SMED30018499
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30018499 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Alignments
SMED30018499 aligns in the following genomic locations:
Homology
BLAST of SMED30018499 vs. TrEMBL
Match: A0A1I8HAV3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 1.518e-6 Identity = 24/44 (54.55%), Postives = 34/44 (77.27%), Query Frame = 1 Query: 289 KNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQK 420 K +R+ R+VMA+ VLL M VILVG+TLS+S+HID +V++ K Sbjct: 82 KQKRIARVVMAVAFVLLAMCVILVGVTLSMSDHIDDLVRKAQLK 125
BLAST of SMED30018499 vs. Planmine SMEST
Match: SMESG000029677.1 (SMESG000029677.1) HSP 1 Score: 246.514 bits (628), Expect = 5.708e-85 Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 1 Query: 91 MENKESEKTDNIISKPSENHDVIPNLNQAVPESVTMETLLAYTAEAAKYRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQKSVKSEDSVSGKSN 459 MENKESEKTDNIISKPSENHDVIPNLNQ VPESVTMETLLAYTAEAAKYRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQKSVKSEDSVSGKSN Sbjct: 1 MENKESEKTDNIISKPSENHDVIPNLNQTVPESVTMETLLAYTAEAAKYRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQKSVKSEDSVSGKSN 123
BLAST of SMED30018499 vs. Planmine SMEST
Match: SMESG000026902.1 (SMESG000026902.1) HSP 1 Score: 66.6254 bits (161), Expect = 6.836e-14 Identity = 34/82 (41.46%), Postives = 62/82 (75.61%), Query Frame = 1 Query: 175 AVPESVTMETLLAYTAEAAKYRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQK 420 A+P+S T E +LA++ +++++ +R Q+ L NL+++R T++V+ +G +LL+MS++L+ ++LSLSEHID+MV+E H K Sbjct: 75 AMPDSKTYEDILAFSHQSSRHLWTLKR---QDTL--NLRDKRTTKVVVVVGTMLLIMSLVLIAVSLSLSEHIDRMVREHHLK 151
BLAST of SMED30018499 vs. Planmine SMEST
Match: SMESG000016957.1 (SMESG000016957.1) HSP 1 Score: 64.3142 bits (155), Expect = 1.154e-12 Identity = 29/62 (46.77%), Postives = 45/62 (72.58%), Query Frame = 1 Query: 235 YRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQK 420 ++++ S Y + ++ K +R+ R+VM + I+LL M VILVG+TLS+S++ID MVKE HQK Sbjct: 143 FKNNVSSSMYDIQETQSPKEKRIARIVMVVAILLLTMCVILVGVTLSMSDYIDTMVKELHQK 204
BLAST of SMED30018499 vs. Planmine SMEST
Match: SMESG000027325.1 (SMESG000027325.1) HSP 1 Score: 54.299 bits (129), Expect = 2.261e-9 Identity = 33/82 (40.24%), Postives = 61/82 (74.39%), Query Frame = 1 Query: 175 AVPESVTMETLLAYTAEAAKYRSDSRRSSYQNELARNLKNRRMTRLVMAIGIVLLVMSVILVGITLSLSEHIDKMVKETHQK 420 ++PES E +L +T+++ K+ + ++N+ NL+++R T++V+ +GI+LL+MS+IL+ ++LSLSEHI+K+VKE +K Sbjct: 79 SIPESKHYEYVLDFTSQSTKHLCN-----FKNQETLNLRDKRTTKIVLIVGIILLLMSLILIAVSLSLSEHINKLVKEQFKK 155 The following BLAST results are available for this feature:
BLAST of SMED30018499 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30018499 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30018499 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 1
BLAST of SMED30018499 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30018499 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30018499 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 4
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30018499 ID=SMED30018499|Name=SMED30018499|organism=Schmidtea mediterranea sexual|type=transcript|length=532bpback to top protein sequence of SMED30018499-orf-1 >SMED30018499-orf-1 ID=SMED30018499-orf-1|Name=SMED30018499-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp MENKESEKTDNIISKPSENHDVIPNLNQAVPESVTMETLLAYTAEAAKYRback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|