVLQ KL +L   IGK G  ++ +TV+ILI+ F I T+ ++++SW  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+    +Y+  +P+   +     + L+ +I++NS+YT+++LP + +G L   +GNKTEC+LLG + G + +DY  +R    E+ L K+YTFNS RKSMST++K  D +  + +KGASE+VL KCS I+   G  + F   D +E+++ VIEPMA DGLRTI +AY++F  +  EP           + ++E++I+ +LTCI +VGIEDPVRPEVP AI KCQ AGI VRMVTGDN+NTAR+IA KCGIL+P ++F+ +EGKEFN +IR+ K G+++Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG +++QLI+ F L++ GE+L D+D+ R   A  ++ PSEH+T VFN FV+M LFNEIN+RKIHG+RNVF GI RN IF  + + TF  QI+I+QFGG   S   L I+ W+WC+F G G LLW Q ++++PT  +   K       K+EI +    E            +     +E EL+  GQ LW RGL+R+QTQ
Sbjct:   20 DGDFGVSMEDLKNIMELRSSEAVAMIQEKFGDVQSICRRLKTSPIEGLSGNPVDLEKRHATFGKNLIPPKKAKTFLQLVWEALQDVTLIILEVAAIISLGLSFYHPPGGDGECKNIFMSSFIKIHKHFIFQGAVTSFCVFLLTACGQAAGGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGASE-------HDEEKKVKKTKTQDGIALEIQPLKSEEA--AELEDKEEKEEVKEIKKVNVTKKEKSVLQGKLTRLTVQIGKAGLFMSAMTVIILILYFVINTFLVQNLSWVAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYK-TVPEPEAIKPETLEMLVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLG-LKRDYQPIRDEIPEEILYKVYTFNSSRKSMSTVLKNADGSFRMYSKGASEIVLRKCSHILDAQGQPRVFKMKDRDEMVRKVIEPMACDGLRTICVAYRDFPAEAGEP-----------NWDNENDILDNLTCIVVVGIEDPVRPEVPEAIAKCQRAGIDVRMVTGDNINTARAIATKCGILQPGEEFLCIEGKEFNQQIRNDK-GEVEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRRPYGRDKPLISRTMMKNILGHAVFQLIIIFTLLFAGEVLFDIDSGR--NAPLHSPPSEHYTIVFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGIGELLWGQFISAIPTHHLKFLKEAGHGITKEEIHKENMTE-----------DTDEIDHAEMELRR-GQILWFRGLNRIQTQ 1134          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000031940.1 (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:101172706])

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 636/1173 (54.22%), Postives = 815/1173 (69.48%), Query Frame = 1
Query:   43 DSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATD-DLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLG---------------------LALYSKYXXXXXXXXX-------------------XXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD----HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIK--DKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRK-------KKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRR 3399
            D  F + +++L  +M  R  EA+  I+ K+ D+ ++C +LKTSP +GLS    DL  R   FG N+IPPK  KTFL+L++EALQDVTLI+L  AA+ISLG                     + ++  +  +    S                    E+ AGWIEG AIL +V++VV+VTAFNDW KEKQFRGLQ +IE   K  VIR G++ +I V +IVVGDI Q+KYGDLLPADGI+IQ ND+K+DESSLTGE DHV+K ++ DPMLLSGTHVMEGSG+MVV+AVGL+SQ GIIF LLGA+E          E K  K    D + LE     +E    ++ +  +  +E  + KK    KK+ SVLQ KL +L   IGK G  ++ +TV+ILI+ F I T+ ++++SW  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQA+    +Y+  +P+   +     + L+ +I++NS+YT+++LP + +G L   +GNKTEC+LLG + G + +DY  +R    E+ L K+YTFNS RKSMST++K  D +  + +KGASE+VL KCS I+   G  + F   D +E+++ VIEPMA DGLRTI +AY++F  +  EP           + ++E++I+ +LTCI +VGIEDPVRPEVP AI KCQ AGI VRMVTGDN+NTAR+IA KCGIL+P ++F+ +EGKEFN +IR+ K G+++Q ++D+IWP+LRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVNVVAVIVAF GAC+  DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR K +ISR M+KNILG +++QLI+ F L++ GE+L D+D+ R   A  ++ PSEH+T VFN FV+M LFNEIN+RKIHG+RNVF GI RN IF  + + TF  QI+I+QFGG   S   L I+ W+WC+F G G LLW Q ++++PT  +   K       K+EI +    E            +     +E EL+  GQ LW RGL+R+QTQ     +    +   V G +RR
Sbjct:   20 DGDFGVSMEDLKNIMELRSSEAVAMIQEKFGDVQSICRRLKTSPIEGLSGNPVDLEKRHATFGKNLIPPKKAKTFLQLVWEALQDVTLIILEVAAIISLGLSFYHPPGGDGECKNIFMSSFIKIHKHFIFQGAVTSFCVFLLTACGQAAGGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSLEKDPMLLSGTHVMEGSGRMVVSAVGLNSQTGIIFTLLGASE-------HDEEKKVKKTKTQDGIALEIQPLKSEEA--AELEDKEEKEEVKEIKKVNVTKKEKSVLQGKLTRLTVQIGKAGLFMSAMTVIILILYFVINTFLVQNLSWVAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGDTHYK-TVPEPEAIKPETLEMLVNSISINSAYTTKILPPEKEGGLPRHVGNKTECALLGLVLG-LKRDYQPIRDEIPEEILYKVYTFNSSRKSMSTVLKNADGSFRMYSKGASEIVLRKCSHILDAQGQPRVFKMKDRDEMVRKVIEPMACDGLRTICVAYRDFPAEAGEP-----------NWDNENDILDNLTCIVVVGIEDPVRPEVPEAIAKCQRAGIDVRMVTGDNINTARAIATKCGILQPGEEFLCIEGKEFNQQIRNDK-GEVEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGETRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRRPYGRDKPLISRTMMKNILGHAVFQLIIIFTLLFAGEVLFDIDSGR--NAPLHSPPSEHYTIVFNVFVMMQLFNEINARKIHGERNVFEGIYRNPIFCSVVLGTFALQIIIVQFGGKPFSCTALTIDQWLWCIFIGIGELLWGQFISAIPTHHLKFLKEAGHGITKEEIHKENMTE-----------DTDEIDHAEMELRR-GQILWFRGLNRIQTQMDVVYTFQTGQA-AVSGALRR 1154          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000038461.1 (SMESG000038461.1)

HSP 1 Score: 2136.3 bits (5534), Expect = 0.000e+0
Identity = 1203/1204 (99.92%), Postives = 1203/1204 (99.92%), Query Frame = 1
Query:   34 MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYTLSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSDLDKHTERNKLISTMSLPSSGHPFSRASSTPQNNTPGYKSDLHRS 3645
            MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTENHYLSDKQKDDTTKEEAKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSM WHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPEKDESESDEEFDELGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYTLSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSDLDKHTERNKLISTMSLPSSGHPFSRASSTPQNNTPGYKSDLHRS
Sbjct:    1 MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTENHYLSDKQKDDTTKEEAKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSMLWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPEKDESESDEEFDELGTSTPYGESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYTLSQVAGIVPMLGGRQISCPVGRLKSANSVSSEYDSDLDKHTERNKLISTMSLPSSGHPFSRASSTPQNNTPGYKSDLHRS 1204          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000038461.1 (SMESG000038461.1)

HSP 1 Score: 1919.82 bits (4972), Expect = 0.000e+0
Identity = 1100/1101 (99.91%), Postives = 1100/1101 (99.91%), Query Frame = 1
Query:   34 MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXDSVELEKLTDNTENHYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPXXXXXXXXXXXXXLGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTENHYLSDKQKDDTTKEEAKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSM WHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPEKDESESDEEFDELGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ
Sbjct:    1 MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTENHYLSDKQKDDTTKEEAKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSMLWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKKKEIPQPEKDESESDEEFDELGTSTPYGESEDELKSPGQKLWIRGLSRLQTQ 1101          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 803/1157 (69.40%), Postives = 931/1157 (80.47%), Query Frame = 1
Query:   40 SDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLI-LRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXX------------DSVELEKLT-------DNTENH----YLX--XXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDK-NVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR---KKKEIPQPXXXXXXXXXXXXXLGTSTPY-------------GESEDELKSPGQKLWIRGLSRLQTQQSKRNSI---LDNRT 3372
            ++  + +  KELT+LM  RQ EAI EIK KY D+  +C +LKTSP  GL   ++ I  RR  FGSN+IPPKPPKTF RLM+EALQD+TLIVLMGAAVISL LALYSK+SG    D +E DAGWIEGVAILGAV+VVV+VTAFNDWQKE+QFRGLQD+IEGNHKIAVIR G   EI+VGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVD DPM+LSGTHVMEGS KM+VTAVGL+SQAGIIFALLGAA   EK   E  +        +            + VEL KLT       D   NH    Y S    + +    +  ++KK ++ KKKGSVLQ KLNKLA+ IG++GT++A LTV ILII+FCI TY  +   W MDHLKKMI+FLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ NG++ R +LP + +L  N  D L+KNI++NSSYTSRL+  +   EL +QIGNKTEC+LLGF+NG++ +DYA+LR+ W E+KLIK+YTFNS RKSMSTII+D+  +LLLTKGASEM+L+KCSFI+GK+G IQ FT  D   L+K+VIEPMA DGLRTIGLAYKEFV       +G  +Y   +DLE+EH +IKDLT IGIVGIEDPVRPEVPPAIKKCQ AGITVRMVTGDN+NTARSIAIKCGILKP +DF+VMEGKEFNN++RD  +GKIKQ  IDQ+WP+LRVLARSSPQDKYTLVTGIIDSHL+ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC +TDSPLKAVQMLWVNLIMDTLASLALATE+PTEELLDRAPYGRTK IISRRM+KNI+GQS+YQL VTFYL+ HG +LLDV+N RG+T RG  KP++HFTA+FNTFV+MTLFNE NSRKIHGQ+NVF G+ RN++FIIIW+TTFVGQIVI+Q+GGYAL T  L+++HW+WCM FG G LLWAQL+N +PT+++PK     KK++P  E       +  D    S                 E +D++K+ GQ LWIRGLSRLQTQ    N+    LD R+
Sbjct:    2 TEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQG--LYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQMRVVNAFRSSLDPRS 1156          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 1409.82 bits (3648), Expect = 0.000e+0
Identity = 803/1151 (69.77%), Postives = 928/1151 (80.63%), Query Frame = 1
Query:   58 IGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLI-LRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXX------------DSVELEKLT-------DNTENH----YLX--XXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDK-NVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR---KKKEIPQPXXXXXXXXXXXXXLGTSTPY-------------GESEDELKSPGQKLWIRGLSRLQTQQSKRNSI---LDNRT 3372
            +  KELT+LM  RQ EAI EIK KY D+  +C +LKTSP  GL   ++ I  RR  FGSN+IPPKPPKTF RLM+EALQD+TLIVLMGAAVISL LALYSK+SG    D +E DAGWIEGVAILGAV+VVV+VTAFNDWQKE+QFRGLQD+IEGNHKIAVIR G   EI+VGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVD DPM+LSGTHVMEGS KM+VTAVGL+SQAGIIFALLGAA   EK   E  +        +            + VEL KLT       D   NH    Y S    + +    +  ++KK ++ KKKGSVLQ KLNKLA+ IG++GT++A LTV ILII+FCI TY  +   W MDHLKKMI+FLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ NG++ R +LP + +L  N  D L+KNI++NSSYTSRL+  +   EL +QIGNKTEC+LLGF+NG++ +DYA+LR+ W E+KLIK+YTFNS RKSMSTII+D+  +LLLTKGASEM+L+KCSFI+GK+G IQ FT  D   L+K+VIEPMA DGLRTIGLAYKEFV       +G  +Y   +DLE+EH +IKDLT IGIVGIEDPVRPEVPPAIKKCQ AGITVRMVTGDN+NTARSIAIKCGILKP +DF+VMEGKEFNN++RD  +GKIKQ  IDQ+WP+LRVLARSSPQDKYTLVTGIIDSHL+ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC +TDSPLKAVQMLWVNLIMDTLASLALATE+PTEELLDRAPYGRTK IISRRM+KNI+GQS+YQL VTFYL+ HG +LLDV+N RG+T RG  KP++HFTA+FNTFV+MTLFNE NSRKIHGQ+NVF G+ RN++FIIIW+TTFVGQIVI+Q+GGYAL T  L+++HW+WCM FG G LLWAQL+N +PT+++PK     KK++P  E       +  D    S                 E +D++K+ GQ LWIRGLSRLQTQ    N+    LD R+
Sbjct:    1 MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQG--LYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQMRVVNAFRSSLDPRS 1149          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 705/1124 (62.72%), Postives = 864/1124 (76.87%), Query Frame = 1
Query:   46 SKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYXXXXXXXXXXXXAGWIEGVAILGAXXXXXXXTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELXXXXXXXXXXXXXXXXXXXD--------SVELEKLTDNTEN-HYLXXXXXXXXXXXXXXXXXXXXXXXXGSVLQTKLNKLAALIGKVGXXXXXXXXXXXXXRFCIETYHIKSMSWHMD-HLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTII---KDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTXXXXXXXXXXXXXXXLTDSPLKAVQMLWVNLIMDXXXXXXXXXXXXXXXXXDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQXXXXXXXXXXXXXXXXXXXXXXXQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR----KKKEIPQPXXXXXXXXXXXXXLGTS----------TPYGESEDELKSPGQKLWIRGLSRLQTQ 3336
            + F + VKEL ++M  R  EAI  I NKY  I+ LCA L+TSP +GL   DD   R E++GSNVIPPKPPKTF +L+FEA+QD+TLIVL+ AA+ISLGL++Y+ Y G+   D +E   GWIEGVAIL AVV+VV V AFNDWQKE+QFRGLQ+KIE  HK  VIR+ +  EI VGDI+VGDICQ+KYGDLLPADG+IIQSND+K+DESSLTGE D VKKG + DP++LSGTHVMEGSGK+++TAVG++SQAGIIFALLGAA    +      E +   K  S+        +V++E  +++ E    + +   + T +   KKK K    K+ SVLQ KL KLA  IG +GT++A++TV ILII+FC   ++     W    HL+++I+F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAF  G  + + LP+Y++L       L+  I++NS YTS+L+  +++ EL TQ+GNKTEC+LLGF+    G  Y E+R+ WTEDKL K+YTFNSVRKSMST+I     K   + TKGASE+V+SKCS+IV  +G I  F+K+D  +++++VIEPMA +GLRTIG+AYK  + + S     + +     D E+E  I+ DLTC+ IVGIEDPVRPEVP AI KCQ AGITVRMVTGDNVNTARSIA KCGILKP DDF+V+EGKEFN +IR  KTG+++Q  ID++WP LRVLARSSPQDKYTLV+GII SHL+  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSISKFLQFQLTVN+VA++VAFVGAC +TDSPLKAVQMLWVNLIMDTLASLALATELP EELLDRAPYGRTK +I+R M+K I+GQ +YQLIV  YL+  GE LLDVD+ R +  +G +KP+EHFT +FNTFV+MTLFNEIN+RKIHGQRN+F G+ RN+IF+ IWI T + QIVII+FGGYALST+ LD +HW+WC+FFG G+L+W Q++ S+P ++VPKR    KKK+IP       +  E  +    +          +P    +D++   GQ LWIRGLSRLQTQ
Sbjct:   14 ADFKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQC-DDFPRRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAE--VGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDRPNAQENQNNNKTASNQLKNGIDLTVKVEVTSEDGEKLSMIENDAYNSTRESPKKKKDKSIRVKEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIEGSNFTK-LPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFN-SRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYEDDDIVRSGQILWIRGLSRLQTQ 1132          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2B30.000e+057.11ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+055.63ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+056.67ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+057.88ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+057.88ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mca-30.000e+057.36Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.36Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.36Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.36Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.36Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMCA0.000e+060.40gene:FBgn0259214 transcript:FBtr0304047[more]
PMCA0.000e+055.14gene:FBgn0259214 transcript:FBtr0304050[more]
PMCA0.000e+055.14gene:FBgn0259214 transcript:FBtr0300558[more]
PMCA0.000e+055.14gene:FBgn0259214 transcript:FBtr0300555[more]
PMCA0.000e+054.29gene:FBgn0259214 transcript:FBtr0300556[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b0.000e+055.83ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b0.000e+056.93ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b0.000e+056.93ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3a0.000e+057.34ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
atp2b3a0.000e+057.76ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b10.000e+058.02Xenopus tropicalis ATPase, Ca++ transporting, plas... [more]
fam149a0.000e+055.85family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+055.29family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+056.89family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+057.96family with sequence similarity 149 member A [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2b30.000e+057.02ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+057.79ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+057.68ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b10.000e+057.52ATPase, Ca++ transporting, plasma membrane 1 [Sour... [more]
Atp2b40.000e+056.89ATPase, Ca++ transporting, plasma membrane 4 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98SH2|AT2B1_CHICK0.000e+058.17Plasma membrane calcium-transporting ATPase 1 OS=G... [more]
sp|Q16720|AT2B3_HUMAN0.000e+057.88Plasma membrane calcium-transporting ATPase 3 OS=H... [more]
sp|Q64568|AT2B3_RAT0.000e+057.02Plasma membrane calcium-transporting ATPase 3 OS=R... [more]
sp|Q64542|AT2B4_RAT0.000e+057.91Plasma membrane calcium-transporting ATPase 4 OS=R... [more]
sp|P11505|AT2B1_RAT0.000e+057.52Plasma membrane calcium-transporting ATPase 1 OS=R... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1J4D20.000e+061.40Calcium-transporting ATPase OS=Strigamia maritima ... [more]
A0A0X3PD520.000e+060.47Calcium-transporting ATPase OS=Schistocephalus sol... [more]
A0A4D5R9F70.000e+060.64Calcium-transporting ATPase OS=Scolopendra viridis... [more]
A0A067QGX40.000e+061.22Calcium-transporting ATPase OS=Zootermopsis nevade... [more]
A0A2J7R4L40.000e+062.36Calcium-transporting ATPase OS=Cryptotermes secund... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b0.000e+057.37ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
atp2b3b0.000e+057.05ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
atp2b40.000e+055.93ATPase plasma membrane Ca2+ transporting 4 [Source... [more]
atp2b3a0.000e+055.41ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
atp2b3b4.394e-7659.90ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007912.13.850e-14058.10pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 g... [more]
ENSPMAT00000001468.19.769e-7657.68pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 g... [more]
ENSPMAT00000010087.11.075e-7557.08pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 g... [more]
ENSPMAT00000002775.12.153e-7560.89pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gen... [more]
ENSPMAT00000007505.11.525e-5983.77pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gen... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMC11.139e-10538.37Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
PMR18.162e-6932.12High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA58.042e-5229.07Protein with similarity to P-type ATPase sodium pu... [more]
ENA21.595e-4928.77P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA14.315e-4928.61P-type ATPase sodium pump; involved in Na+ and Li+... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417750.000e+055.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417744.231e-16943.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445175.279e-12436.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356162.377e-6331.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364553.706e-6031.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b0.000e+058.15ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
atp2b20.000e+056.16ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
ENSORLT00000024208.20.000e+056.60plasma membrane calcium-transporting ATPase 1-like... [more]
ENSORLT00000036123.10.000e+054.86plasma membrane calcium-transporting ATPase 1-like... [more]
ENSORLT00000031940.10.000e+054.22plasma membrane calcium-transporting ATPase 1-like... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038461.10.000e+099.92SMESG000038461.1[more]
SMESG000038461.10.000e+099.91SMESG000038461.1[more]
SMESG000063816.10.000e+069.40SMESG000063816.1[more]
SMESG000063816.10.000e+069.77SMESG000063816.1[more]
SMESG000014734.10.000e+062.72SMESG000014734.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018507 ID=SMED30018507|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=4567bp
CTGTAGAAATCTGTTTGAAGTCGTCATCTAAATATGGAATCAGATTCAAA
ATTTTCTATTGGAGTTAAAGAATTAACTGAACTGATGGGGTTTCGGCAGT
TTGAAGCAATTGAAGAGATTAAAAACAAATACCAAGACATAAACAATTTA
TGTGCAAAATTAAAAACGTCTCCTAATGACGGTCTCAGTGCAACAGATGA
TTTAATTTTAAGACGTGAAGTATTTGGTTCAAATGTTATTCCACCAAAAC
CACCGAAAACATTTTTACGGTTGATGTTTGAGGCCCTTCAAGATGTAACA
TTAATAGTATTAATGGGTGCTGCAGTTATTTCTTTAGGCTTGGCTTTATA
TTCAAAATACTCGGGCGAAGAAACATCAGATTCCAGTGAAAGTGATGCAG
GATGGATTGAAGGAGTTGCCATTCTGGGAGCTGTCGTAGTAGTAGTAATG
GTAACTGCATTTAATGATTGGCAAAAGGAAAAACAATTTCGAGGTCTTCA
AGATAAGATTGAAGGCAATCATAAAATTGCAGTAATTCGGTCTGGTCGAA
TAGGAGAGATATTAGTCGGAGATATTGTTGTAGGAGATATTTGCCAAGTA
AAATACGGTGATCTTTTACCTGCGGATGGAATTATTATTCAGAGCAATGA
TATTAAGGTGGATGAAAGTTCTTTAACCGGTGAACCAGATCATGTAAAAA
AGGGTGTTGATACGGATCCAATGCTACTTTCAGGAACTCACGTTATGGAA
GGTTCCGGTAAAATGGTTGTGACTGCTGTTGGTTTAAGCTCCCAGGCCGG
AATAATTTTTGCACTATTAGGAGCAGCAGAACTAAATGAAAAGTCAACTA
AAGAACCAACAGAAACAAAAAAGACTAAGAAAAATAAAAGCGACTCCGTT
GAATTAGAAAAATTGACTGACAATACTGAAAATCATTACCTTTCTGATAA
ACAAAAAGACGATACAACAAAAGAAGAGGCAAAGAAAAAAAAGAAAAAAA
GTTTCAAAAAAAAGGGTTCCGTTCTTCAAACAAAATTGAATAAACTTGCA
GCTCTTATTGGAAAAGTTGGAACTGTAATTGCAGTTTTAACGGTAGTTAT
TTTGATAATAAGATTTTGCATCGAAACATATCACATAAAAAGTATGTCGT
GGCATATGGATCATTTAAAGAAAATGATACACTTTCTTATAATTGGAGTT
ACTGTACTAGTTGTTGCTGTACCAGAAGGTCTTCCACTTGCAGTAACAAT
TTCACTGGCATATTCAGTTAAAAAAATGATGAAGGATAACAATCTGGTTC
GACATCTTGATGCCTGTGAAACAATGGGCAATGCAACGGCTATTTGTTCT
GATAAGACCGGTACACTCACAACCAACCGAATGACTGTCGTTCAAGCTTT
TTTTAATGGGAAATATTATCGGCAAAATTTACCACAGTATAATGACTTAC
CAGAAAATTTAACTGATAAACTTTTGAAAAACATAGCTTTGAATAGTAGC
TACACATCCCGGCTTTTGCCAGGAAAATCCCAAGGAGAACTACTTACTCA
AATTGGAAATAAAACTGAATGTTCATTATTAGGTTTTATGAATGGAGCGA
TTGGTAAAGACTATGCAGAACTTAGATCTATTTGGACAGAAGATAAACTT
ATTAAAATCTATACATTTAATTCTGTCCGAAAATCAATGAGTACCATAAT
TAAAGATAAAAATGTGTTATTGCTCACCAAAGGAGCTTCAGAAATGGTTC
TTAGCAAGTGTTCGTTTATTGTTGGGAAAGATGGCTCAATACAAAACTTT
ACAAAAAATGATGCCAATGAGTTGATCAAATCTGTAATTGAGCCAATGGC
TAAAGATGGCCTTAGAACTATTGGATTAGCATACAAAGAATTTGTAGATG
ATGGAAGTGAACCTCAGAAAGGTCAAGACATATATTTGCCTAATATTGAT
TTAGAAGACGAACATAATATAATAAAAGATCTCACATGCATTGGAATTGT
TGGAATAGAGGATCCGGTCAGACCAGAGGTTCCACCAGCCATTAAGAAAT
GCCAAAATGCAGGAATTACTGTACGCATGGTAACAGGTGACAACGTAAAT
ACTGCCAGGTCGATTGCTATTAAATGTGGCATTTTGAAGCCGGAAGATGA
CTTTATTGTGATGGAAGGGAAAGAATTTAATAATAAAATAAGAGATTCAA
AAACTGGAAAAATTAAACAAAGCAAAATTGACCAAATTTGGCCTCGACTT
CGTGTTTTAGCCCGTTCCTCACCTCAGGATAAATATACTCTCGTAACTGG
TATTATAGACAGCCATCTCAGCACGGCTAGAGAAGTCGTAGCTGTTACAG
GAGATGGTACAAATGATGGACCGGCATTGAAAAAAGCAGATGTAGGGTTT
GCTATGGGAATAGCAGGAACGGATGTGGCAAAAGAGGCTTCTGACATTAT
TCTAACTGATGATAATTTCACTAGTATTGTTAAAGCAGTTCTTTGGGGAA
GAAATGTTTATGATTCGATCTCAAAATTCCTTCAATTTCAGTTAACAGTT
AATGTTGTTGCAGTTATTGTAGCGTTTGTTGGCGCTTGCGTGCTCACAGA
CAGTCCTCTTAAAGCTGTACAAATGTTATGGGTAAATCTTATCATGGATA
CTCTGGCTTCTCTAGCATTAGCGACAGAATTACCCACTGAGGAATTATTA
GATCGGGCTCCTTATGGAAGAACAAAGTCTATAATTAGTCGTCGAATGGT
AAAAAATATTTTGGGTCAATCTCTTTATCAGCTTATTGTGACATTTTATC
TAATTTGGCATGGAGAAATACTTTTAGATGTAGACAATGCAAGAGGGATG
ACAGCAAGAGGAAATACCAAGCCATCTGAACATTTTACTGCTGTTTTCAA
TACGTTTGTTATAATGACACTTTTCAATGAAATAAATTCGCGCAAAATTC
ACGGACAACGAAATGTTTTCATTGGTATAAATCGCAATATAATTTTCATT
ATTATATGGATTACAACATTTGTTGGTCAGATTGTTATAATTCAATTCGG
CGGCTATGCACTTAGTACGGCACCTTTAGATATTGAACACTGGATGTGGT
GTATGTTTTTTGGATTTGGAAGTTTGCTTTGGGCACAGCTTGTGAACAGT
GTTCCGACAAGTATTGTTCCAAAACGAAAAAAGAAAGAAATTCCACAACC
AGAAAAAGACGAATCCGAGTCAGATGAAGAATTTGACGAATTGGGAACTT
CTACGCCATATGGTGAATCTGAAGATGAATTGAAAAGTCCTGGACAAAAA
CTTTGGATTAGAGGTTTATCTAGGCTCCAAACTCAGCAAAGCAAGCGTAA
TTCAATTTTGGATAATAGAACTGACGGTGTTTATGGAGGAGTTCGACGGT
ATACTCTTAGTCAAGTAGCTGGCATTGTTCCCATGTTGGGTGGCCGGCAA
ATATCTTGTCCGGTTGGACGGTTAAAATCCGCTAATTCTGTCTCATCTGA
ATACGATTCAGATTTAGATAAACATACTGAACGAAACAAGTTAATTTCGA
CTATGAGTTTACCGTCTTCTGGTCACCCTTTTTCACGTGCTTCTTCTACT
CCCCAAAATAATACTCCGGGTTACAAATCTGATTTACATCGTTCTGAAGG
AATAGACGAAGAGTCAGAAGAAGAGGAAAACGAATGATTTAAACAAAAAT
TTTAACATAATTTTTTAAGCTTGCAGATATTCGCATTATGGTCGCTATAA
AAAAAACAACATTATAAACAGATTAAATCTGTCCTGTTTGCAATTTATTT
ACATTCAATTTAATAATTATAACTTTATATGGCTCGTTTCATTTGTTTTT
AACTGTATTATTATTATATCGTAGAAAATTAGTATTAGTTTCCTGTCTGT
AACATTTATGTTTTAGCAGTTTTTTATTCTTCTTTGACATTGGATATTTT
ATGAAATTTCTCTATTATATTGATAATTAAAACAAAAATGATGAATGTTT
CTGACATTTATTTATATTTAATTAATTTCACTTTCTGGCGATGAGAAAAA
CTAACTGAAATTTCACGGTTTATCGTCATCGTCCAATGCTTCCTAATTCT
TCCATCCAGTCCAGTCAAATTCTAATTCACAGAATAATGGCTGTTGAAGC
GTTTCAATCATCGAGGTCTCCTCCACCGTATTCAGCTTATCCCGGCTCTA
GATAATTTATTTTATCTGAATTCTTAGCTCATTTTCATATCCTGACATTT
GATTTTAAGAAAATTAAGAAAATAATTTAAATAAGCTGTGATTGAAATTT
AATTAAATTCTAAAAAATAATTAAAATAATCTGTGATTGAAATTTGTTTT
AATGTTCTGTTACTTTATTTTACTTTATGTTTATTCTTGAAGTTTTAGTG
ATTTTCTAATATTTATCTGTCATCATCTATGCTAAATATTACTGTATATA
ATTTTTATATGCCCACTGATTGAATCTATGCATTGTAATAAACATTTAGA
AATAACAAAGCTTAGAATGCTAACCTTTATTTTTCTTATTTTTATAATTA
GTATTGTGTGAAAATTT
back to top

protein sequence of SMED30018507-orf-1

>SMED30018507-orf-1 ID=SMED30018507-orf-1|Name=SMED30018507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1218bp
MESDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDG
LSATDDLILRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVIS
LGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEK
QFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGI
IIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVG
LSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKSDSVELEKLTDNTEN
HYLSDKQKDDTTKEEAKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIA
VLTVVILIIRFCIETYHIKSMSWHMDHLKKMIHFLIIGVTVLVVAVPEGL
PLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRM
TVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQ
GELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRK
SMSTIIKDKNVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKS
VIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDL
TCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGI
LKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDK
YTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAK
EASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVG
ACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSI
ISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEH
FTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQI
VIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKRKK
KEIPQPEKDESESDEEFDELGTSTPYGESEDELKSPGQKLWIRGLSRLQT
QQSKRNSILDNRTDGVYGGVRRYTLSQVAGIVPMLGGRQISCPVGRLKSA
NSVSSEYDSDLDKHTERNKLISTMSLPSSGHPFSRASSTPQNNTPGYKSD
LHRSEGIDEESEEEENE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006408P-type_ATPase_IIB
IPR001757P_typ_ATPase
IPR030320ATP2B1
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR023214HAD_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR018303ATPase_P-typ_P_site
IPR023299ATPase_P-typ_cyto_dom_N
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 26..46
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 772..791
score: 75.78
coord: 438..452
score: 80.68
coord: 676..686
score: 69.84
coord: 210..224
score: 53.67
coord: 654..665
score: 48.73
coord: 796..808
score: 61.82
NoneNo IPR availablePFAMPF08282Hydrolase_3coord: 750..818
e-value: 3.7E-5
score: 23.6
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 782..1043
e-value: 4.5E-73
score: 248.2
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 310..452
e-value: 3.4E-39
score: 136.8
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 139..263
e-value: 1.8E-26
score: 95.0
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 496..579
e-value: 7.3E-15
score: 54.8
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 163..271
e-value: 1.6E-25
score: 89.7
coord: 325..417
e-value: 5.9E-10
score: 39.0
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 420..824
e-value: 0.0
score: 272.1
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 420..824
e-value: 0.0
score: 272.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1171..1199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1171..1217
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1048..1084
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..317
NoneNo IPR availablePANTHERPTHR24093CATION TRANSPORTING ATPASEcoord: 3..1092
NoneNo IPR availableCDDcd02081P-type_ATPase_Ca_PMCA-likecoord: 60..905
e-value: 0.0
score: 1185.08
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 951..968
NoneNo IPR availableTMHMMTMhelixcoord: 341..363
NoneNo IPR availableTMHMMTMhelixcoord: 245..267
NoneNo IPR availableTMHMMTMhelixcoord: 384..406
NoneNo IPR availableTMHMMTMhelixcoord: 88..107
NoneNo IPR availableTMHMMTMhelixcoord: 1018..1040
NoneNo IPR availableTMHMMTMhelixcoord: 832..854
NoneNo IPR availableTMHMMTMhelixcoord: 981..1003
NoneNo IPR availableTMHMMTMhelixcoord: 909..931
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 30..105
e-value: 9.4E-8
score: 41.8
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 34..100
e-value: 6.5E-14
score: 51.4
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 857..1037
e-value: 2.8E-40
score: 138.0
IPR006408P-type ATPase, subfamily IIBTIGRFAMTIGR01517TIGR01517coord: 326..1042
e-value: 4.9E-240
score: 797.2
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 737..853
e-value: 1.4E-29
score: 100.8
coord: 325..464
e-value: 7.9E-24
score: 81.9
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 453..661
e-value: 4.8E-25
score: 90.3
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 444..666
IPR030320Plasma membrane calcium-transporting ATPase 1PANTHERPTHR24093:SF245PLASMA MEMBRANE CALCIUM-TRANSPORTING ATPASE 1coord: 3..1092
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 440..446
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 32..1043
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 437..876
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 163..261