SMED30018503

Overview
NameSMED30018503
Smed IDSMED30018503
Length (bp)941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018503 (SMED30018503) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018503 (SMED30018503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018503 (SMED30018503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018503 (SMED30018503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018503SMESG000023942.1 SmedASXL_011004SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018503SMESG000023942.1 dd_Smed_v6_11443_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018503 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.015576:3705..4688 +4615
v31.019744:9514..10391 +4094
Homology
BLAST of SMED30018503 vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 72.7886 bits (177), Expect = 1.695e-13
Identity = 49/171 (28.65%), Postives = 82/171 (47.95%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L QL  LE+L++ +N+L  LP +I  L+ L    ++   L   P   C+L  LE L +  N +  LP     L+RLK L+   N   + P +   L  L  +    N    + ++ S L +L  L   +N++    D ++  T  + +L L GN+  ++P H+  +S V L
Sbjct:  200 LLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELT-GLEELVLQGNQIAVLPDHFGQLSRVGL 369          

HSP 2 Score: 62.3882 bits (150), Expect = 4.442e-10
Identity = 43/132 (32.58%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRL--KWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             C+L  LE L + NN L ALP +   L+ L   N++      FP ++  L  LE L +S N ++ +P+ I  L RL   WLD+  N I  LP+S   L  L  +  Q N    + + F  L+++     K N
Sbjct:  246 FCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDN--NRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDN 375          
BLAST of SMED30018503 vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 72.7886 bits (177), Expect = 1.695e-13
Identity = 49/171 (28.65%), Postives = 82/171 (47.95%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L QL  LE+L++ +N+L  LP +I  L+ L    ++   L   P   C+L  LE L +  N +  LP     L+RLK L+   N   + P +   L  L  +    N    + ++ S L +L  L   +N++    D ++  T  + +L L GN+  ++P H+  +S V L
Sbjct:  200 LLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELT-GLEELVLQGNQIAVLPDHFGQLSRVGL 369          

HSP 2 Score: 62.3882 bits (150), Expect = 4.442e-10
Identity = 43/132 (32.58%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRL--KWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             C+L  LE L + NN L ALP +   L+ L   N++      FP ++  L  LE L +S N ++ +P+ I  L RL   WLD+  N I  LP+S   L  L  +  Q N    + + F  L+++     K N
Sbjct:  246 FCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDN--NRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDN 375          
BLAST of SMED30018503 vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 72.7886 bits (177), Expect = 1.727e-13
Identity = 49/171 (28.65%), Postives = 82/171 (47.95%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L QL  LE+L++ +N+L  LP +I  L+ L    ++   L   P   C+L  LE L +  N +  LP     L+RLK L+   N   + P +   L  L  +    N    + ++ S L +L  L   +N++    D ++  T  + +L L GN+  ++P H+  +S V L
Sbjct:  200 LLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELT-GLEELVLQGNQIAVLPDHFGQLSRVGL 369          

HSP 2 Score: 62.003 bits (149), Expect = 4.818e-10
Identity = 43/132 (32.58%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRL--KWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             C+L  LE L + NN L ALP +   L+ L   N++      FP ++  L  LE L +S N ++ +P+ I  L RL   WLD+  N I  LP+S   L  L  +  Q N    + + F  L+++     K N
Sbjct:  246 FCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDN--NRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDN 375          
BLAST of SMED30018503 vs. Ensembl Human
Match: LRRC1 (leucine rich repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:14307])

HSP 1 Score: 71.2478 bits (173), Expect = 3.602e-13
Identity = 48/154 (31.17%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNN-----------------------QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L QL +LE+L++GNN                       QLS LP EIGNLKNL+  +++   L   P  I  L  L  L IS+N +  +P+ I +LK+L  L    N ++ LPE+      L  +    N  + +      L KL  L+   N+
Sbjct:  170 LTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNK 323          

HSP 2 Score: 68.5514 bits (166), Expect = 2.632e-12
Identity = 52/184 (28.26%), Postives = 89/184 (48.37%), Query Frame = 2
Query:  287 RLQMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            R ++  I   I  C+   L+  +   N L+ LP     L+NL   ++N  +L   P +I  L  L  L + EN +++LP+S+ QL+RL+ LD G N I +LPES  +L+ L  +    N   ++     +L  L  L    N+L    +++   T S+T L +S N    +P     +  + ++
Sbjct:   91 RNEIPEIPESISFCK--ALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLT-SLTDLVISQNLLETIPDGIGKLKKLSIL 271          

HSP 3 Score: 57.3806 bits (137), Expect = 1.273e-8
Identity = 38/128 (29.69%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            LT L  L I  N L  +P+ IG LK L    ++   L+  P ++ +   L  L ++EN +  LP SI +LK+L  L++  N +  LP+       L     + N   +I    S  T+L  L    N+
Sbjct:  242 LTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATELHVLDVAGNR 369          
BLAST of SMED30018503 vs. Ensembl Human
Match: LRRIQ4 (leucine rich repeats and IQ motif containing 4 [Source:HGNC Symbol;Acc:HGNC:34298])

HSP 1 Score: 70.8626 bits (172), Expect = 5.828e-13
Identity = 46/172 (26.74%), Postives = 82/172 (47.67%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            LC L  LE +++  N++ A+P EIG+L  L KF +   NL   P S+CQ  QL  L++S N +  +P S  +L+++  +    N +  +P        L+ +        ++R  F  L  L++L    N L      +    N +  L L  N+   +PS   ++S ++++
Sbjct:  184 LCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNLPVLPASLCQCSQLSVLDLSHNLLHSIPKSFAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGLHRLRGSFRCLVNLRFLDLSQNHLHHCPLQICALKN-LEVLGLDDNKIGQLPSELGSLSKLKIL 354          

HSP 2 Score: 59.3066 bits (142), Expect = 3.081e-9
Identity = 38/107 (35.51%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQ---LSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            L  LE+L IG +Q   L+ +P  I  L++L +  I + +L Y P S+  +  LE L+   N +  LP++ICQ + LK L    N ++ LPE+  SLV+L  +    N
Sbjct:  371 LASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSMPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDN 477          

HSP 3 Score: 55.8398 bits (133), Expect = 4.319e-8
Identity = 37/128 (28.91%), Postives = 55/128 (42.97%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  LE L +  N L  LP EI N   L +  +       FP  +C L  LE +++ EN I  +P  I  L  L+      N++  LP S      L  ++   NL   I   F++L K+  +    N+
Sbjct:  141 LHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNLPVLPASLCQCSQLSVLDLSHNLLHSIPKSFAELRKMTEIGLSGNR 268          

HSP 4 Score: 51.9878 bits (123), Expect = 7.674e-7
Identity = 39/154 (25.32%), Postives = 62/154 (40.26%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQ-----------------------LVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            LCQ ++L  L++ +N L ++P     L+ + +  ++   L   P  IC+                       LV L +L++S+N +   P  IC LK L+ L    N I  LP    SL  L  +    N F+        L  L+ L    +Q
Sbjct:  230 LCQCSQLSVLDLSHNLLHSIPKSFAELRKMTEIGLSGNRLEKVPRLICRWTSLHLLYLGNTGLHRLRGSFRCLVNLRFLDLSQNHLHHCPLQICALKNLEVLGLDDNKIGQLPSELGSLSKLKILGLTGNEFLSFPEEVLSLASLEKLYIGQDQ 383          

HSP 5 Score: 51.2174 bits (121), Expect = 1.409e-6
Identity = 38/133 (28.57%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINH---CNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L+KL+ L +  N+  + P E+ +L +L K  I       L+Y P  I +L  L+ L I  N + +LP S+  +  L+ LD   N +  LP++      L  +  + NL   +      L  LK L+   N
Sbjct:  345 LGSLSKLKILGLTGNEFLSFPEEVLSLASLEKLYIGQDQGFKLTYVPEHIRKLQSLKELYIENNHLEYLPVSLGSMPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDN 477          
BLAST of SMED30018503 vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972934:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 72.4034 bits (176), Expect = 8.095e-14
Identity = 44/128 (34.38%), Postives = 73/128 (57.03%), Query Frame = 2
Query:  317 ICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLS 700
            + + +L KLE+L++G N+L ALP EIG L +L +F ++  +L+  P SI     L+ L++SEN I  LP ++ ++  L  L+   N I +LP SF  L  L  +    N    + N+ S++ K + L+
Sbjct:  168 LSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRN---SLHNLTSEIGKCQSLT 292          

HSP 2 Score: 67.0106 bits (162), Expect = 4.047e-12
Identity = 42/131 (32.06%), Postives = 68/131 (51.91%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L  L++ +N+L+ LP EIGNL  LI+ N+N  +++  P ++     L  LN+S N  + LP +IC+   +  L     S++ LP +  SL +L  +  + NL   I     +L KL+ L    N+
Sbjct:   55 LFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNE 185          

HSP 3 Score: 57.3806 bits (137), Expect = 5.957e-9
Identity = 45/152 (29.61%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  278 QLLRLQM--------RSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYI---NFQTNLFIKIRNVFSDLTKLKYLS 700
            +L RLQM         ++ S+I  CQ   L +L +G N L+ LP+ IG+L+ L   N++  NLS  P +I     L  L++ +N ++ LP +I + + L  LD   N +  LP +   L  L  +     QT   +K+     D   +K ++
Sbjct:  264 ELKRLQMLKADRNSLHNLTSEIGKCQ--SLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQTQSILKLSETRDDRKGIKVVT 413          

HSP 4 Score: 56.225 bits (134), Expect = 1.337e-8
Identity = 47/192 (24.48%), Postives = 83/192 (43.23%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQ-----------------------LVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            LT+L +LN+  N ++ LP+ + N K L   N++    +  P +IC+                       L  L  L   +N +  +P SI +L++L+ LD G N +  LP     L  L       N    + +  S    L  L    NQ++   ++L    N +T L++S N  + +PS +  +  +Q++
Sbjct:   81 LTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPN-LTDLNISINEIIELPSSFGELKRLQML 271          

HSP 5 Score: 53.1434 bits (126), Expect = 1.540e-7
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +C+ + +  L++    L+ LP+ IG+L NL         L   P SI +L +LE L++ +N +  LP  I +L  L+      NS++ LP+S S    L  ++   N  I++      +  L  L+   N+
Sbjct:  124 ICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINE 254          

HSP 6 Score: 51.6026 bits (122), Expect = 4.910e-7
Identity = 33/131 (25.19%), Postives = 63/131 (48.09%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L ++  L  LNI  N++  LP+  G LK L     +  +L      I +   L  L + +NF++ LP++I  L++L  L+   N++SD+P++  +   L  ++ + N+  ++         L  L    N+
Sbjct:  239 LGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNK 369          

HSP 7 Score: 49.6766 bits (117), Expect = 1.618e-6
Identity = 32/126 (25.40%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSF 703
            CQ  +++ ++   + L A+P++I   + L   N+   N+    H +  L  L  L++S+N ++ LP  I  L +L  L+   NSI+ LP++  +   L  +N  +N F ++     + + +  LS 
Sbjct:   11 CQ-RQVDSIDRSQSNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSL 135          
BLAST of SMED30018503 vs. Ensembl Celegans
Match: let-413 (pep chromosome:WBcel235:V:7972924:7977774:-1 gene:WBGene00002632.1 transcript:F26D11.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-413)

HSP 1 Score: 72.0182 bits (175), Expect = 9.604e-14
Identity = 44/128 (34.38%), Postives = 73/128 (57.03%), Query Frame = 2
Query:  317 ICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLS 700
            + + +L KLE+L++G N+L ALP EIG L +L +F ++  +L+  P SI     L+ L++SEN I  LP ++ ++  L  L+   N I +LP SF  L  L  +    N    + N+ S++ K + L+
Sbjct:  168 LSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRN---SLHNLTSEIGKCQSLT 292          

HSP 2 Score: 67.0106 bits (162), Expect = 4.302e-12
Identity = 41/128 (32.03%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L++ +N+L+ LP EIGNL  LI+ N+N  +++  P ++     L  LN+S N  + LP +IC+   +  L     S++ LP +  SL +L  +  + NL   I     +L KL+ L    N+
Sbjct:   58 LRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNE 185          

HSP 3 Score: 56.9954 bits (136), Expect = 6.931e-9
Identity = 45/152 (29.61%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  278 QLLRLQM--------RSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYI---NFQTNLFIKIRNVFSDLTKLKYLS 700
            +L RLQM         ++ S+I  CQ   L +L +G N L+ LP+ IG+L+ L   N++  NLS  P +I     L  L++ +N ++ LP +I + + L  LD   N +  LP +   L  L  +     QT   +K+     D   +K ++
Sbjct:  264 ELKRLQMLKADRNSLHNLTSEIGKCQ--SLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQTQSILKLSETRDDRKGIKVVT 413          

HSP 4 Score: 56.6102 bits (135), Expect = 1.146e-8
Identity = 47/192 (24.48%), Postives = 83/192 (43.23%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQ-----------------------LVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            LT+L +LN+  N ++ LP+ + N K L   N++    +  P +IC+                       L  L  L   +N +  +P SI +L++L+ LD G N +  LP     L  L       N    + +  S    L  L    NQ++   ++L    N +T L++S N  + +PS +  +  +Q++
Sbjct:   81 LTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPN-LTDLNISINEIIELPSSFGELKRLQML 271          

HSP 5 Score: 53.1434 bits (126), Expect = 1.498e-7
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +C+ + +  L++    L+ LP+ IG+L NL         L   P SI +L +LE L++ +N +  LP  I +L  L+      NS++ LP+S S    L  ++   N  I++      +  L  L+   N+
Sbjct:  124 ICECSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINE 254          

HSP 6 Score: 51.2174 bits (121), Expect = 4.996e-7
Identity = 33/131 (25.19%), Postives = 63/131 (48.09%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L ++  L  LNI  N++  LP+  G LK L     +  +L      I +   L  L + +NF++ LP++I  L++L  L+   N++SD+P++  +   L  ++ + N+  ++         L  L    N+
Sbjct:  239 LGRMPNLTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNK 369          

HSP 7 Score: 49.6766 bits (117), Expect = 1.618e-6
Identity = 32/126 (25.40%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSF 703
            CQ  +++ ++   + L A+P++I   + L   N+   N+    H +  L  L  L++S+N ++ LP  I  L +L  L+   NSI+ LP++  +   L  +N  +N F ++     + + +  LS 
Sbjct:   11 CQ-RQVDSIDRSQSNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICECSSITILSL 135          
BLAST of SMED30018503 vs. Ensembl Celegans
Match: F56A8.3 (pep chromosome:WBcel235:III:13256880:13262883:1 gene:WBGene00010139.1 transcript:F56A8.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56A8.3)

HSP 1 Score: 62.003 bits (149), Expect = 1.312e-10
Identity = 35/108 (32.41%), Postives = 59/108 (54.63%), Query Frame = 2
Query:  389 EIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            E+ NL+   + +++   +  FP++I QL +L  L++S N I+FLP S C++ +L  LD G   +  LP+    L  L ++N   N    +   F++L  LK+L  K N
Sbjct:   10 ELKNLQEDDELDLSASGIQEFPNAIVQLPRLTKLDLSSNAITFLPESFCKMTKLIRLDFGSCQLHHLPDGIGLLTSLQHLNLYNNQIEDLPLSFANLKSLKWLDLKKN 117          

HSP 2 Score: 56.6102 bits (135), Expect = 8.332e-9
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLD 562
             + QL +L +L++ +N ++ LP     +  LI+ +   C L + P  I  L  L++LN+  N I  LP S   LK LKWLD
Sbjct:   33 AIVQLPRLTKLDLSSNAITFLPESFCKMTKLIRLDFGSCQLHHLPDGIGLLTSLQHLNLYNNQIEDLPLSFANLKSLKWLD 113          
BLAST of SMED30018503 vs. Ensembl Celegans
Match: F56A8.3 (pep chromosome:WBcel235:III:13256880:13262883:1 gene:WBGene00010139.1 transcript:F56A8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56A8.3)

HSP 1 Score: 62.003 bits (149), Expect = 1.312e-10
Identity = 35/108 (32.41%), Postives = 59/108 (54.63%), Query Frame = 2
Query:  389 EIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            E+ NL+   + +++   +  FP++I QL +L  L++S N I+FLP S C++ +L  LD G   +  LP+    L  L ++N   N    +   F++L  LK+L  K N
Sbjct:   10 ELKNLQEDDELDLSASGIQEFPNAIVQLPRLTKLDLSSNAITFLPESFCKMTKLIRLDFGSCQLHHLPDGIGLLTSLQHLNLYNNQIEDLPLSFANLKSLKWLDLKKN 117          

HSP 2 Score: 56.6102 bits (135), Expect = 8.332e-9
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLD 562
             + QL +L +L++ +N ++ LP     +  LI+ +   C L + P  I  L  L++LN+  N I  LP S   LK LKWLD
Sbjct:   33 AIVQLPRLTKLDLSSNAITFLPESFCKMTKLIRLDFGSCQLHHLPDGIGLLTSLQHLNLYNNQIEDLPLSFANLKSLKWLD 113          
BLAST of SMED30018503 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 61.2326 bits (147), Expect = 2.920e-10
Identity = 34/130 (26.15%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            C+  + ++L++ + +++++P+ I  L  L +  +    L+  P  I QLV L+ L +SEN ++ LP+S+  L+ L+ LD   N ++++P     +  L  +  + N  + +     +L+KLK L  + N+
Sbjct:  142 CKEAQDQRLDLSSIEITSIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIGNLSKLKMLDVRENK 271          

HSP 2 Score: 51.6026 bits (122), Expect = 4.538e-7
Identity = 54/208 (25.96%), Postives = 99/208 (47.60%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSI--CQ----------------------LKRLKWLDSGFNSISDLPESFS-SLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            ++R + S I   +LT L    +  N L+ +P EIG+  +L + ++ H +LS  P+SI +LV L  + I  N I  +P+ +  CQ                      L ++  ++   N ++  P       V    IN + N   KI   +FS  T+L  L+ K N+L++   D+   T S+T+L+LS N+  ++P     + +++++
Sbjct:  271 KIRELPSAIG--KLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWT-SITELNLSTNQLKVLPEDIEKLVNLEIL 475          

HSP 3 Score: 48.1358 bits (113), Expect = 5.681e-6
Identity = 38/126 (30.16%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T+L +LN+  N+L +LP ++G+  ++ + N++   L   P  I +LV LE L +S N +  LPN I  L +L+ LD   N +  +P     L  L  +  Q+N  + +     +L  L+ L    N
Sbjct:  424 TRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGEN 549          
BLAST of SMED30018503 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308623)

HSP 1 Score: 79.337 bits (194), Expect = 4.849e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.390e-14
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.471e-13
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.609e-9
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.725e-9
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.433e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308632)

HSP 1 Score: 79.337 bits (194), Expect = 4.856e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.404e-14
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.485e-13
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.618e-9
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.735e-9
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.436e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308620)

HSP 1 Score: 79.337 bits (194), Expect = 4.867e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.423e-14
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.504e-13
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.630e-9
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.751e-9
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.440e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308621)

HSP 1 Score: 79.337 bits (194), Expect = 4.867e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.423e-14
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.504e-13
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.630e-9
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.751e-9
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.440e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335522)

HSP 1 Score: 79.337 bits (194), Expect = 4.871e-16
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.430e-14
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.511e-13
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.634e-9
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.757e-9
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.441e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. Ensembl Zebrafish
Match: si:dkey-1h4.4 (si:dkey-1h4.4 [Source:ZFIN;Acc:ZDB-GENE-160728-41])

HSP 1 Score: 91.6633 bits (226), Expect = 6.508e-23
Identity = 58/171 (33.92%), Postives = 86/171 (50.29%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            +  L  L  L I +N LS LP  +G+L  L +     C L   P SI +L +L+ L +  N I+ LP+    L  L+WL+   N + DLPE  + L  L +IN   N F  I  V +D+  L+ LS K N +   +D L+   + +TKLD+  N  +  P HW  +  + L
Sbjct:   78 IGSLKHLTYLGINHNPLSVLPEALGDLTELRELWAVGCGLISLPSSIGKLSKLQKLGVHNNIITNLPSQFGSLSNLQWLNLADNKLQDLPEDINHLPSLVFINLDKNCFTDIPTVLTDMANLQILSLKFNSIRTLEDYLIPGFSRLTKLDIRENPLMDRPPHWKGLDFILL 248          

HSP 2 Score: 35.039 bits (79), Expect = 6.508e-23
Identity = 19/52 (36.54%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  148 YDKFEKCKINKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEV 303
            YD   +C   + E LN SH  + V      +L  ++ L LNNN +I PP+E+
Sbjct:    4 YDMVLECFNKQQESLNMSHRGLVVLPPGVSRLVTLKKLFLNNNQLILPPDEI 55          

HSP 3 Score: 53.9138 bits (128), Expect = 6.006e-8
Identity = 40/135 (29.63%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  308 YSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            Y  +  C   + E LN+ +  L  LP  +  L  L K  +N+  L   P  I  L +LE L +  N ++ LP++I  LK L +L    N +S LPE+   L +L  +       I + +    L+KL+ L   +N
Sbjct:    4 YDMVLECFNKQQESLNMSHRGLVVLPPGVSRLVTLKKLFLNNNQLILPPDEILHLEKLEELILDRNQLTMLPSNIGSLKHLTYLGINHNPLSVLPEALGDLTELRELWAVGCGLISLPSSIGKLSKLQKLGVHNN 138          
BLAST of SMED30018503 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 71.633 bits (174), Expect = 1.687e-13
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L +LN+ +NQL++LP + G   ++++ N+    L+  P  IC LV LE L +S N +  LP  I  L++L+ LD   N +  LP   + L DL  +    N    +      LT L YL    N
Sbjct:  360 LSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGEN 483          

HSP 2 Score: 60.8474 bits (146), Expect = 6.056e-10
Identity = 39/110 (35.45%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDL--YYINFQTNL 646
            +C L  LE L + NN L  LP  IGNL+ L + ++    L   P+ I  L  L+ L ++ N ++ LP  I  L  L +L  G N +  LPE   +L +L   Y+N   NL
Sbjct:  400 ICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNL 509          

HSP 3 Score: 56.6102 bits (135), Expect = 1.426e-8
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T + +LN+  NQL+ +P +I  L +L    +++  L   P+ I  L +L  L++ EN +  LPN I  LK L+ L    N ++ LP     L +L Y+    NL   +      L  L+ L    N
Sbjct:  381 TSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDN 506          

HSP 4 Score: 54.6842 bits (130), Expect = 7.123e-8
Identity = 31/91 (34.07%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFS 604
            L+KL  L+I  N++  LP EIG L NLI  ++ H  L + P  I    Q+  L++  N +  LP +I  L  +  L   +N +S +P S +
Sbjct:  193 LSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLA 283          

HSP 5 Score: 54.299 bits (129), Expect = 1.029e-7
Identity = 48/176 (27.27%), Postives = 85/176 (48.30%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPES-FSSLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP---SHWAAMSHVQL 835
            + +L  L  L++ +NQL  LP EIGN   +   ++ H +L   P +I  L  +  L +  N +S +P S+ + + L+ L+   N+IS LPE   SSLV+L  +    N F        S  + +  L+ +HN++      +      ++KL++  N+   +P     W +M  + L
Sbjct:  213 IGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNL 388          

HSP 6 Score: 53.5286 bits (127), Expect = 1.513e-7
Identity = 43/167 (25.75%), Postives = 82/167 (49.10%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            +LT+L +L + +N+L +LP E+G L  L+   ++  +L+  P S+  L +L  L++  N +  +P  + ++  L  L   FN I+ + +   +L  L  ++ + N   ++     +L  L  L   HNQL     ++   T  +T LDL  N  L +P     ++ +
Sbjct:  100 ELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQ-ITNLDLQHNDLLDLPETIGNLASI 265          

HSP 7 Score: 48.1358 bits (113), Expect = 7.683e-6
Identity = 33/130 (25.38%), Postives = 60/130 (46.15%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            C+     +L++    +  LP+ I  L  L +  +    L   P  +  L  L  L +SEN ++ LP+S+  LK+L+ LD   N + ++P     +  L  +  + N    +     +L+KL  LS + N+
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENK 205          
BLAST of SMED30018503 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 71.633 bits (174), Expect = 1.687e-13
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L +LN+ +NQL++LP + G   ++++ N+    L+  P  IC LV LE L +S N +  LP  I  L++L+ LD   N +  LP   + L DL  +    N    +      LT L YL    N
Sbjct:  360 LSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGEN 483          

HSP 2 Score: 60.8474 bits (146), Expect = 6.056e-10
Identity = 39/110 (35.45%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDL--YYINFQTNL 646
            +C L  LE L + NN L  LP  IGNL+ L + ++    L   P+ I  L  L+ L ++ N ++ LP  I  L  L +L  G N +  LPE   +L +L   Y+N   NL
Sbjct:  400 ICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNL 509          

HSP 3 Score: 56.6102 bits (135), Expect = 1.426e-8
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T + +LN+  NQL+ +P +I  L +L    +++  L   P+ I  L +L  L++ EN +  LPN I  LK L+ L    N ++ LP     L +L Y+    NL   +      L  L+ L    N
Sbjct:  381 TSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDN 506          

HSP 4 Score: 54.6842 bits (130), Expect = 7.123e-8
Identity = 31/91 (34.07%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFS 604
            L+KL  L+I  N++  LP EIG L NLI  ++ H  L + P  I    Q+  L++  N +  LP +I  L  +  L   +N +S +P S +
Sbjct:  193 LSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLA 283          

HSP 5 Score: 54.299 bits (129), Expect = 1.029e-7
Identity = 48/176 (27.27%), Postives = 85/176 (48.30%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPES-FSSLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP---SHWAAMSHVQL 835
            + +L  L  L++ +NQL  LP EIGN   +   ++ H +L   P +I  L  +  L +  N +S +P S+ + + L+ L+   N+IS LPE   SSLV+L  +    N F        S  + +  L+ +HN++      +      ++KL++  N+   +P     W +M  + L
Sbjct:  213 IGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNL 388          

HSP 6 Score: 53.5286 bits (127), Expect = 1.513e-7
Identity = 43/167 (25.75%), Postives = 82/167 (49.10%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            +LT+L +L + +N+L +LP E+G L  L+   ++  +L+  P S+  L +L  L++  N +  +P  + ++  L  L   FN I+ + +   +L  L  ++ + N   ++     +L  L  L   HNQL     ++   T  +T LDL  N  L +P     ++ +
Sbjct:  100 ELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQ-ITNLDLQHNDLLDLPETIGNLASI 265          

HSP 7 Score: 48.1358 bits (113), Expect = 7.683e-6
Identity = 33/130 (25.38%), Postives = 60/130 (46.15%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            C+     +L++    +  LP+ I  L  L +  +    L   P  +  L  L  L +SEN ++ LP+S+  LK+L+ LD   N + ++P     +  L  +  + N    +     +L+KL  LS + N+
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENK 205          
BLAST of SMED30018503 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 71.633 bits (174), Expect = 1.687e-13
Identity = 41/124 (33.06%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L +LN+ +NQL++LP + G   ++++ N+    L+  P  IC LV LE L +S N +  LP  I  L++L+ LD   N +  LP   + L DL  +    N    +      LT L YL    N
Sbjct:  360 LSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGEN 483          

HSP 2 Score: 60.8474 bits (146), Expect = 6.056e-10
Identity = 39/110 (35.45%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDL--YYINFQTNL 646
            +C L  LE L + NN L  LP  IGNL+ L + ++    L   P+ I  L  L+ L ++ N ++ LP  I  L  L +L  G N +  LPE   +L +L   Y+N   NL
Sbjct:  400 ICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNL 509          

HSP 3 Score: 56.6102 bits (135), Expect = 1.426e-8
Identity = 38/126 (30.16%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T + +LN+  NQL+ +P +I  L +L    +++  L   P+ I  L +L  L++ EN +  LPN I  LK L+ L    N ++ LP     L +L Y+    NL   +      L  L+ L    N
Sbjct:  381 TSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDN 506          

HSP 4 Score: 54.6842 bits (130), Expect = 7.123e-8
Identity = 31/91 (34.07%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFS 604
            L+KL  L+I  N++  LP EIG L NLI  ++ H  L + P  I    Q+  L++  N +  LP +I  L  +  L   +N +S +P S +
Sbjct:  193 LSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLA 283          

HSP 5 Score: 54.299 bits (129), Expect = 1.029e-7
Identity = 48/176 (27.27%), Postives = 85/176 (48.30%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPES-FSSLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP---SHWAAMSHVQL 835
            + +L  L  L++ +NQL  LP EIGN   +   ++ H +L   P +I  L  +  L +  N +S +P S+ + + L+ L+   N+IS LPE   SSLV+L  +    N F        S  + +  L+ +HN++      +      ++KL++  N+   +P     W +M  + L
Sbjct:  213 IGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNL 388          

HSP 6 Score: 53.5286 bits (127), Expect = 1.513e-7
Identity = 43/167 (25.75%), Postives = 82/167 (49.10%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            +LT+L +L + +N+L +LP E+G L  L+   ++  +L+  P S+  L +L  L++  N +  +P  + ++  L  L   FN I+ + +   +L  L  ++ + N   ++     +L  L  L   HNQL     ++   T  +T LDL  N  L +P     ++ +
Sbjct:  100 ELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQ-ITNLDLQHNDLLDLPETIGNLASI 265          

HSP 7 Score: 48.1358 bits (113), Expect = 7.683e-6
Identity = 33/130 (25.38%), Postives = 60/130 (46.15%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            C+     +L++    +  LP+ I  L  L +  +    L   P  +  L  L  L +SEN ++ LP+S+  LK+L+ LD   N + ++P     +  L  +  + N    +     +L+KL  LS + N+
Sbjct:   76 CREENSMRLDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENK 205          
BLAST of SMED30018503 vs. Ensembl Zebrafish
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 71.2478 bits (173), Expect = 3.508e-13
Identity = 44/131 (33.59%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +L +  NQLS+LP E+GNL+ L+  +++   LS  P  I  L+ L  L +SEN +  LP+SI  LK+L  L    N +  L +S     +L  +    NL   +      L KL  L+   N+
Sbjct:  193 LGALPNLRELWLDRNQLSSLPPELGNLRQLVCLDVSENRLSELPTEISGLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNR 323          

HSP 2 Score: 59.3066 bits (142), Expect = 2.994e-9
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +  N L  LP+ IG+LK L    +N   L +   SI +   L  L ++EN +  LP S+ +LK+L  L+   N +S +P      V L  ++ + N   K+    ++ T+L  L    N+
Sbjct:  242 LIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANATELHVLDVAGNR 369          

HSP 3 Score: 57.7658 bits (138), Expect = 8.628e-9
Identity = 42/130 (32.31%), Postives = 64/130 (49.23%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            QL  L  L++ +  L +LPN+IGNL NL+   +    L   P S+  LV+LE L++  N +  LP+++  L  L+  WLD   N +S LP    +L  L  ++   N   ++    S L  L  L    N
Sbjct:  126 QLRGLAHLSLNDVSLQSLPNDIGNLSNLVTLELRENLLKSLPSSLSFLVKLEQLDLGSNVLEVLPDTLGALPNLRELWLDR--NQLSSLPPELGNLRQLVCLDVSENRLSELPTEISGLIALTDLLLSEN 253          
BLAST of SMED30018503 vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 71.633 bits (174), Expect = 3.599e-13
Identity = 44/125 (35.20%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L +  NQLS+LP+E+GNL+ L+  +++   L   P  I  L+ L  L +S+N +S LP+S+ QLK+L  L    N ++ L ES     +L  I    NL   +     +LTKL  L+   N+
Sbjct:    2 LFSLWLDRNQLSSLPSELGNLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNR 126          

HSP 2 Score: 53.5286 bits (127), Expect = 2.659e-7
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            Q+ S+ S   L QL +L  L +  N+L+ L   IG+ +NL +  +    L+  P S+  L +L  LN+  N +  LP+ I     L  L    N +S LP   +   +L+ ++   N  + +    ++L  LK L    NQ
Sbjct:   57 QLSSLPSS--LGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGATELHVLDVAGNRLLNLPFALTNLN-LKALWLAENQ 194          

HSP 3 Score: 53.1434 bits (126), Expect = 3.324e-7
Identity = 34/128 (26.56%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +  NQLS+LP+ +G LK L    ++   L+    SI     L  + ++EN ++ LP S+  L +L  L+   N +  LP        L  ++ + N    +    +  T+L  L    N+
Sbjct:   45 LMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGATELHVLDVAGNR 172          
BLAST of SMED30018503 vs. Ensembl Xenopus
Match: ENSXETT00000034460.1 (volume-regulated anion channel subunit LRRC8E gene 2 [Source:NCBI gene;Acc:100490082])

HSP 1 Score: 70.4774 bits (171), Expect = 7.237e-13
Identity = 38/110 (34.55%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKI 658
             L  LE+L+I +N+L  +P  + +L  L   +I+H N+   P  + QL +LE+  ++ N IS LP+ +C+  RL+ L +GFN++S LP  F+ L  L  +    N  I +
Sbjct:  633 HLHNLEELSISHNRLETIPTSLFSLVRLRNVDISHNNIKVIPLEVGQLSRLEWFAVTGNQISSLPHELCRCTRLRSLKAGFNNLSSLPTVFNKLTLLSTLELAGNHLISL 742          
BLAST of SMED30018503 vs. Ensembl Xenopus
Match: LRRD1 (leucine-rich repeats and death domain containing 1 [Source:NCBI gene;Acc:100490254])

HSP 1 Score: 70.4774 bits (171), Expect = 7.362e-13
Identity = 46/131 (35.11%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +C L++L  LN+ +NQ++ LP+EI  LKN+ +   N+  LS  P  +  L  L+ L IS N +  LP+S   LK L  L+   N IS LP++   L  L  +    N    +     DL  L+ LS   NQ
Sbjct:  104 ICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQ 234          

HSP 2 Score: 67.781 bits (164), Expect = 6.067e-12
Identity = 45/131 (34.35%), Postives = 68/131 (51.91%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            LC L+KLE L++  N L +LP EI +L  L   N+NH  ++  PH I  L  ++ L  + N +S LP  +  L  L+ L    NS+  LP+S +SL +L+ +N   N    +      L++L  L    NQ
Sbjct:   81 LCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQ 211          

HSP 3 Score: 64.3142 bits (155), Expect = 8.870e-11
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            CL  LT L+ L I  N +  LP+   +LKNL   N++   +S  P ++ +L QL  L +S N I  LP  I  LK L+ L    N ++ LP    +L  L  +    N    I +   +L +LK LS  +N
Sbjct:  149 CLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANN 279          

HSP 4 Score: 60.077 bits (144), Expect = 1.740e-9
Identity = 43/137 (31.39%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  317 ICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISE----NFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            I LC L  L+++++  NQ+  +P+ I  L+ L   N+++ +   FP  +  +  LE L IS+      IS LP+ + +LK LK L+   N+I  LP S   + +L  +   +N    +    S L  L+ LS K NQ
Sbjct:  470 IELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLIS-LPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQ 605          

HSP 5 Score: 59.3066 bits (142), Expect = 3.915e-9
Identity = 50/187 (26.74%), Postives = 87/187 (46.52%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXT----------------------NSVTKLDLSGNRDLIVPSHWAAMS 823
            +L++L +L +  NQ+ +LP EIG+LKNL + +++   L++ P  +  L  LE L + +N ++ + + +  LK+LK L    N ++D+ E       +  +    N   ++     +L  LK L  + N L    D L                          N +TKLDLSGN+   VP   ++M+
Sbjct:  198 RLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMT 384          

HSP 6 Score: 58.151 bits (139), Expect = 7.091e-9
Identity = 49/170 (28.82%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  296 MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPS 805
            +  I  ++C C    +E L +  NQ+  LP +I NL+NL + +I    L   P  +  L  L  +  + N + ++P  +    ++  LD   N +S++P++ SS+  L Y+N   N   +I N      KL++L    N+L  F        N +  LDLS N    VPS
Sbjct:  281 LTDITEKVCWC--PAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNKLTVFSVHFCGLHN-LAYLDLSRNEINSVPS 447          

HSP 7 Score: 55.8398 bits (133), Expect = 4.887e-8
Identity = 43/143 (30.07%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCN---LSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            Q+ ++ S I L  L  L  +N+ NN     P E+ ++ +L    I+  +   L   P  + +L  L+ L IS+N I  LP SI ++K L  L +  N +  LP S SSL  L  ++ + N    + +  S L KL+ ++   N
Sbjct:  487 QIETVPSGISL--LEGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQLTSLPSDISGLQKLREINLDSN 627          

HSP 8 Score: 54.6842 bits (130), Expect = 1.114e-7
Identity = 38/122 (31.15%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  332 LTKLEQLNIG---NNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKL 688
            ++ LE L I      +L +LP+E+  LKNL +  I+  N+   P SI ++  L  L  + N +  LP SI  L  L+ L    N ++ LP   S L  L  IN  +N  ++  ++  D  +L
Sbjct:  521 VSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQLTSLPSDISGLQKLREINLDSNPMLRPPSLLCDGKRL 642          

HSP 9 Score: 53.9138 bits (128), Expect = 1.905e-7
Identity = 48/166 (28.92%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQ 832
            T L+ L + NN ++ LP  + +L  L   ++    L   P  IC L QL  LN++ N I+ LP+ I  LK +K L +  N +S LP     L  L  +    N    + +  + L  L  L+   NQ+ A    +   +  V KL LSGN+   +P     + +++
Sbjct:   62 TNLQCLLLSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKAVFRLSQLV-KLCLSGNQIKSLPKEIGDLKNLR 226          

HSP 10 Score: 52.373 bits (124), Expect = 6.024e-7
Identity = 41/160 (25.62%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  350 LNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            +N+ + +L+ +P ++    NL    +++  +++ P S+C L +LE L++  N +  LP  IC L +L  L+   N I+ LP   S L ++  +    N   ++     DLT L+ L    N +    D      N +  L+L GN+   +P     +S +
Sbjct:   44 INLNSKELTEIPPDVFRCTNLQCLLLSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKN-LHVLNLDGNQISALPKAVFRLSQL 202          

HSP 11 Score: 51.9878 bits (123), Expect = 9.159e-7
Identity = 31/102 (30.39%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYI 628
            L +L  L++L I +N +  LP  IG +KNL++       L + P SI  L  L+ L++  N ++ LP+ I  L++L+ ++   N +   P        LY I
Sbjct:  544 LSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGNQLTSLPSDISGLQKLREINLDSNPMLRPPSLLCDGKRLYPI 645          

HSP 12 Score: 50.447 bits (119), Expect = 2.460e-6
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  359 GNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             NN    +P+  G++ ++   N+N   L+  P  + +   L+ L +S NF++ LP S+C L +L+ L    N++  LP    SL  L  +N   N    + +  S L  +K L F +N  L+     L    ++  L +SGN    +P   A++ ++ ++
Sbjct:   27 SNNMPRTVPSGTGSITSI---NLNSKELTEIPPDVFRCTNLQCLLLSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQL-FANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVL 182          
BLAST of SMED30018503 vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 70.4774 bits (171), Expect = 8.601e-13
Identity = 46/132 (34.85%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
             L  L  L +L +  NQLS+LP+E+GNL+ L+  +++   L   P  I  L+ L  L +S+N +S LP+S+ QLK+L  L    N ++ L ES     +L  I    NL   +     +LTKL  L+   N+
Sbjct:   52 TLGALPNLRELWLDRNQLSSLPSELGNLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNR 183          

HSP 2 Score: 48.9062 bits (115), Expect = 7.095e-6
Identity = 34/131 (25.95%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +  L  L  L +  NQLS+LP+ +G LK L    ++   L+    SI     L  + ++EN ++ LP S+  L +L  L+   N +  LP        L  ++ + N    +    +  T+L  L    N+
Sbjct:   99 ISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGATELHVLDVAGNR 229          

HSP 3 Score: 48.9062 bits (115), Expect = 8.177e-6
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            Q+ S+ S   L QL +L  L +  N+L+ L   IG+ +NL +  +    L+  P S+  L +L  LN+  N +  LP+ I     L  L    N +S LP   +   +L+ ++   N  + +    ++L  LK L    NQ
Sbjct:  114 QLSSLPS--SLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNRLLSLPSEIGGCASLNVLSLRDNQLSALPPELAGATELHVLDVAGNRLLNLPFALTNL-NLKALWLAENQ 251          
BLAST of SMED30018503 vs. Ensembl Xenopus
Match: SCRIB (scribbled planar cell polarity protein [Source:NCBI gene;Acc:100494581])

HSP 1 Score: 70.0922 bits (170), Expect = 9.253e-13
Identity = 46/132 (34.85%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
             L  L  L +L +  NQLS+LP+E+GNL+ L+  +++   L   P  I  L+ L  L +S+N +S LP+S+ QLK+L  L    N ++ L ES     +L  I    NL   +     +LTKL  L+   N+
Sbjct:   58 TLGALPNLRELWLDRNQLSSLPSELGNLRRLVCLDVSENKLEQLPAEISGLMSLTDLLLSQNQLSSLPSSLGQLKQLSILKVDQNRLTQLTESIGDCENLSEIILTENLLTVLPKSMGNLTKLTNLNVDRNR 189          
BLAST of SMED30018503 vs. Ensembl Mouse
Match: Lrrc18 (leucine rich repeat containing 18 [Source:MGI Symbol;Acc:MGI:1914830])

HSP 1 Score: 68.9366 bits (167), Expect = 3.898e-13
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISF--LPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            C+ +L+ +++L++  N +  +P+ I   +NL   +++   +   P SI Q+  L +LN+S N ++   LP  + QLK ++ ++ G N +  +P +  +L +L+ +    NL   I    + L KLK L+ K N
Sbjct:   45 CILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNNRLTTNGLPVELNQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLTTIPASIAKLPKLKKLNIKRN 177          

HSP 2 Score: 54.6842 bits (130), Expect = 3.119e-8
Identity = 24/76 (31.58%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  416 KFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            + +++   ++ FP  I +L  ++ L++S N I  +P+SI + + L+WLD   N I  LPES   +  L ++N   N
Sbjct:   31 RLDLSKMGITTFPKCILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNN 106          
BLAST of SMED30018503 vs. Ensembl Mouse
Match: Lrrc18 (leucine rich repeat containing 18 [Source:MGI Symbol;Acc:MGI:1914830])

HSP 1 Score: 68.9366 bits (167), Expect = 4.618e-13
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISF--LPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            C+ +L+ +++L++  N +  +P+ I   +NL   +++   +   P SI Q+  L +LN+S N ++   LP  + QLK ++ ++ G N +  +P +  +L +L+ +    NL   I    + L KLK L+ K N
Sbjct:   45 CILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNNRLTTNGLPVELNQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLTTIPASIAKLPKLKKLNIKRN 177          

HSP 2 Score: 54.6842 bits (130), Expect = 3.744e-8
Identity = 24/76 (31.58%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  416 KFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            + +++   ++ FP  I +L  ++ L++S N I  +P+SI + + L+WLD   N I  LPES   +  L ++N   N
Sbjct:   31 RLDLSKMGITTFPKCILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNN 106          
BLAST of SMED30018503 vs. Ensembl Mouse
Match: Lrrc18 (leucine rich repeat containing 18 [Source:MGI Symbol;Acc:MGI:1914830])

HSP 1 Score: 68.9366 bits (167), Expect = 7.874e-13
Identity = 37/133 (27.82%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISF--LPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            C+ +L+ +++L++  N +  +P+ I   +NL   +++   +   P SI Q+  L +LN+S N ++   LP  + QLK ++ ++ G N +  +P +  +L +L+ +    NL   I    + L KLK L+ K N
Sbjct:   45 CILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNNRLTTNGLPVELNQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLTTIPASIAKLPKLKKLNIKRN 177          

HSP 2 Score: 54.6842 bits (130), Expect = 4.548e-8
Identity = 24/76 (31.58%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  416 KFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            + +++   ++ FP  I +L  ++ L++S N I  +P+SI + + L+WLD   N I  LPES   +  L ++N   N
Sbjct:   31 RLDLSKMGITTFPKCILRLSDIDELDLSRNMIRKIPDSIAKFQNLRWLDLHSNYIDKLPESIGQMTSLLFLNVSNN 106          
BLAST of SMED30018503 vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 69.3218 bits (168), Expect = 9.706e-13
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +L  L  L++ +  L +LP  IGNL NL    +    L+Y P S+ QL +LE L++  N I  LP SI  L  LK  WLD   N +S+LP+   +L +L  ++   N   ++    S LT L YL    N
Sbjct:   81 ELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDG--NQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQN 208          

HSP 2 Score: 68.5514 bits (166), Expect = 2.174e-12
Identity = 44/143 (30.77%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  287 RLQMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            R  +  I   I  C+   L+  +   N L+ LP     L+NL   ++N  +L   P +I  L  L  L + EN +++LP+S+ QL+RL+ LD G N I +LPES  +L+ L  +    N   ++     +L  L  L    N+
Sbjct:   46 RNDIPEIPESIAFCK--ALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENR 186          

HSP 3 Score: 66.6254 bits (161), Expect = 9.658e-12
Identity = 53/171 (30.99%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  281 LLRLQMRS---IYSQICLCQLTKLEQLNIGNN-----------------------QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L++R     Y    L QL +LE+L++GNN                       QLS LP EIGNLKNL+  +++   L   P  I  L  L YL IS+N +  +P  I +LK+L  L    N ++ LPE+     +L  +    N  + +      L KL  L+   N+
Sbjct:  108 LASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNK 278          
BLAST of SMED30018503 vs. Ensembl Mouse
Match: Lrrc1 (leucine rich repeat containing 1 [Source:MGI Symbol;Acc:MGI:2442313])

HSP 1 Score: 68.9366 bits (167), Expect = 1.411e-12
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +L  L  L++ +  L +LP  IGNL NL    +    L+Y P S+ QL +LE L++  N I  LP SI  L  LK  WLD   N +S+LP+   +L +L  ++   N   ++    S LT L YL    N
Sbjct:  126 ELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDG--NQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQN 253          

HSP 2 Score: 67.781 bits (164), Expect = 3.427e-12
Identity = 44/143 (30.77%), Postives = 70/143 (48.95%), Query Frame = 2
Query:  287 RLQMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            R  +  I   I  C+   L+  +   N L+ LP     L+NL   ++N  +L   P +I  L  L  L + EN +++LP+S+ QL+RL+ LD G N I +LPES  +L+ L  +    N   ++     +L  L  L    N+
Sbjct:   91 RNDIPEIPESIAFCK--ALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENR 231          

HSP 3 Score: 65.855 bits (159), Expect = 1.805e-11
Identity = 49/154 (31.82%), Postives = 71/154 (46.10%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNN-----------------------QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L QL +LE+L++GNN                       QLS LP EIGNLKNL+  +++   L   P  I  L  L YL IS+N +  +P  I +LK+L  L    N ++ LPE+     +L  +    N  + +      L KL  L+   N+
Sbjct:  170 LTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLKKLSILKLDQNRLTQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNK 323          
BLAST of SMED30018503 vs. UniProt/SwissProt
Match: sp|Q54AX5|LRRA_DICDI (Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum OX=44689 GN=lrrA PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.025e-18
Identity = 55/141 (39.01%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            Q+  +  +I  C+   LE L+I +NQL + P E G L NL  FN +  +L   P  I   V+LE LN+S N ++FLPN IC L  L  L+ GFN +  LPE  SS+V L  ++ + N  ++     S+L +LK LS ++ Q
Sbjct:  119 QLDDLPVEISNCE--ALEYLDISDNQLQSFPLEFGKLYNLQVFNCSKNSLKSLPSEISGWVKLEELNVSNNQLAFLPNQICLLGLLSTLNVGFNKLQQLPEELSSMVSLTNLDLKVNPPLQYVPQLSNLRQLKILSIRNLQ 257          

HSP 2 Score: 59.6918 bits (143), Expect = 1.286e-8
Identity = 33/107 (30.84%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            +  +  L++    NNQL A+P EIG L  L K N++   L+  P S   L +L+  ++  N I+ LP ++  LK    +D   N +++LP  F  L+ L  ++   N
Sbjct:  360 IASMKALKEFEASNNQLQAIPTEIGELSGLTKINLSGNKLTSIPASFGNLSELQICDLKSNEIAELPTTLDGLKSCTKIDLSHNMLTELPWEFGDLIGLTILDVGHN 466          

HSP 3 Score: 57.3806 bits (137), Expect = 6.535e-8
Identity = 35/112 (31.25%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  377 ALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            ALP EI ++K L +F  ++  L   P  I +L  L  +N+S N ++ +P S   L  L+  D   N I++LP +   L     I+   N+  ++   F DL  L  L   HN
Sbjct:  355 ALPPEIASMKALKEFEASNNQLQAIPTEIGELSGLTKINLSGNKLTSIPASFGNLSELQICDLKSNEIAELPTTLDGLKSCTKIDLSHNMLTELPWEFGDLIGLTILDVGHN 466          
BLAST of SMED30018503 vs. UniProt/SwissProt
Match: sp|Q6ZH85|PIRL2_ORYSJ (Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.234e-15
Identity = 44/132 (33.33%), Postives = 77/132 (58.33%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQ-LVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNV---FSDLTKLKYLSFKHNQ 715
            LT L+ L++  N+L +LP+ I   ++L++ ++++  LSY P  I Q + +LE L +  N +  LP+S+C+++ L+ LD+ FN +  LP     L  L  +N  +N F  +R++   F DL  L+ L   +NQ
Sbjct:  259 LTSLKILDVSGNKLRSLPDSISKCRSLVELDVSYNVLSYLPTGIGQEMARLEKLWVHLNKLRSLPSSVCEMRSLRLLDAHFNQLRGLPAGIGRLAALESLNLSSN-FSDMRDLPASFGDLLGLRELDLSNNQ 389          

HSP 2 Score: 57.7658 bits (138), Expect = 4.676e-8
Identity = 32/103 (31.07%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLF 649
            +E+L + + QL  LP ++G ++ L+  +++   L   P +I  L  LE L ++ N +  LP+SI  L  LK LD   N +  LP+S S    L  ++   N+ 
Sbjct:  193 VERLLLADRQLRHLPEQLGRIRGLLVLDVSRNQLKNVPDAIGGLEHLEELRLASNALVSLPDSIGLLTSLKILDVSGNKLRSLPDSISKCRSLVELDVSYNVL 295          
BLAST of SMED30018503 vs. UniProt/SwissProt
Match: sp|Q7KRY7|LAP4_DROME (Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.913e-15
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
             L  L+  +  +N +  LP+    LKNL    +N  +L+  P     L QLE L + EN +  LP +I QL +LK LD G N I DLP     L  L+ +    N   ++      LTKL YL    N+L    +++     S+T LDL+ N    +P   A +S + ++
Sbjct:  104 HLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLV-SLTDLDLAQNLLEALPDGIAKLSRLTIL 272          

HSP 2 Score: 72.7886 bits (177), Expect = 9.511e-13
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L +L +L + +N++  LP +I N +NL++ +++  ++   P  I  L  L+  + S N I  LP+   QLK L  L     S++ LP  F SL  L  +  + NL   +    S LTKLK L    N+
Sbjct:   58 RLHRLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNE 186          

HSP 3 Score: 69.707 bits (169), Expect = 9.591e-12
Identity = 39/130 (30.00%), Postives = 66/130 (50.77%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            + QLTKL++L++G+N++  LP  +G L  L +  ++H  L   P  +  L +L YL++SEN +  LPN I  L  L  LD   N +  LP+  + L  L  +    N   ++ +   +   ++ L    N
Sbjct:  171 ISQLTKLKRLDLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN 300          

HSP 4 Score: 57.7658 bits (138), Expect = 6.685e-8
Identity = 45/157 (28.66%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
            LTKL  L++  N+L  LPNEI  L +L   ++    L   P  I +L +L  L + +N +  L +++   + ++ L    N +S+LP S   +  L  +N   N    +         L  LS + N+L     +L   T  +  LD+SGN+ L +P
Sbjct:  220 LTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCT-VLHVLDVSGNQLLYLP 375          

HSP 5 Score: 57.3806 bits (137), Expect = 8.824e-8
Identity = 35/127 (27.56%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L  L +L + +NQL  LP E+G L  L   +++   L   P+ I  LV L  L++++N +  LP+ I +L RL  L    N +  L ++  +  ++  +    N   ++      +TKL  L+   N
Sbjct:  197 LPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRN 323          

HSP 6 Score: 52.7582 bits (125), Expect = 2.459e-6
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L++L  L +  N+L  L + +GN +N+ +  +    LS  P SI Q+ +L  LN+  N + +LP  I Q   L  L    N +  LP    +   L+ ++   N  + +     +L +LK +    NQ
Sbjct:  263 IAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWLSENQ 392          
BLAST of SMED30018503 vs. UniProt/SwissProt
Match: sp|Q6Z8P4|PIRL4_ORYSJ (Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL4 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.405e-14
Identity = 50/124 (40.32%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKY 694
            + +LT L  L+I  N+L ALP+ IG L +L K +I+   +S  P SI  L  L YLN+  N +S LP+SI +L  L+ LD G N +S LP+S  SL  L  +  +TN          DL +L Y
Sbjct:  269 IGKLTGLVTLDISENRLLALPDAIGKLFSLAKLDIHANRISQLPESIGDLRSLIYLNMRGNQLSSLPSSIGRLLNLEELDVGSNGLSSLPDSIGSLTRLKKLIVETN----------DLDELPY 382          

HSP 2 Score: 73.559 bits (179), Expect = 2.919e-13
Identity = 45/131 (34.35%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             + +L  L +L+I  N++S LP  IG+L++LI  N+    LS  P SI +L+ LE L++  N +S LP+SI  L RLK L    N + +LP +    V L  +    N    +      L  L+ LS ++N
Sbjct:  291 AIGKLFSLAKLDIHANRISQLPESIGDLRSLIYLNMRGNQLSSLPSSIGRLLNLEELDVGSNGLSSLPDSIGSLTRLKKLIVETNDLDELPYTIGHCVSLVELQAGYNHLKALPEAVGKLEPLEILSVRYN 421          

HSP 3 Score: 55.0694 bits (131), Expect = 3.766e-7
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNI--NHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFS 604
             +  LTKL+++++  N+L ++P       +LIK N+  N  +L Y P SI  L  LE L++S N I  LP+S   LK L+ L +  N +   P   +
Sbjct:  429 TMASLTKLKEVDVSFNELESIPENFCFATSLIKLNVGNNFADLQYLPRSIGNLEMLEELDMSNNQIRVLPDSFGNLKHLRVLRAEENPLQVPPRDIA 525          

HSP 4 Score: 53.9138 bits (128), Expect = 8.988e-7
Identity = 35/110 (31.82%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENF--ISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
             + +L  LE L++  N L +LP  + +L  L + +++   L   P + C    L  LN+  NF  + +LP SI  L+ L+ LD   N I  LP+SF +L  L  +  + N
Sbjct:  406 AVGKLEPLEILSVRYNNLRSLPTTMASLTKLKEVDVSFNELESIPENFCFATSLIKLNVGNNFADLQYLPRSIGNLEMLEELDMSNNQIRVLPDSFGNLKHLRVLRAEEN 515          

HSP 5 Score: 53.1434 bits (126), Expect = 1.638e-6
Identity = 33/93 (35.48%), Postives = 46/93 (49.46%), Query Frame = 2
Query:  434 CNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
              + + P SI +L  L  L+ISEN +  LP++I +L  L  LD   N IS LPES   L  L Y+N + N    + +    L  L+ L    N
Sbjct:  260 AQIEWLPDSIGKLTGLVTLDISENRLLALPDAIGKLFSLAKLDIHANRISQLPESIGDLRSLIYLNMRGNQLSSLPSSIGRLLNLEELDVGSN 352          
BLAST of SMED30018503 vs. UniProt/SwissProt
Match: sp|Q9LRV8|PIRL2_ARATH (Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana OX=3702 GN=PIRL2 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.732e-14
Identity = 49/158 (31.01%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQ------------------------LVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNL--FIKIRNVFSDLTKLKYLSFKHNQ 715
             + +L KLE+L++ +N L +LP+ IG L NL   N+N  NL+  P SI                          L  LE L+I  N + + P SI ++  LK+LD+  N I  +P S   L  L  +N  +N    + + +  +DLT L+ L   +NQ
Sbjct:  201 AISKLKKLEELDVSSNSLESLPDSIGMLLNLRILNVNANNLTALPESIAHCRSLVELDASYNNLTSLPTNIGYGLQNLERLSIQLNKLRYFPGSISEMYNLKYLDAHMNEIHGIPNSIGRLTKLEVLNLSSNFNNLMGVPDTITDLTNLRELDLSNNQ 358          

HSP 2 Score: 56.225 bits (134), Expect = 1.608e-7
Identity = 33/117 (28.21%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            ++  +YS      L   E++N    ++ A+  E  +   + + +++   L   P +  ++V L YLN+S N ++F+P++I +LK+L+ LD   NS+  LP+S   L++L  +N   N
Sbjct:  126 ELSRVYSTEVESMLRSGEEVN---EKVLAVLKEAESGGTVERIDLSSQELKLIPEAFWKVVGLVYLNLSGNDLTFIPDAISKLKKLEELDVSSNSLESLPDSIGMLLNLRILNVNAN 239          

HSP 3 Score: 52.7582 bits (125), Expect = 2.068e-6
Identity = 30/96 (31.25%), Postives = 59/96 (61.46%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFS---SLVDL 619
            +E++++ + +L  +P     +  L+  N++  +L++ P +I +L +LE L++S N +  LP+SI  L  L+ L+   N+++ LPES +   SLV+L
Sbjct:  162 VERIDLSSQELKLIPEAFWKVVGLVYLNLSGNDLTFIPDAISKLKKLEELDVSSNSLESLPDSIGMLLNLRILNVNANNLTALPESIAHCRSLVEL 257          
BLAST of SMED30018503 vs. TrEMBL
Match: A0A2G8LA75 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_05918 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.200e-21
Identity = 62/171 (36.26%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L  L+ L  L++ +N+LS LP +IG+LKNL +  +  C L   P  I  L  L+ L   +N IS LP  I Q  +LKWL+   N + DLP  F  L +L Y++   N  ++I    + L +L  L  + N + +  DDLLL  +S+ K DL  N+  + PSHW  +  + L
Sbjct:  101 LGGLSNLRYLSLSHNKLSYLPPDIGDLKNLAQLWLVGCELVAMPSEIGLLSSLQMLGARDNMISELPTEISQCPKLKWLNLAGNRLQDLPSHFERLQNLIYLDISENRIVEIPPCLTKLQRLSTLLLRKNFISSLPDDLLLGFSSLIKFDLRENKMTVRPSHWKGLDFILL 271          

HSP 2 Score: 37.3502 bits (85), Expect = 1.200e-21
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 1
Query:  175 NKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEV 303
            N+++ LN SH  ++V      K+  ++ LLLNNN I+ PP E+
Sbjct:   36 NETQALNISHRNLTVLPSCIAKMTCIKRLLLNNNDILMPPTEI 78          
BLAST of SMED30018503 vs. TrEMBL
Match: A0A444U378 (Malignant fibrous histiocytoma-amplified sequence 1 OS=Acipenser ruthenus OX=7906 GN=EOD39_18862 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.591e-21
Identity = 63/169 (37.28%), Postives = 91/169 (53.85%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            LC LT    L++ +N +S LP EIG L+ L +     CNL   P S+ +L QL+ +    N I+ LP    QLK L+WL+   N +SDLP++F +L  L Y+N   N F ++    SD+  L  +  K N + +  DD +L   S+TKLDL  N   I P HW    ++
Sbjct:   74 LCHLT---YLSLSHNPVSVLPEEIGELRELRELWAVGCNLISLPSSLRKLRQLQKIGARNNHIATLPTEFVQLKALQWLNLANNELSDLPKNFMNLEALAYLNLDGNKFEQVPESLSDMASLLVIYMKCNYIRSLPDDRILGLTSLTKLDLRENPLTIRPGHWKVRVYI 239          

HSP 2 Score: 34.6538 bits (78), Expect = 1.591e-21
Identity = 20/55 (36.36%), Postives = 32/55 (58.18%), Query Frame = 1
Query:  136 NSLIYDKFEKCKINKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNE 300
            N+L+ +    CK  +SELLN SH ++ V      +L  ++ L LN+N ++ PP E
Sbjct:    2 NALLLEAL--CK--QSELLNLSHRELQVLPPSVSQLTQLKKLFLNDNKLLLPPTE 52          
BLAST of SMED30018503 vs. TrEMBL
Match: A0A4Q7WID5 (Leucine rich repeat (LRR) protein OS=Plantactinospora sp. CNZ321 OX=2512141 GN=EV371_5038 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.106e-20
Identity = 60/161 (37.27%), Postives = 86/161 (53.42%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVP 802
             L +LT L +L + +NQLSALP  +GNL  L +  + +  L+  P S+  L  L +L +S N +S LP S+  L  L WLD   N +S LPES  +L  L +++   N    +     DLT L  L   +NQL    + L     ++T+LDL GNR  +VP
Sbjct:   32 SLAELTGLTRLILVDNQLSALPEWLGNLTALTELGLGNNQLTVLPESLGNLTGLTWLGLSGNRLSTLPESLGNLTALTWLDLSGNRLSTLPESLGNLTALTWLDLTDNELSALPEWLGDLTALTRLDLTNNQLTRLPESLGSLA-ALTRLDLVGNRLTVVP 191          

HSP 2 Score: 68.9366 bits (167), Expect = 1.920e-9
Identity = 46/164 (28.05%), Postives = 74/164 (45.12%), Query Frame = 2
Query:  296 MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNR 787
            M     QI   + +    L++  + L  LP  +  L  L +  +    LS  P  +  L  L  L +  N ++ LP S+  L  L WL    N +S LPES  +L  L +++   N    +     +LT L +L    N+L A  + L   T ++T+LDL+ N+
Sbjct:    1 MDGTADQIEAVRRSGASSLDLSGHSLGTLPESLAELTGLTRLILVDNQLSALPEWLGNLTALTELGLGNNQLTVLPESLGNLTGLTWLGLSGNRLSTLPESLGNLTALTWLDLSGNRLSTLPESLGNLTALTWLDLTDNELSALPEWLGDLT-ALTRLDLTNNQ 163          
BLAST of SMED30018503 vs. TrEMBL
Match: A0A2G8JHS1 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_27878 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.889e-20
Identity = 60/171 (35.09%), Postives = 91/171 (53.22%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L  L+ L  L++ +N+LS LP +IG+LK L +  +  C L   P  I  L  L+ L   +N IS LP  I Q  +LKWL+   N + DLP  F  L +L Y++   N  ++I    + L +L  L  + N + +  DDLLL  +++ K DL  N+  + PSHW  +  + L
Sbjct:  101 LGGLSNLRYLSLSHNKLSYLPPDIGDLKKLAQLWLVGCELVAMPSEIGLLSSLQMLGARDNMISELPTEISQCLKLKWLNLAGNRLRDLPSHFERLQNLIYLDISENRIVEIPPCLTKLHRLSTLLLRKNFISSLPDDLLLGFSNLIKFDLRENKMTVRPSHWKGLDFILL 271          

HSP 2 Score: 38.1206 bits (87), Expect = 1.889e-20
Identity = 18/43 (41.86%), Postives = 27/43 (62.79%), Query Frame = 1
Query:  175 NKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEV 303
            N+++ LN SH  ++V      KL  ++ LLLNNN I+ PP E+
Sbjct:   36 NETQALNISHRNVTVLPSCIAKLTCIKRLLLNNNDILMPPTEI 78          
BLAST of SMED30018503 vs. TrEMBL
Match: A0A210QD44 (Leucine-rich repeat protein SHOC-2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT26228 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.597e-20
Identity = 61/166 (36.75%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHV 829
            LT L  LN+ +N L  L  EIGNL +L +  +  C L+    +IC+L QL+ L++ ENFIS +P    +L  L WL    N    LP+    L  L Y+N   N F  I     +L  L  LS K N ++  DDD +LA + +TK DL     L  P HW  + ++
Sbjct:   84 LTNLTYLNLSHNPLGFLGEEIGNLCSLTQLWLVECQLTNLSENICRLKQLKKLSVRENFISEIPEGFDRLSNLMWLSLAENKFDQLPKKLERLSGLAYLNLDHNQFQDIPAFVLELESLTNLSMKGNLVMGVDDDTILALSKLTKFDLRDTCILEKPDHWKGLEYI 249          

HSP 2 Score: 41.9726 bits (97), Expect = 2.597e-20
Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  145 IYDKFEKCKINKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEV 303
            I +  +K + N  E+LN SH  I V     +KL ++R L+LN+N I+ PP+EV
Sbjct:    6 IEEIIQKAEKNNREVLNLSHRNIKVVSSNIQKLSNLRKLMLNDNEILMPPSEV 58          
BLAST of SMED30018503 vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 71.2478 bits (173), Expect = 1.778e-13
Identity = 40/126 (31.75%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNIN-HCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYL 697
            + +L  L++LN+  N+LS +P E+G  +NL K  +  + +LS  P  +  L  L++L+++EN  + +P  + ++  L+WLD   N ++DLPE    L DL  +    N    +  V +++ KLK L
Sbjct:  197 IGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKML 322          
BLAST of SMED30018503 vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 70.8626 bits (172), Expect = 1.906e-13
Identity = 40/126 (31.75%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNIN-HCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYL 697
            + +L  L++LN+  N+LS +P E+G  +NL K  +  + +LS  P  +  L  L++L+++EN  + +P  + ++  L+WLD   N ++DLPE    L DL  +    N    +  V +++ KLK L
Sbjct:  197 IGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKML 322          
BLAST of SMED30018503 vs. Ensembl Cavefish
Match: LRRC2 (leucine rich repeat containing 2 [Source:NCBI gene;Acc:103036599])

HSP 1 Score: 70.4774 bits (171), Expect = 3.202e-13
Identity = 40/126 (31.75%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNIN-HCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYL 697
            + +L  L++LN+  N+LS +P E+G  +NL K  +  + +LS  P  +  L  L++L+++EN  + +P  + ++  L+WLD   N ++DLPE    L DL  +    N    +  V +++ KLK L
Sbjct:  234 IGKLVNLKELNVNYNKLSIIPPELGECENLEKLEMTANGDLSELPFELSNLKALKHLDLAENKFATIPICVLRMSSLQWLDMSNNRLTDLPEDIDRLSDLQTMFLHKNKLTYLPMVMANMDKLKML 359          
BLAST of SMED30018503 vs. Ensembl Cavefish
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:103023999])

HSP 1 Score: 69.3218 bits (168), Expect = 7.970e-13
Identity = 44/138 (31.88%), Postives = 66/138 (47.83%), Query Frame = 2
Query:  302 SIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
             I   I  C+   L+  +   N L+ LP+    L+NL   +IN  +L   P +I  L  L  L + EN +++LP S+CQL RL+ LD G N + +LPE+   LV L  +    N   +I      +  L  L    N+
Sbjct:   96 EIPDSISFCK--ALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENK 231          

HSP 2 Score: 67.781 bits (164), Expect = 2.976e-12
Identity = 50/171 (29.24%), Postives = 76/171 (44.44%), Query Frame = 2
Query:  281 LLRLQMRS---IYSQICLCQLTKLEQLNIGNN-----------------------QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L+ L++R     Y    LCQL +LE+L++GNN                       QL+ +P E+G++KNL+  +++   L   P     L  L  L +S+N I  LP  I +LKRL  L +  N +  LPES  S   L  +    N  + +      L KL   +   N+
Sbjct:  153 LVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNR 323          

HSP 3 Score: 64.3142 bits (155), Expect = 4.227e-11
Identity = 43/130 (33.08%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +L  L  L+I +  L ALP+ IGNL NL+   +    L+Y P S+CQL +LE L++  N +  LP +I  L  LK  WLD   N ++++P    S+ +L  ++   N   ++    + L  L  L    N
Sbjct:  126 ELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDG--NQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQN 253          

HSP 4 Score: 51.2174 bits (121), Expect = 7.054e-7
Identity = 37/128 (28.91%), Postives = 55/128 (42.97%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +  N + ALP  IG LK L     +   L   P SI     L  L ++EN +  LP SI +LK+L   +   N ++ LP+       L  +  + N   +I +  S  T+L       N+
Sbjct:  242 LNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNR 369          

HSP 5 Score: 49.2914 bits (116), Expect = 3.022e-6
Identity = 36/124 (29.03%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            LE+L +  NQL  LP +   L  L K  ++   +   P  I   +QL  L++S N I  +P+SI   K L+  D   N ++ LP+SF  L +L  ++        + +   +L  L  L  + N
Sbjct:   38 LEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELREN 161          
BLAST of SMED30018503 vs. Ensembl Cavefish
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:103023999])

HSP 1 Score: 68.9366 bits (167), Expect = 1.451e-12
Identity = 44/137 (32.12%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  305 IYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            I   I  C+   L+  +   N L+ LP+    L+NL   +IN  +L   P +I  L  L  L + EN +++LP S+CQL RL+ LD G N + +LPE+   LV L  +    N   +I      +  L  L    N+
Sbjct:   97 IPDSISFCK--ALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENK 231          

HSP 2 Score: 67.781 bits (164), Expect = 3.485e-12
Identity = 50/171 (29.24%), Postives = 76/171 (44.44%), Query Frame = 2
Query:  281 LLRLQMRS---IYSQICLCQLTKLEQLNIGNN-----------------------QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L+ L++R     Y    LCQL +LE+L++GNN                       QL+ +P E+G++KNL+  +++   L   P     L  L  L +S+N I  LP  I +LKRL  L +  N +  LPES  S   L  +    N  + +      L KL   +   N+
Sbjct:  153 LVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNR 323          

HSP 3 Score: 63.5438 bits (153), Expect = 7.274e-11
Identity = 43/130 (33.08%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +L  L  L+I +  L ALP+ IGNL NL+   +    L+Y P S+CQL +LE L++  N +  LP +I  L  LK  WLD   N ++++P    S+ +L  ++   N   ++    + L  L  L    N
Sbjct:  126 ELRNLTCLSINDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDG--NQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQN 253          

HSP 4 Score: 51.2174 bits (121), Expect = 8.921e-7
Identity = 37/128 (28.91%), Postives = 55/128 (42.97%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +  N + ALP  IG LK L     +   L   P SI     L  L ++EN +  LP SI +LK+L   +   N ++ LP+       L  +  + N   +I +  S  T+L       N+
Sbjct:  242 LNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNR 369          

HSP 5 Score: 48.9062 bits (115), Expect = 4.879e-6
Identity = 36/124 (29.03%), Postives = 58/124 (46.77%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            LE+L +  NQL  LP +   L  L K  ++   +   P  I   +QL  L++S N I  +P+SI   K L+  D   N ++ LP+SF  L +L  ++        + +   +L  L  L  + N
Sbjct:   38 LEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIGNLCNLVSLELREN 161          
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011353.1 (pep scaffold:Pmarinus_7.0:GL480086:13034:13672:1 gene:ENSPMAG00000010326.1 transcript:ENSPMAT00000011353.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 9.489e-15
Identity = 43/137 (31.39%), Postives = 76/137 (55.47%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLS-YFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLS 700
            ++R + S++ L  L  LE++++ NN L+ALP  +G L+ L   ++ +  L    P  +CQL  L +L+ S+N I  LP++I  + +L+ L   +NSI +LP+   SL  L  +   +N    +   F +L  L++ S
Sbjct:   44 ELRELPSEVSL--LANLERVSLSNNALTALPRGLGGLRKLRSVHLANNKLGPVLPAELCQLKALCFLDASDNCIERLPSAIGSMAKLETLLLLYNSIRELPDELCSLTTLRTLWLGSNRLRSLPRGFGELRGLRWGS 178          

HSP 2 Score: 61.2326 bits (147), Expect = 2.203e-11
Identity = 40/141 (28.37%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  296 MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFIS-FLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +RS+ + +C  +L  L  L +  N+L  LP+E+  L NL + ++++  L+  P  +  L +L  ++++ N +   LP  +CQLK L +LD+  N I  LP +  S+  L  +    N   ++ +    LT L+ L    N+
Sbjct:   22 LRSLPADVC--RLHNLRVLCLDTNELRELPSEVSLLANLERVSLSNNALTALPRGLGGLRKLRSVHLANNKLGPVLPAELCQLKALCFLDASDNCIERLPSAIGSMAKLETLLLLYNSIRELPDELCSLTTLRTLWLGSNR 160          

HSP 3 Score: 45.8246 bits (107), Expect = 5.534e-7
Identity = 25/84 (29.76%), Postives = 42/84 (50.00%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFN 574
            LCQL  L  L+  +N +  LP+ IG++  L    + + ++   P  +C L  L  L +  N +  LP    +L+ L+W  SG +
Sbjct:   99 LCQLKALCFLDASDNCIERLPSAIGSMAKLETLLLLYNSIRELPDELCSLTTLRTLWLGSNRLRSLPRGFGELRGLRWGSSGAD 182          

HSP 4 Score: 24.2534 bits (51), Expect = 5.534e-7
Identity = 11/28 (39.29%), Postives = 19/28 (67.86%), Query Frame = 1
Query:  238 KLDHVRILLLNNNTIIAPPNEVNLFPNL 321
            +L ++R+L L+ N +   P+EV+L  NL
Sbjct:   31 RLHNLRVLCLDTNELRELPSEVSLLANL 58          
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 68.5514 bits (166), Expect = 4.250e-13
Identity = 48/152 (31.58%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNR 787
            L KLEQL++GNN+L  LP  +G+L N+ +  ++   L   P  I +L +L  L+IS+N +  LP++I  L  L    +  N + +LPE    L  L  +    N    +     D   L  L    NQL+     +   T  +T L+L  NR
Sbjct:  120 LVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTK-LTNLNLDKNR 270          

HSP 2 Score: 57.3806 bits (137), Expect = 1.765e-9
Identity = 46/164 (28.05%), Postives = 79/164 (48.17%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAM 820
            +L  L +L + +N+L  LP +I N  +L+  +++  +++  P SI     LE ++ S N ++ LP    QLK L +L     S+  LP+   +L +L  +  + NL   +      L KL+ L   +N+L      L    N V +L L GN+   +PS    +
Sbjct:    4 RLHNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIPDSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPN-VRELWLDGNQLEALPSEIGEL 166          

HSP 3 Score: 56.225 bits (134), Expect = 4.099e-9
Identity = 37/123 (30.08%), Postives = 58/123 (47.15%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKL 688
             QL  L  L++ +  L  LP++IGNL NL+   +    L   P S+  LV+LE L++  N +  LP S+  L  ++  WLD   N +  LP     L  L  ++   N   ++ +    L  L
Sbjct:   72 TQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDG--NQLEALPSEIGELRRLVCLDISQNRLERLPDAIGGLAAL 192          

HSP 4 Score: 48.521 bits (114), Expect = 1.448e-6
Identity = 30/117 (25.64%), Postives = 54/117 (46.15%), Query Frame = 2
Query:  365 NQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            N L  LP E+G LK+L     +   L++ P +I     L  L ++EN +  LP SI +L +L  L+   N ++ +P        L  ++ + N   ++    S  +++  L    N+
Sbjct:  200 NHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISGASQIHVLDLAGNR 316          
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.787e-12
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L +LN+ +NQL++LP +IG  K++++ N+    L+  P  I +L  LE L +S N +  LP+ +  L++L+ LD   N +  LP   + L DL  +    N    +      L  L +L    NQ
Sbjct:  330 LSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQ 454          

HSP 2 Score: 57.3806 bits (137), Expect = 1.454e-9
Identity = 52/181 (28.73%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  284 LRLQMRSIYS-QICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMS 823
            L L  RSI S    + +LT+L +L +  N+L  LP EIG L NL+   +N  +L+  P ++  L  L  L++  N +  +P  + +L  L  L   FN I+ + +   +L  L  ++ + N    +     +L  L  L   HNQL    +++      VT LDL  N  L +P     ++
Sbjct:   54 LDLAKRSIASLPPNIKELTQLTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENKIKLLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCV-QVTNLDLQHNELLDLPDSIGNLA 233          

HSP 3 Score: 54.6842 bits (130), Expect = 1.043e-8
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDL--YYINFQTNL 646
            + +LT LE L + NN L  LP+ +GNL+ L + ++    L   P+ I  L  L+ L ++ N ++ LP  I  L  L  L  G N ++ +PE   +L +L   Y+N   NL
Sbjct:  370 ISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELYLNDNPNL 479          

HSP 4 Score: 52.7582 bits (125), Expect = 4.341e-8
Identity = 35/122 (28.69%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  347 QLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +LN+  NQL+ +P++I  L +L    +++  L   PH +  L +L  L++ EN +  LPN I  LK L+ L    N ++ LP     L  L ++    N    +      L  L+ L    N
Sbjct:  355 ELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELYLNDN 476          

HSP 5 Score: 52.7582 bits (125), Expect = 5.239e-8
Identity = 51/198 (25.76%), Postives = 87/198 (43.94%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESF-------------------------SSLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            + +L  L  L++ +NQL  LP EIGN   +   ++ H  L   P SI  L  L  L +  N +S +P ++     L+ L+   N+IS LPE                           S    +Y +N + N   KI   +FS    L  L+ K NQL +   D+     S+ +L+L+ N+   +P   + ++ ++++
Sbjct:  183 IGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTW-KSMVELNLATNQLTKIPDDISELTSLEIL 379          

HSP 6 Score: 50.8322 bits (120), Expect = 1.849e-7
Identity = 33/138 (23.91%), Postives = 63/138 (45.65%), Query Frame = 2
Query:  302 SIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
             +  ++  C+     +L++    +++LP  I  L  L +  +    L   P  I  LV L  L ++EN ++ LP+++  L  L+ LD   N +  +P     L  L  +  + N   ++     +L+KL  LS + N+
Sbjct:   38 EVVKELNKCKEQNATRLDLAKRSIASLPPNIKELTQLTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLRFNRITQVEKDIGNLSKLTMLSVRENK 175          
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 64.3142 bits (155), Expect = 8.923e-12
Identity = 43/164 (26.22%), Postives = 74/164 (45.12%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHS-----------------------ICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            ++R++   + L  L  L  L++ +NQL+ LP  +G L NL K N++H  L   P S                       I  L +LE L++S N ++ LP ++ +L R+  L+   N + +LP    S+  L  +    NL   +      +  L+ L  +HN+
Sbjct:   95 RLRALSDDLQL--LPALTVLDVHDNQLTELPQVLGELVNLQKLNVSHNKLQTLPESLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNR 256          

HSP 2 Score: 54.6842 bits (130), Expect = 1.057e-8
Identity = 38/156 (24.36%), Postives = 77/156 (49.36%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNR 787
             L  ++ L  L++ +N+L  + N IGNL  L + +++   L+  P ++ +L ++  LN++EN +  LP  I  +K L  L++  N +  +P +   +  L  +  + N    +  +  +   LK L   +NQ+     + L    +++ LDL  N+
Sbjct:  148 SLWAISSLLSLHVEHNELEGISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPELH-NCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNK 302          

HSP 3 Score: 51.9878 bits (123), Expect = 9.055e-8
Identity = 39/154 (25.32%), Postives = 66/154 (42.86%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLP---------------NSICQLK--------RLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             L +LT++ +LN+  N+L  LP EI ++K L +    H  L   P ++  +  L+ L +  N +  LP               N I +L          +  LD   N + +LP+  + L  L  ++   N    + N   +L KLK L+ + N
Sbjct:  194 TLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLYLRHNRLKSLPELHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALGNLGKLKSLALEGN 347          
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008655.1 (pep scaffold:Pmarinus_7.0:GL484079:6946:12214:1 gene:ENSPMAG00000007829.1 transcript:ENSPMAT00000008655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.667e-11
Identity = 46/153 (30.07%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNL------------IKFNINHC-----------NLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            LC L  L  L++ +N L++LP  IG L  L            I  NI  C            LS  P  + QLV L  L +S+  + FLP S+ +L +L+ L+   N ++ LP++   L  L  ++   N F  +  V   LT L+ L    N
Sbjct:   67 LCALPLLRVLSVADNDLASLPPAIGGLAGLRRIDASRNELRDIPDNIRSCRQLSVVNVSNNTLSRLPDGLTQLVSLTELYLSDVLLEFLPASLGRLCKLRVLELRDNHLNSLPKAMHRLSQLRRLDLGCNDFSHVPPVLQQLTTLQELLMDGN 219          
BLAST of SMED30018503 vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 53.9138 bits (128), Expect = 1.507e-8
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEI-GNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLF 649
            +  L +   QLS++P E+   L  L K  +N  NL+  P  I +L +L +L+++ N + ++P  + QLK L+ LD   N+I D  +   +L +L  +N  +N F
Sbjct: 1042 MTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDGMENL-ELTSLNISSNAF 1144          
BLAST of SMED30018503 vs. Ensembl Nematostella
Match: EDO45570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSI5])

HSP 1 Score: 85.8853 bits (211), Expect = 1.809e-23
Identity = 52/137 (37.96%), Postives = 76/137 (55.47%), Query Frame = 2
Query:  305 IYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            I   + L  L++L +L + +NQL+ LP+  G L NL    ++H NL Y    IC+LVQLE L I    +  LP  IC+LK LK L +G N I+ LP+  S LV L +++ + N    + + F  L KL +L    N+
Sbjct:   91 IMPPVELVYLSRLRELCLDHNQLTLLPSGFGRLTNLKVLCLSHNNLGYLASEICELVQLEELWIINTQLMALPADICRLKLLKKLSAGKNMITSLPDKISGLVSLQWLSLRENHLSSLPSEFFKLPKLAHLDLNMNK 227          

HSP 2 Score: 40.817 bits (94), Expect = 1.809e-23
Identity = 20/40 (50.00%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  184 ELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEV 303
            ++LN SH +++V     +KL HV+ILLLN+N II PP E+
Sbjct:   58 KILNLSHRELTVIPDSLKKLKHVQILLLNDNQIIMPPVEL 97          

HSP 3 Score: 68.9366 bits (167), Expect = 2.500e-13
Identity = 45/132 (34.09%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIR-NVFSDLTKLKYLSFKHNQ 715
            +C+L +LE+L I N QL ALP +I  LK L K +     ++  P  I  LV L++L++ EN +S LP+   +L +L  LD   N   + PE+   LV L  ++ + N    +  N    L KL  +  + NQ
Sbjct:  143 ICELVQLEELWIINTQLMALPADICRLKLLKKLSAGKNMITSLPDKISGLVSLQWLSLRENHLSSLPSEFFKLPKLAHLDLNMNKFEEFPENLIGLVSLECLSLRGNCIKSLADNCVEGLPKLCKVDIRDNQ 274          
BLAST of SMED30018503 vs. Ensembl Nematostella
Match: EDO35138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB5])

HSP 1 Score: 73.9442 bits (180), Expect = 2.097e-15
Identity = 45/139 (32.37%), Postives = 73/139 (52.52%), Query Frame = 2
Query:  296 MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            M+  Y    + +LT+L+ LN+  N ++  P     L+ L +  + +  L + P  +C LVQLE L+++ NFI  LP S   L RL+WL+   N I++LP S + +  L Y+N + N         S L++L+ L    N
Sbjct:    1 MKLQYFPEQILELTQLQVLNLSGNHITNFPYRFFMLRFLTELYLRNDFLEFLPAQVCTLVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLSRLRVLHLNSN 139          

HSP 2 Score: 63.1586 bits (152), Expect = 1.352e-11
Identity = 50/154 (32.47%), Postives = 79/154 (51.30%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGN 784
            +C L +LE L++ NN +  LP   G+L  L   N+ +  ++  P S+  +  L YLN+  N +   P  + QL RL+ L    N++  LPESF  L  L  +  + N    + + F+    L YLS ++N L+ F  ++   T S+  L LSGN
Sbjct:   56 VCTLVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLSRLRVLHLNSNNLRALPESFKLLNHLRILYLKDNKLRVLPDWFASFHCLAYLSMENNDLVCFPGEISKLT-SLEVLILSGN 208          

HSP 3 Score: 54.6842 bits (130), Expect = 8.391e-9
Identity = 42/157 (26.75%), Postives = 79/157 (50.32%), Query Frame = 2
Query:  368 QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            +L   P +I  L  L   N++  +++ FP+    L  L  L +  +F+ FLP  +C L +L+ LD   N I  LP S   L  L ++N Q N    + +  +D+  L YL+ + N+L  F +++   +  +  L L+ N    +P  +  ++H++++
Sbjct:    2 KLQYFPEQILELTQLQVLNLSGNHITNFPYRFFMLRFLTELYLRNDFLEFLPAQVCTLVQLEVLDLANNFIRTLPYSSGHLTRLRWLNLQNNQITNLPSSLADMNGLCYLNLEANELKIFPEEVSQLS-RLRVLHLNSNNLRALPESFKLLNHLRIL 157          

HSP 4 Score: 46.2098 bits (108), Expect = 7.114e-6
Identity = 38/128 (29.69%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            QL++L  L++ +N L ALP     L +L    +    L   P        L YL++  N +   P  I +L  L+ L    NSI +LP+S   LV+L  +    N   K+    + L KL+ L  + N
Sbjct:  127 QLSRLRVLHLNSNNLRALPESFKLLNHLRILYLKDNKLRVLPDWFASFHCLAYLSMENNDLVCFPGEISKLTSLEVLILSGNSIRELPDSIKELVNLKELFLGRNKIRKLPPSITKLEKLQVLYLQEN 254          
BLAST of SMED30018503 vs. Ensembl Nematostella
Match: EDO37227 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD7])

HSP 1 Score: 71.633 bits (174), Expect = 8.754e-15
Identity = 47/131 (35.88%), Postives = 73/131 (55.73%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +L+ L++L + +N L+ LP EIG++K L   N++H  L   P +I QL  L+YL+I+ N +  LP  +  LK+L+ LD   N++  LP   S  V L  + F  NL   +    +DL  LK LS   N+
Sbjct:   57 ISRLSSLKELYLHSNNLTHLPQEIGHIKCLESLNVSHNFLQNLPPTIGQLQHLQYLHIANNQLHSLPREVGHLKQLQVLDIMNNNLHQLPWQLSDCVRLETLLFDGNLVEWLPQQLTDLKGLKELSGSRNR 187          

HSP 2 Score: 63.1586 bits (152), Expect = 1.034e-11
Identity = 40/132 (30.30%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  317 ICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            +    L K++++ +  N L++LP EI  L +L +  ++  NL++ P  I  +  LE LN+S NF+  LP +I QL+ L++L    N +  LP     L  L  ++   N   ++    SD  +L+ L F  N
Sbjct:   32 VSFLHLKKVQRVYLKYNLLTSLPQEISRLSSLKELYLHSNNLTHLPQEIGHIKCLESLNVSHNFLQNLPPTIGQLQHLQYLHIANNQLHSLPREVGHLKQLQVLDIMNNNLHQLPWQLSDCVRLETLLFDGN 163          

HSP 3 Score: 59.6918 bits (143), Expect = 1.681e-10
Identity = 35/89 (39.33%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPE 595
            QL  L+ L+I NNQL +LP E+G+LK L   +I + NL   P  +   V+LE L    N + +LP  +  LK LK L    N +  LP+
Sbjct:  105 QLQHLQYLHIANNQLHSLPREVGHLKQLQVLDIMNNNLHQLPWQLSDCVRLETLLFDGNLVEWLPQQLTDLKGLKELSGSRNRLLSLPQ 193          
BLAST of SMED30018503 vs. Ensembl Nematostella
Match: EDO38039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE32])

HSP 1 Score: 70.8626 bits (172), Expect = 8.968e-14
Identity = 46/140 (32.86%), Postives = 73/140 (52.14%), Query Frame = 2
Query:  365 NQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGN 784
            N LS LP+    + NL K +++   +   P     LV LE+L++ +N I  LP+S C L +L +L    N +++LPE+F +L  L  +   +N    +   F++LT +K L    N+L      LL   N + +LDL GN
Sbjct:  280 NWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTELPENFGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLYRNKLSEIPRVLLKLEN-LMRLDLDGN 418          

HSP 2 Score: 54.6842 bits (130), Expect = 1.764e-8
Identity = 49/174 (28.16%), Postives = 74/174 (42.53%), Query Frame = 2
Query:  326 CQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXT---NSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
              L  L +L I  N LS L      +KNL    +   ++   P     L +LE +N+S+N I  LP S   L  LK  D   N I +LPE F S   L ++    N    + + F DL  +  L    N+L          +    +++ LDLSGNR   +P     +  ++ +
Sbjct:   89 AGLASLTELRIDENDLSELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTL 262          

HSP 3 Score: 51.9878 bits (123), Expect = 1.490e-7
Identity = 46/155 (29.68%), Postives = 64/155 (41.29%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLN------------------------ISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L +L +  N L++LP+    L NL + ++N  +L   P S+ +L +L  LN                        I EN +S L  S   +K LK L+ G N I  LPE F +L  L  +N   N   K+   F  L  LK      N 
Sbjct:   18 LGSLASLTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNLTGNKLEKLRDDFGAGLASLTELRIDENDLSELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNH 172          
BLAST of SMED30018503 vs. Ensembl Nematostella
Match: EDO37499 (Leucine-rich repeat protein soc-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SFP1])

HSP 1 Score: 64.6994 bits (156), Expect = 1.173e-11
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L +LN+ +NQL++LP + G+  +L++ N+    +S  P  I  LV LE L +S N +  LP  I  L++L+ LD   N +  +P     L  L  +  Q+N    +      L+ + YLS   N+
Sbjct:  367 LSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENE 491          

HSP 2 Score: 52.373 bits (124), Expect = 1.089e-7
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L +LN+  NQ+S LP +I  L NL    +++  L   P  I  L +L  L+I EN +  +P  I  L+ L+ L    N +  LP S   L  + Y++   N  + +     ++  L+ L    N+
Sbjct:  390 LVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDNE 514          

HSP 3 Score: 52.373 bits (124), Expect = 1.109e-7
Identity = 40/147 (27.21%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  365 NQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPS 805
            N++S + + IGNLK L + ++    +   P  I QLV L  L+IS N I  LP  I     +  LD   N I  LP+S   L  +  +  + N    + +  ++ + +   + + N +    + LL +  ++T L LS N+  + P+
Sbjct:  188 NRISVVESGIGNLKLLERLSLRENKIKILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFPA 334          

HSP 4 Score: 51.9878 bits (123), Expect = 1.658e-7
Identity = 35/137 (25.55%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  305 IYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            I+ +I  C+     +L++    ++ LP E+  L +L +  +    ++  P  +  L  LE L +SEN ++ LP+++ +L +LK LD   N I ++P+    L  L  +  + N    + +   +L  L+ LS + N+
Sbjct:   76 IHKEIQKCREEGATRLDLSKAAVTVLPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNLTTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENK 212          
BLAST of SMED30018503 vs. Ensembl Medaka
Match: lrrc18a (leucine rich repeat containing 18a [Source:ZFIN;Acc:ZDB-GENE-090313-323])

HSP 1 Score: 74.3294 bits (181), Expect = 7.041e-15
Identity = 46/133 (34.59%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISF--LPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            CL +LT L++L++  N L  LP+ IGN  +L + +++   L   P S+  L  L +LN++ N ++F  LP S+  L  LK L+ G N + DLP    +LV+L  +    N F+K+      L  L  L+ K N
Sbjct:   44 CLFKLTNLDELDLSRNLLQKLPDSIGNFSSLTRLDLHSNKLESLPESVGNLTGLTHLNLANNCLTFVGLPFSLGCLTNLKSLNLGMNQLDDLPPPLENLVNLQELGLFDNRFLKLPEFVKVLRNLTKLNLKRN 176          

HSP 2 Score: 49.6766 bits (117), Expect = 1.416e-6
Identity = 32/99 (32.32%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  425 INHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN--LFIKIRNVFSDLTKLKYLSFKHNQ 715
            +++  L+ FP  + +L  L+ L++S N +  LP+SI     L  LD   N +  LPES  +L  L ++N   N   F+ +      LT LK L+   NQ
Sbjct:   33 LSNMGLTVFPKCLFKLTNLDELDLSRNLLQKLPDSIGNFSSLTRLDLHSNKLESLPESVGNLTGLTHLNLANNCLTFVGLPFSLGCLTNLKSLNLGMNQ 131          
BLAST of SMED30018503 vs. Ensembl Medaka
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:101158008])

HSP 1 Score: 72.7886 bits (177), Expect = 7.240e-14
Identity = 52/182 (28.57%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  278 QLLRL---QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWA 814
            Q LRL   Q+ S+  ++C+  L  L  L +  N L  LP E G L+NL + +++   L+  P S+ +L  L+ +++S N +S LP+ + QL  +K LD   N +SD+P S + ++ L  ++ + N   ++  + +    LK L   +NQ+   + + L    +++ L+L  N+   VP   +
Sbjct:  126 QTLRLSHNQLSSLPVEVCM--LRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQLSDVPASLAHMLSLEQLHLRHNRLQRLPQLHA--PALKELYVGNNQVGVLEAEQLECLKAISVLELRDNKIRAVPEQMS 303          

HSP 2 Score: 68.5514 bits (166), Expect = 1.572e-12
Identity = 43/128 (33.59%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L  L  L++ +NQL+ L + IG L+ L    ++H  LS  P  +C L  L  L + +N +  LP    QL+ L  LD   N ++DLP+S   L  L  I+   N    + +  S LT +K L   +NQ
Sbjct:   99 LPALVTLDLHDNQLNTLHSAIGELQELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTNVKLLDCSNNQ 226          

HSP 3 Score: 63.5438 bits (153), Expect = 8.726e-11
Identity = 51/162 (31.48%), Postives = 82/162 (50.62%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAM 820
            T L +L + +NQ+S +  +I  L  L+  +++   L+    +I +L +L+ L +S N +S LP  +C L+ L+ L    N + +LPE F  L +L  ++   N    +      LT L+ +S  HN+L    D L   TN V  LD S N+   VP+  A M
Sbjct:   77 TDLTKLLLSSNQISQISEDIRLLPALVTLDLHDNQLNTLHSAIGELQELQTLRLSHNQLSSLPVEVCMLRNLRSLTLQQNLLENLPEEFGQLENLTELDLSKNRLTDLPQSLGRLTGLQKISLSHNKLSCLPDCLSQLTN-VKLLDCSNNQLSDVPASLAHM 237          
BLAST of SMED30018503 vs. Ensembl Medaka
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:101173528])

HSP 1 Score: 72.0182 bits (175), Expect = 1.601e-13
Identity = 47/132 (35.61%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
             C+L  LE L +  N+LSALP   G L+ L   N++   L  FP ++  +  LE L +S N +S +P  I QL RL   WLD+  NSI+ LP+S   L +L  +  Q N    + + F  L+++     K N
Sbjct:  242 FCRLQNLESLMLDGNRLSALPPSFGLLQRLKMMNLSSNQLQVFPQALLGVCGLEELYLSRNRLSHVPEEISQLGRLVNLWLDN--NSITRLPDSIVDLENLEELVLQGNHIAVLPDNFGKLSRVNIWKVKDN 371          

HSP 2 Score: 69.707 bits (169), Expect = 8.609e-13
Identity = 49/172 (28.49%), Postives = 82/172 (47.67%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            LC+L +L +L++ +N L  L   +G L+ L K  ++H  +   P  I  L  LE L+IS N +  LP S   L RL+ LD+  N +S  P    +L  L  ++   N F+ +      LT +K L     ++ +  +      N +  L L GNR   +P  +  +  +++M
Sbjct:  104 LCELGQLVELDMSHNCLRTLSEGLGQLRALKKLCVSHNKIQSLPAQIGALQALEELDISFNLLHGLPRSFSSLTRLRALDADHNQLSQFPVEILALGQLEELDLSGNRFVALPANIWRLTSIKVLWLSSLRMASLPETFCRLQN-LESLMLDGNRLSALPPSFGLLQRLKMM 274          

HSP 3 Score: 66.6254 bits (161), Expect = 9.800e-12
Identity = 60/216 (27.78%), Postives = 97/216 (44.91%), Query Frame = 2
Query:  293 QMRSIYSQICLC----------QLTKLEQLNIGNNQLSALPNEIGN------------------------LKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            ++RS   Q+ LC           ++++E LN+GNN L  LP E+G+                        L  L++ +++H  L      + QL  L+ L +S N I  LP  I  L+ L+ LD  FN +  LP SFSS                       LT+L+ L   HNQL  F  ++L     + +LDLSGNR + +P++   ++ ++++
Sbjct:   37 KLRSGLRQLTLCAQNQQLVLPEDISEVEALNLGNNSLQELPEELGSSLNKLRVLELRRNKFTAAPRVLCELGQLVELDMSHNCLRTLSEGLGQLRALKKLCVSHNKIQSLPAQIGALQALEELDISFNLLHGLPRSFSS-----------------------LTRLRALDADHNQLSQFPVEILAL-GQLEELDLSGNRFVALPANIWRLTSIKVL 228          

HSP 4 Score: 63.1586 bits (152), Expect = 1.176e-10
Identity = 48/143 (33.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  293 QMRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLK--WLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +++S+ +QI   Q   LE+L+I  N L  LP    +L  L   + +H  LS FP  I  L QLE L++S N    LP +I +L  +K  WL S    ++ LPE+F  L +L  +    N    +   F  L +LK ++   NQ
Sbjct:  142 KIQSLPAQIGALQ--ALEELDISFNLLHGLPRSFSSLTRLRALDADHNQLSQFPVEILALGQLEELDLSGNRFVALPANIWRLTSIKVLWLSS--LRMASLPETFCRLQNLESLMLDGNRLSALPPSFGLLQRLKMMNLSSNQ 280          

HSP 5 Score: 59.3066 bits (142), Expect = 2.435e-9
Identity = 43/168 (25.60%), Postives = 80/168 (47.62%), Query Frame = 2
Query:  332 LTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQL 835
            L +LE+L++  N+  ALP  I  L ++    ++   ++  P + C+L  LE L +  N +S LP S   L+RLK ++   N +   P++   +  L  +    N    +    S L +L  L   +N +    D ++   N + +L L GN   ++P ++  +S V +
Sbjct:  199 LGQLEELDLSGNRFVALPANIWRLTSIKVLWLSSLRMASLPETFCRLQNLESLMLDGNRLSALPPSFGLLQRLKMMNLSSNQLQVFPQALLGVCGLEELYLSRNRLSHVPEEISQLGRLVNLWLDNNSITRLPDSIVDLEN-LEELVLQGNHIAVLPDNFGKLSRVNI 365          
BLAST of SMED30018503 vs. Ensembl Medaka
Match: lrrc39 (leucine rich repeat containing 39 [Source:NCBI gene;Acc:101158344])

HSP 1 Score: 68.9366 bits (167), Expect = 6.163e-13
Identity = 39/132 (29.55%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNIN-HCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +LT+L++L +  N++ ++P E+G  ++L +  ++ + +LS  P     L +L++L++S N  SF+P+ I  L  L+WLD G N +  LPE    + +L+ +  Q N   K+ +  S +  L  L    N+
Sbjct:  128 IGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMNCFSFIPDCIVALPALEWLDIGGNCLQHLPEDIHKMENLHTLWLQRNDLEKLPDNISRMASLDTLVLSSNR 259          

HSP 2 Score: 54.299 bits (129), Expect = 5.430e-8
Identity = 34/132 (25.76%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFN-SISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            CL  L+++++  I    L  +P+ I + +NL+  +++  +++  P  I +L +L+ L +S N I  +P  +   + L+ L+   N  +S+LP+ F +L  L +++   N F  I +    L  L++L    N
Sbjct:   81 CLIHLSQVQEWQIHRTGLQKIPHFIPSFQNLLVLDLSRNSITEIPKQIGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMNCFSFIPDCIVALPALEWLDIGGN 212          

HSP 3 Score: 51.2174 bits (121), Expect = 5.690e-7
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 2
Query:  350 LNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFI-KIRNVFSDLTKLKYLSFKHN 712
            L I   +  +LP  + +L  + ++ I+   L   PH I     L  L++S N I+ +P  I +L RLK L   +N I  +PE       L  +    N  + ++ + F +LT+L++L    N
Sbjct:   68 LRIEQEEWKSLPGCLIHLSQVQEWQIHRTGLQKIPHFIPSFQNLLVLDLSRNSITEIPKQIGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMN 189          
BLAST of SMED30018503 vs. Ensembl Medaka
Match: lrrc39 (leucine rich repeat containing 39 [Source:NCBI gene;Acc:101158344])

HSP 1 Score: 68.9366 bits (167), Expect = 6.356e-13
Identity = 39/132 (29.55%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNIN-HCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + +LT+L++L +  N++ ++P E+G  ++L +  ++ + +LS  P     L +L++L++S N  SF+P+ I  L  L+WLD G N +  LPE    + +L+ +  Q N   K+ +  S +  L  L    N+
Sbjct:  121 IGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMNCFSFIPDCIVALPALEWLDIGGNCLQHLPEDIHKMENLHTLWLQRNDLEKLPDNISRMASLDTLVLSSNR 252          

HSP 2 Score: 54.299 bits (129), Expect = 5.910e-8
Identity = 34/132 (25.76%), Postives = 69/132 (52.27%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFN-SISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            CL  L+++++  I    L  +P+ I + +NL+  +++  +++  P  I +L +L+ L +S N I  +P  +   + L+ L+   N  +S+LP+ F +L  L +++   N F  I +    L  L++L    N
Sbjct:   74 CLIHLSQVQEWQIHRTGLQKIPHFIPSFQNLLVLDLSRNSITEIPKQIGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMNCFSFIPDCIVALPALEWLDIGGN 205          

HSP 3 Score: 50.8322 bits (120), Expect = 6.983e-7
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 2
Query:  350 LNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFI-KIRNVFSDLTKLKYLSFKHN 712
            L I   +  +LP  + +L  + ++ I+   L   PH I     L  L++S N I+ +P  I +L RLK L   +N I  +PE       L  +    N  + ++ + F +LT+L++L    N
Sbjct:   61 LRIEQEEWKSLPGCLIHLSQVQEWQIHRTGLQKIPHFIPSFQNLLVLDLSRNSITEIPKQIGELTRLKELLLSYNRIQSVPEELGGCESLERLELSMNRDLSELPDQFRNLTRLQHLDLSMN 182          
BLAST of SMED30018503 vs. Planmine SMEST
Match: SMESG000023942.1 (SMESG000023942.1)

HSP 1 Score: 321.627 bits (823), Expect = 1.059e-119
Identity = 172/172 (100.00%), Postives = 172/172 (100.00%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 838
            LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQLLAFDDDLLLATNSVTKLDLSGNRDLIVPSHWAAMSHVQLM
Sbjct:  452 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQLLAFDDDLLLATNSVTKLDLSGNRDLIVPSHWAAMSHVQLM 623          

HSP 2 Score: 127.872 bits (320), Expect = 1.059e-119
Identity = 63/65 (96.92%), Postives = 64/65 (98.46%), Query Frame = 1
Query:  127 QASNSLIYDKFEKCKINKSELLNFSHLQISVFQGFNEKLDHVRILLLNNNTIIAPPNEVNLFPNL 321
            +ASNSLIYDKFEKCKINKSELLNFSHL ISVFQGFNEKLDHVRILLLNNNTIIAPPNEVNLFPNL
Sbjct:  371 KASNSLIYDKFEKCKINKSELLNFSHLHISVFQGFNEKLDHVRILLLNNNTIIAPPNEVNLFPNL 435          
BLAST of SMED30018503 vs. Planmine SMEST
Match: SMESG000004186.1 (SMESG000004186.1)

HSP 1 Score: 69.707 bits (169), Expect = 5.685e-13
Identity = 43/125 (34.40%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  341 LEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L +L++ +N +  +  +I  L NL+  ++ + NL   P  IC L QL YLN+S+N I+ LP SI  L  L+ +  G N +  LP  F  L+ L  ++   N F  I +   +  KLK LS  +N+
Sbjct:   98 LTKLDLSSNHIKKVSEDIRFLSNLLYLDLQNNNLKTIPDEICDLAQLRYLNLSKNKITVLPESIGTLNHLQQIILGNNLLKLLPTEFCRLLSLEVLDLSNNEFSHIPDAIGNFIKLKRLSISYNK 222          

HSP 2 Score: 60.8474 bits (146), Expect = 3.828e-10
Identity = 34/107 (31.78%), Postives = 57/107 (53.27%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTN 643
            +C L +L  LN+  N+++ LP  IG L +L +  + +  L   P   C+L+ LE L++S N  S +P++I    +LK L   +N +  LP++   L  L Y +   N
Sbjct:  138 ICDLAQLRYLNLSKNKITVLPESIGTLNHLQQIILGNNLLKLLPTEFCRLLSLEVLDLSNNEFSHIPDAIGNFIKLKRLSISYNKLEKLPKNICKLKALIYFDVSQN 244          

HSP 3 Score: 56.9954 bits (136), Expect = 8.139e-9
Identity = 33/104 (31.73%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  320 CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYIN 631
             +  L  L+Q+ +GNN L  LP E   L +L   ++++   S+ P +I   ++L+ L+IS N +  LP +IC+LK L + D   N IS+ P+   +  ++  +N
Sbjct:  160 SIGTLNHLQQIILGNNLLKLLPTEFCRLLSLEVLDLSNNEFSHIPDAIGNFIKLKRLSISYNKLEKLPKNICKLKALIYFDVSQNKISEFPKDLDASFEVLKVN 263          
BLAST of SMED30018503 vs. Planmine SMEST
Match: SMESG000037709.1 (SMESG000037709.1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.628e-13
Identity = 43/133 (32.33%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  296 MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKY 694
            +R +  +I L  LT LE++ + NN L+ LPNEI NLK L   +I +     FP  IC+++ +E+ + S+N    +P SI  LK L+ L    N +  LP+    L+ L  +    N   ++   F  L  L +
Sbjct:   86 LRHVPKEIGL--LTNLERIALSNNSLTTLPNEIKNLKKLRSLHIANNKFETFPEIICEILSMEFFDASDNMFRSVPKSIRNLKSLETLMLYENQLEGLPDELCELIQLRCLWLGNNKLTQLPKQFGRLKLLDW 216          

HSP 2 Score: 50.0618 bits (118), Expect = 8.584e-7
Identity = 33/116 (28.45%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  368 QLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            +L  +P  IG L NL    ++  +L + P  I  L  LE + +S N ++ LPN I  LK+L+ L    N     PE    ++ + + +   N+F  +     +L  L+ L    NQ
Sbjct:   62 KLQEVPLSIGKLLNLKILMLDTNDLRHVPKEIGLLTNLERIALSNNSLTTLPNEIKNLKKLRSLHIANNKFETFPEIICEILSMEFFDASDNMFRSVPKSIRNLKSLETLMLYENQ 177          

HSP 3 Score: 49.2914 bits (116), Expect = 1.577e-6
Identity = 34/133 (25.56%), Postives = 67/133 (50.38%), Query Frame = 2
Query:  317 ICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            + + +L  L+ L +  N L  +P EIG L NL +  +++ +L+  P+ I  L +L  L+I+ N     P  IC++  +++ D+  N    +P+S  +L  L  +    N    + +   +L +L+ L   +N+
Sbjct:   68 LSIGKLLNLKILMLDTNDLRHVPKEIGLLTNLERIALSNNSLTTLPNEIKNLKKLRSLHIANNKFETFPEIICEILSMEFFDASDNMFRSVPKSIRNLKSLETLMLYENQLEGLPDELCELIQLRCLWLGNNK 200          
BLAST of SMED30018503 vs. Planmine SMEST
Match: SMESG000029655.1 (SMESG000029655.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.227e-11
Identity = 44/144 (30.56%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  290 LQMRSIYSQI---CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L +RS   +I   CL +L  LE L + +N++ ++P+ +  L+NL    ++  N+S  P  I +L +L  LN++ N I  LP  +C    ++ LD   N +++LPES  +L +L  +N + N   KI      +  LK    + N
Sbjct:  189 LDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNISRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQN 332          

HSP 2 Score: 55.8398 bits (133), Expect = 1.999e-8
Identity = 50/194 (25.77%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESF-SSLVDLYYIN----------------FQTNLFIKIRN---------VFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQ 832
            +L +L  LN+  N++  LP E+ N  ++   ++ H  L+  P S+  L  L  LNI  N I+ +P S+ ++K LK      N + +LP+ F S+L +L  +N                F T + + + N         +FS    L  L+ + N++     + ++   ++ +LDLS N+  I+P    A+ ++Q
Sbjct:  251 KLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQNCVENLPDQFLSNLGNLDNVNLSRNAFKTFPTGGPNQFATTMSLNMSNNHIDCIPMGIFSVSKHLSILNLRGNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQ 444          

HSP 3 Score: 54.299 bits (129), Expect = 5.035e-8
Identity = 38/126 (30.16%), Postives = 62/126 (49.21%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T L +L++ +NQLS +P EIG L NL K +++  ++   P +I  L  L  L + +N I  LP+ I  L+ +  L+   N +  LP S   L  L  +    N    +     +++ L  L  K+N
Sbjct:  418 TTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTNELKSLPASIGKLKSLMKLRLAENDLRIVPPEIGEMSSLTELHLKNN 543          

HSP 4 Score: 53.9138 bits (128), Expect = 7.015e-8
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L + T L+ L++ +N++  +P  +  L+NL    ++   +   P S+ +L  L++L + +N IS LP  I +L+RL  L+  FN I +LPE   +   +  ++   N   ++     +L  L  L+ ++NQ
Sbjct:  180 LSKCTGLKVLDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNISRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQ 310          

HSP 5 Score: 51.9878 bits (123), Expect = 2.832e-7
Identity = 43/155 (27.74%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  359 GNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMS 823
            GN   + +PN++     L++ +++   LS  P  I  LV L+ L++S N I  LP +I  L  L  L+   N I  LP+   +L  +  +N  TN   +++++ + + KLK                     S+ KL L+ N   IVP     MS
Sbjct:  403 GNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTN---ELKSLPASIGKLK---------------------SLMKLRLAENDLRIVPPEIGEMS 533          
BLAST of SMED30018503 vs. Planmine SMEST
Match: SMESG000029655.1 (SMESG000029655.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.322e-11
Identity = 44/144 (30.56%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  290 LQMRSIYSQI---CLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            L +RS   +I   CL +L  LE L + +N++ ++P+ +  L+NL    ++  N+S  P  I +L +L  LN++ N I  LP  +C    ++ LD   N +++LPES  +L +L  +N + N   KI      +  LK    + N
Sbjct:  180 LDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNISRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQN 323          

HSP 2 Score: 55.4546 bits (132), Expect = 2.272e-8
Identity = 50/194 (25.77%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  329 QLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESF-SSLVDLYYIN----------------FQTNLFIKIRN---------VFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMSHVQ 832
            +L +L  LN+  N++  LP E+ N  ++   ++ H  L+  P S+  L  L  LNI  N I+ +P S+ ++K LK      N + +LP+ F S+L +L  +N                F T + + + N         +FS    L  L+ + N++     + ++   ++ +LDLS N+  I+P    A+ ++Q
Sbjct:  242 KLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQNCVENLPDQFLSNLGNLDNVNLSRNAFKTFPTGGPNQFATTMSLNMSNNHIDCIPMGIFSVSKHLSILNLRGNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQ 435          

HSP 3 Score: 54.299 bits (129), Expect = 5.187e-8
Identity = 38/126 (30.16%), Postives = 62/126 (49.21%), Query Frame = 2
Query:  335 TKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHN 712
            T L +L++ +NQLS +P EIG L NL K +++  ++   P +I  L  L  L + +N I  LP+ I  L+ +  L+   N +  LP S   L  L  +    N    +     +++ L  L  K+N
Sbjct:  409 TTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTNELKSLPASIGKLKSLMKLRLAENDLRIVPPEIGEMSSLTELHLKNN 534          

HSP 4 Score: 53.9138 bits (128), Expect = 7.161e-8
Identity = 36/131 (27.48%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  323 LCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQ 715
            L + T L+ L++ +N++  +P  +  L+NL    ++   +   P S+ +L  L++L + +N IS LP  I +L+RL  L+  FN I +LPE   +   +  ++   N   ++     +L  L  L+ ++NQ
Sbjct:  171 LSKCTGLKVLDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNISRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQ 301          

HSP 5 Score: 51.9878 bits (123), Expect = 3.306e-7
Identity = 43/155 (27.74%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  359 GNNQLSALPNEIGNLKNLIKFNINHCNLSYFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPESFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQXXXXXXXXXXXTNSVTKLDLSGNRDLIVPSHWAAMS 823
            GN   + +PN++     L++ +++   LS  P  I  LV L+ L++S N I  LP +I  L  L  L+   N I  LP+   +L  +  +N  TN   +++++ + + KLK                     S+ KL L+ N   IVP     MS
Sbjct:  394 GNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTN---ELKSLPASIGKLK---------------------SLMKLRLAENDLRIVPPEIGEMS 524          
The following BLAST results are available for this feature:
BLAST of SMED30018503 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFHAS11.695e-1328.65malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS11.695e-1328.65malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS11.727e-1328.65malignant fibrous histiocytoma amplified sequence ... [more]
LRRC13.602e-1331.17leucine rich repeat containing 1 [Source:HGNC Symb... [more]
LRRIQ45.828e-1326.74leucine rich repeats and IQ motif containing 4 [So... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-4138.095e-1434.38pep chromosome:WBcel235:V:7972934:7977774:-1 gene:... [more]
let-4139.604e-1434.38pep chromosome:WBcel235:V:7972924:7977774:-1 gene:... [more]
F56A8.31.312e-1032.41pep chromosome:WBcel235:III:13256880:13262883:1 ge... [more]
F56A8.31.312e-1032.41pep chromosome:WBcel235:III:13256880:13262883:1 ge... [more]
soc-22.920e-1026.15Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrib4.849e-1631.76gene:FBgn0263289 transcript:FBtr0308623[more]
scrib4.856e-1631.76gene:FBgn0263289 transcript:FBtr0308632[more]
scrib4.867e-1631.76gene:FBgn0263289 transcript:FBtr0308620[more]
scrib4.867e-1631.76gene:FBgn0263289 transcript:FBtr0308621[more]
scrib4.871e-1631.76gene:FBgn0263289 transcript:FBtr0335522[more]
back to top
BLAST of SMED30018503 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1h4.46.508e-2333.92si:dkey-1h4.4 [Source:ZFIN;Acc:ZDB-GENE-160728-41][more]
shoc21.687e-1333.06SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc21.687e-1333.06SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc21.687e-1333.06SHOC2 leucine rich repeat scaffold protein [Source... [more]
scrib3.508e-1333.59scribble planar cell polarity protein [Source:NCBI... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCRIB3.599e-1335.20scribbled planar cell polarity protein [Source:NCB... [more]
ENSXETT00000034460.17.237e-1334.55volume-regulated anion channel subunit LRRC8E gene... [more]
LRRD17.362e-1335.11leucine-rich repeats and death domain containing 1... [more]
SCRIB8.601e-1334.85scribbled planar cell polarity protein [Source:NCB... [more]
SCRIB9.253e-1334.85scribbled planar cell polarity protein [Source:NCB... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc183.898e-1327.82leucine rich repeat containing 18 [Source:MGI Symb... [more]
Lrrc184.618e-1327.82leucine rich repeat containing 18 [Source:MGI Symb... [more]
Lrrc187.874e-1327.82leucine rich repeat containing 18 [Source:MGI Symb... [more]
Lrrc19.706e-1336.15leucine rich repeat containing 1 [Source:MGI Symbo... [more]
Lrrc11.411e-1236.15leucine rich repeat containing 1 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30018503 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54AX5|LRRA_DICDI8.025e-1839.01Leucine-rich repeat protein lrrA OS=Dictyostelium ... [more]
sp|Q6ZH85|PIRL2_ORYSJ3.234e-1533.33Plant intracellular Ras-group-related LRR protein ... [more]
sp|Q7KRY7|LAP4_DROME4.913e-1531.76Protein lap4 OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q6Z8P4|PIRL4_ORYSJ2.405e-1440.32Plant intracellular Ras-group-related LRR protein ... [more]
sp|Q9LRV8|PIRL2_ARATH3.732e-1431.01Plant intracellular Ras-group-related LRR protein ... [more]
back to top
BLAST of SMED30018503 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8LA751.200e-2136.26Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A444U3781.591e-2137.28Malignant fibrous histiocytoma-amplified sequence ... [more]
A0A4Q7WID51.106e-2037.27Leucine rich repeat (LRR) protein OS=Plantactinosp... [more]
A0A2G8JHS11.889e-2035.09Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A210QD442.597e-2036.75Leucine-rich repeat protein SHOC-2 OS=Mizuhopecten... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC21.778e-1331.75leucine rich repeat containing 2 [Source:NCBI gene... [more]
LRRC21.906e-1331.75leucine rich repeat containing 2 [Source:NCBI gene... [more]
LRRC23.202e-1331.75leucine rich repeat containing 2 [Source:NCBI gene... [more]
lrrc17.970e-1331.88leucine rich repeat containing 1 [Source:NCBI gene... [more]
lrrc11.451e-1232.12leucine rich repeat containing 1 [Source:NCBI gene... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011353.19.489e-1531.39pep scaffold:Pmarinus_7.0:GL480086:13034:13672:1 g... [more]
scrib4.250e-1331.58scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000004940.11.787e-1231.20pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
lrrc408.923e-1226.22leucine rich repeat containing 40 [Source:NCBI gen... [more]
ENSPMAT00000008655.12.667e-1130.07pep scaffold:Pmarinus_7.0:GL484079:6946:12214:1 ge... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CYR11.507e-831.73Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455701.809e-2337.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351382.097e-1532.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372278.754e-1535.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380398.968e-1432.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374991.173e-1131.20Leucine-rich repeat protein soc-2 homolog [Source... [more]
back to top
BLAST of SMED30018503 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc18a7.041e-1534.59leucine rich repeat containing 18a [Source:ZFIN;Ac... [more]
lrrc407.240e-1428.57leucine rich repeat containing 40 [Source:NCBI gen... [more]
mfhas11.601e-1335.61malignant fibrous histiocytoma amplified sequence ... [more]
lrrc396.163e-1329.55leucine rich repeat containing 39 [Source:NCBI gen... [more]
lrrc396.356e-1329.55leucine rich repeat containing 39 [Source:NCBI gen... [more]
back to top
BLAST of SMED30018503 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023942.11.059e-119100.00SMESG000023942.1[more]
SMESG000004186.15.685e-1334.40SMESG000004186.1[more]
SMESG000037709.17.628e-1332.33SMESG000037709.1[more]
SMESG000029655.11.227e-1130.56SMESG000029655.1[more]
SMESG000029655.11.322e-1130.56SMESG000029655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018503 ID=SMED30018503|Name=SMED30018503|organism=Schmidtea mediterranea sexual|type=transcript|length=941bp
ATAATTTTTTTCTTAATGTGTTAGTTTTAGATACATATATTTAGTATTTA
TTAATTCATTTAATAAATTCAACAATAATTATTATTATTGCCTTGTAAAA
AGTTATAAATTAATTTTATTTATTTACAGGCTAGTAATAGTTTAATTTAC
GATAAATTTGAAAAATGTAAAATAAACAAATCAGAACTGTTAAATTTTAG
TCACTTGCAGATTTCTGTTTTTCAAGGTTTCAATGAGAAATTAGATCATG
TAAGGATATTATTATTAAATAATAATACAATTATTGCGCCTCCAAATGAG
GTCAATCTATTCCCAAATTTGTTTATGTCAATTAACCAAACTAGAACAAT
TAAATATTGGTAACAATCAATTGTCTGCTTTGCCAAATGAAATCGGAAAT
CTCAAGAATCTCATCAAATTCAACATCAACCATTGTAACTTGTCGTATTT
TCCCCATTCGATATGCCAATTGGTTCAGTTGGAGTATTTAAATATTTCAG
AAAATTTCATTTCTTTTCTACCGAATTCAATTTGTCAATTGAAACGTTTG
AAATGGCTCGATTCCGGTTTCAATTCGATTTCGGATCTTCCTGAATCTTT
CAGCAGTTTGGTCGATCTTTATTACATTAATTTTCAAACGAATTTATTCA
TCAAAATTCGGAACGTTTTTTCCGACTTGACGAAATTGAAATATCTTTCA
TTTAAGCATAACCAATTGTTGGCGTTCGACGATGATTTGCTGTTGGCGAC
GAATTCTGTTACAAAGCTTGATCTCAGCGGCAATCGGGATCTGATTGTAC
CGTCTCATTGGGCAGCTATGTCTCATGTACAGTTAATGGAAGATGACCCC
GAGGTTGATCACGAGGATGTGTGATATTATTTTTAGAAATTATTGTTTGA
TTTTTTTGTGAAATAAATAAAGATCTTGTCTCTAAAAAAAA
back to top

protein sequence of SMED30018503-orf-1

>SMED30018503-orf-1 ID=SMED30018503-orf-1|Name=SMED30018503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MRSIYSQICLCQLTKLEQLNIGNNQLSALPNEIGNLKNLIKFNINHCNLS
YFPHSICQLVQLEYLNISENFISFLPNSICQLKRLKWLDSGFNSISDLPE
SFSSLVDLYYINFQTNLFIKIRNVFSDLTKLKYLSFKHNQLLAFDDDLLL
ATNSVTKLDLSGNRDLIVPSHWAAMSHVQLMEDDPEVDHEDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction