ATPase_AAA_core domain-containing protein

Overview
NameATPase_AAA_core domain-containing protein
Smed IDSMED30018495
Length (bp)2518
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase_AAA_core domain-containing protein (SMED30018495) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase_AAA_core domain-containing protein (SMED30018495) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase_AAA_core domain-containing protein (SMED30018495) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase_AAA_core domain-containing protein (SMED30018495) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018495

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018495SMESG000073596.1 Contig37757newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018495SMESG000073596.1 Contig37757uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018495SMESG000081995.1 SMESG000080328.1 SMESG000080048.1 SMESG000078665.1 SMESG000077025.1 SMESG000076395.1 SMESG000075858.1 SMESG000073751.1 SMESG000073596.1 SMESG000068623.1 SMESG000066691.1 SMESG000062442.1 SMESG000054975.1 SMESG000054276.1 SMESG000051957.1 SMESG000049162.1 SMESG000046165.1 SMESG000036051.1 SMESG000035648.1 SMESG000034762.1 SMESG000030928.1 SMESG000030069.1 SMESG000029599.1 SMESG000029355.1 SMESG000027993.1 SMESG000027217.1 SMESG000022058.1 SMESG000012961.1 SMESG000012903.1 SMESG000010709.1 SMESG000007675.1 SMESG000006952.1 SMESG000004166.1 SMESG000003706.1 SMESG000002239.1 SMESG000080313.1 SMESG000069906.1 SMESG000066842.1 SMESG000050392.1 SMESG000033095.1 SMESG000017493.1 SMESG000004603.1 SMESG000004121.1 Contig42477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018495SMESG000081995.1 SMESG000080328.1 SMESG000080048.1 SMESG000078665.1 SMESG000077025.1 SMESG000076395.1 SMESG000075858.1 SMESG000073751.1 SMESG000073596.1 SMESG000068623.1 SMESG000066691.1 SMESG000062442.1 SMESG000054975.1 SMESG000054276.1 SMESG000051957.1 SMESG000049162.1 SMESG000046165.1 SMESG000036051.1 SMESG000035648.1 SMESG000034762.1 SMESG000030928.1 SMESG000030069.1 SMESG000029599.1 SMESG000029355.1 SMESG000027993.1 SMESG000027217.1 SMESG000022058.1 SMESG000012961.1 SMESG000012903.1 SMESG000010709.1 SMESG000007675.1 SMESG000006952.1 SMESG000004166.1 SMESG000003706.1 SMESG000002239.1 SMESG000080313.1 SMESG000069906.1 SMESG000066842.1 SMESG000050392.1 SMESG000033095.1 SMESG000017493.1 SMESG000004603.1 SMESG000004121.1 Contig42477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30018495SMESG000073596.1 dd_Smed_v6_9568_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018495SMESG000073596.1 dd_Smed_v4_9484_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018495SMESG000073596.1 dd_Smed_v4_9568_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:HGNC Symbol;Acc:HGNC:26195])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 412/826 (49.88%), Postives = 587/826 (71.07%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEK---PEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP-LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MS+  YNK WH+ Q+ L  +L  E  P+K   P+++Q+  FQ L+T Y+KY+QIFR LE  YDQ VHPQKR +I+KVLDGV+GRI+E+KNEMV LEL+E+HYFDD+L DLKL PQ ++IPIPKYF+ E+ +++  REK+L QILA S +    + SDMK     +P DEA+++IQI ERARQGR+RA  M++I  QE + + + +   +  D   AAL+IQ++WR    R+  +K++EEE ++LGM+ P L    S   +Q ++  ++ ++ +IK    E++Y +ALVTIK+ ++  EG D+ E+++DQIR WF+E R++ G FPDYP+ E+GGS  IF +KT +++ E++   +  E+KNKKK K K K  K    ++K  K +  +E+E+   MS S FLP + EG   Y+ +W  ++E  NF+Q +DPE+IKEEKR+E+++EIRIQVDELMRQEL+NLK++VD+E+ + +   K+K KKGKKGKK +K+                +  +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + I P+GS  V EKAPL+KS+LL GP GVGK MLVH+ICTE GANLF+L++SN+ GKYPGK+GL+M+LH VFKV R LQPS++ ++  EK F KK+P  +  +  +  K     + K +KP+DRI+++GT+  PFDAEL+ FC +YQKIIL+PRPDYASR ++W+++I R+ G+LT+ L++S L K++DG+T   +  V + VLT++RI +   KPL A EFIT +  ++PVY EEEE+FK WY KTPLGKKR  A
Sbjct:    1 MSNAMYNKMWHQTQEALGALLDKE--PQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRILIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQILADSGI----DTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAAALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKH---EEDYREALVTIKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWK-MSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKD----------KDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAVEFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALA 806          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:HGNC Symbol;Acc:HGNC:26195])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 399/826 (48.31%), Postives = 565/826 (68.40%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEK---PEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP-LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MS+  YNK WH+ Q+ L  +L  E  P+K   P+++Q+  FQ L+T Y+KY+QIFR LE  YDQ VHPQKR +I+KVLDGV+GRI+E+KNEMV LEL+E+HYFDD+L DLKL PQ ++IPIPKYF+ E+ +++  REK+L QILA S +    + SDMK     +P DEA+++IQI ERARQGR+RA  M++I  QE + + + +   +  D   AAL+IQ++WR    R+  +K++EEE ++LGM+ P L    S   +Q ++  ++ ++ +IK    E++Y +ALVTIK+ ++  EG D+ E+++DQIR WF+E R++ G FPDYP+ E+GGS  IF +KT ++  +E +K                                          MS S FLP + EG   Y+ +W  ++E  NF+Q +DPE+IKEEKR+E+++EIRIQVDELMRQEL+NLK++VD+E+ + +   K+K KKGKKGKK +K+                +  +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + I P+GS  V EKAPL+KS+LL GP GVGK MLVH+ICTE GANLF+L++SN+ GKYPGK+GL+M+LH VFKV R LQPS++ ++  EK F KK+P  +  +  +  K     + K +KP+DRI+++GT+  PFDAEL+ FC +YQKIIL+PRPDYASR ++W+++I R+ G+LT+ L++S L K++DG+T   +  V + VLT++RI +   KPL A EFIT +  ++PVY EEEE+FK WY KTPLGKKR  A
Sbjct:    1 MSNAMYNKMWHQTQEALGALLDKE--PQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRILIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQILADSGI----DTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAAALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKH---EEDYREALVTIKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQEEDEKWK------------------------------------------MSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKD----------KDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAVEFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALA 765          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:HGNC Symbol;Acc:HGNC:26195])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 407/824 (49.39%), Postives = 582/824 (70.63%), Query Frame = 1
Query:   64 HNTYNKQWHEAQQNLQDILAYEEIPEK---PEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP-LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            +  YNK WH+ Q+ L  +L  E  P+K   P+++Q+  FQ L+T Y+KY+QIFR LE  YDQ VHPQKR +I+KVLDGV+GRI+E+KNEMV LEL+E+HYFDD+L DLKL PQ ++IPIPKYF+ E+ +++  REK+L QILA S +    + SDMK     +P DEA+++IQI ERARQGR+RA  M++I  QE + + + +   +  D   AAL+IQ++WR    R+  +K++EEE ++LGM+ P L    S   +Q ++  ++ ++ +IK    E++Y +ALVTIK+ ++  EG D+ E+++DQIR WF+E R++ G FPDYP+ E+GGS  IF +KT +++ E++   +  E+KNKKK K K K  K    ++K  K +  +E+E+   MS S FLP + EG   Y+ +W  ++E  NF+Q +DPE+IKEEKR+E+++EIRIQVDELMRQEL+NLK++VD+E+ + +   K+K KK  K  K K++K               +  +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + I P+GS  V EKAPL+KS+LL GP GVGK MLVH+ICTE GANLF+L++SN+ GKYPGK+GL+M+LH VFKV R LQPS++ ++  EK F KK+P  +  +  +  K     + K +KP+DRI+++GT+  PFDAEL+ FC +YQKIIL+PRPDYASR ++W+++I R+ G+LT+ L++S L K++DG+T   +  V + VLT++RI +   KPL A EFIT +  ++PVY EEEE+FK WY KTPLGKKR  A
Sbjct:   10 NRMYNKMWHQTQEALGALLDKE--PQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRILIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQILADSGI----DTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAAALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKH---EEDYREALVTIKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWK-MSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKKGKKGKKKEKKAKK---------DKDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAVEFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALA 814          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:HGNC Symbol;Acc:HGNC:26195])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 333/667 (49.93%), Postives = 472/667 (70.76%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEK---PEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMS-TPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIP 2031
            MS+  YNK WH+ Q+ L  +L  E  P+K   P+++Q+  FQ L+T Y+KY+QIFR LE  YDQ VHPQKR +I+KVLDGV+GRI+E+KNEMV LEL+E+HYFDD+L DLKL PQ ++IPIPKYF+ E+ +++  REK+L QILA S +    + SDMK     +P DEA+++IQI ERARQGR+RA  M++I  QE + + + +   +  D   AAL+IQ++WR    R+  +K++EEE ++LGM+  PL    S   +Q ++  ++ ++ +IK    E++Y +ALVTIK+ ++  EG D+ E+++DQIR WF+E R++ G FPDYP+ E+GGS  IF +KT +++ E++      E++  KK K K +    K+ K+KKG   K+ EE+E WKMS S FLP + EG   Y+ +W  ++E  NF+Q +DPE+IKEEKR+E+++EIRIQVDELMRQEL+NLK++VD+E+ + +   K+K KK  K  K K++K               +  +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + I P+GS  V EKAPL+KS+LL GP GVGK MLVH+ICTE GANLF+L++SN+ GKYPGK+GL+M+LH VFKV R LQPS++ ++  EK F KK+P
Sbjct:    1 MSNAMYNKMWHQTQEALGALLDKE--PQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRILIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQILADSGI----DTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAAALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKH---EEDYREALVTIKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDII-ANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWKMSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKKGKKGKKKEKKAK---------KDKDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVP 648          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: IQCA1L (IQ motif containing with AAA domain 1 like [Source:HGNC Symbol;Acc:HGNC:22831])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 351/818 (42.91%), Postives = 523/818 (63.94%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPE-KSQLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            MS   Y + W  +   LQ++L  E++  +P    +  +FQ  L+++Y+ Y+ + R+ +  YDQ+V PQKR++++++LDGV GR++E+K+E+V  +L E H  D VL D KLTP D+E+PIPKYF++E+   + ER  +L +IL++ +     +KS   M   EAI ++Q  ERARQGR+RA  M+EIR  E++D              +AA+ IQ++W+G L R+  ++ +  E  ++GM  P        S+ + +   +E  +R++Q   E+E+  A+V   D + ETEG DM E MK+QIRQWF+E  D+ G+FPDYP+   GGS +IF +KTPE++  EL  +     K +++   +   D+ +  K K+ K +K + +     +  S  +P I  G + Y   WKNR E  + +Q +D E ++EEKR+EVE EIRIQVDELMRQELR L+++VDKE+ + +   K+   K    KK K   DLT               +R++ESLYEELVI G+++K+ +  L +Y G++ YLG+TL      P PSL D+R+ V  + +L +GSP++   APLI+S+LL GP G+GK MLV ++CTE GANLFDL+  NL GKYPG++G +M++H+VFKV RLLQPS++ +   EK F KK PK D     KR+KKDL K ++ + P DR+M+IGT+S P  AE++  C +Y++I+ +PRPDYASR ++W+++I       T HLDIS+L K+SDGYT   +    Q VL+ERR  QLSK+PL A+EF+  + ++DPVY EEEE+ K+WY KTPLGKK +K
Sbjct:    1 MSEGAYQRLWESSHATLQELLDQEQLLLEPAPDRERQSFQYRLASLYLHYLGLLRRFDTVYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRADLCENHCLDRVLQDFKLTPADLEVPIPKYFLLEQSTTVRERGLILAEILSRLEPVS-SQKSFTGMHRTEAIILVQKAERARQGRLRATFMREIRRDEEQDGRIREDGWHKFSQGQAAVTIQKVWKGYLQRKRTQQDRRMEMEFIGM-LPSPNQVEHLSI-ISQPCLVEDVQRLRQMEKEEEFRAAMVKAHDSLVETEGPDMKEKMKEQIRQWFIECHDLTGRFPDYPDASSGGSYSIFADKTPEQVRMELEMQMQENRKKEQEKSKEKGKDEKEKKKGKEEKAKKGEVDAVLQVLP-SKCIPMICAGHEEYLNTWKNRCESIHPSQNYDSETLREEKRKEVELEIRIQVDELMRQELRKLRLAVDKEEERPLRAPKKTPGKKTGKKKEK---DLTS--------------DRSVESLYEELVISGLLRKSESVALKDYIGDFLYLGSTLSLVKKLPMPSLFDIRQNVALYAVLRLGSPDIHIMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLFDLSPENLLGKYPGRNGAQMMVHIVFKVARLLQPSVIWIGNAEKNFYKKTPKEDKEMDPKRIKKDLTKALRLLTPGDRVMLIGTTSRPQLAEMRGLCRVYERILFMPRPDYASRYVLWKRMIEARGIQPTQHLDISALAKVSDGYTPGHILQAIQSVLSERRFLQLSKRPLVASEFLGQLVKLDPVYREEEESLKDWYFKTPLGKKSMK 797          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 78.5666 bits (192), Expect = 8.934e-15
Identity = 72/269 (26.77%), Postives = 141/269 (52.42%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIK--PEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL-NLVTQQVLTERR-----IAQLSKKPLQA---NEFITHMARIDPVYTEEE-EAFKEWYKK 2475
            L   ++ + E  +LP   P+V    +AP  K VLL GP G GKTM+   + ++  A  F+++AS+L  K+ G +G K L+  +F V RL  PS++ +D+ + +   +  +++    +R+K +    + G+   P++R++V+G ++ P + + +     +QK + I  P+  SR  I + L++     +TNH ++  + +L+DGY+ +D+  L T+  +   R     I  + K  ++A    +F      + P   + + +A+  W KK
Sbjct:  321 LEGAKKALREIVVLPFKRPDVFTGIRAPP-KGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVG-EGEK-LVRALFSVARLKLPSVIFIDEIDSLLSSRS-ESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELD-EAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNH-NLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKK 583          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: figl-1 (Fidgetin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O16299])

HSP 1 Score: 78.5666 bits (192), Expect = 8.934e-15
Identity = 72/269 (26.77%), Postives = 141/269 (52.42%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIK--PEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL-NLVTQQVLTERR-----IAQLSKKPLQA---NEFITHMARIDPVYTEEE-EAFKEWYKK 2475
            L   ++ + E  +LP   P+V    +AP  K VLL GP G GKTM+   + ++  A  F+++AS+L  K+ G +G K L+  +F V RL  PS++ +D+ + +   +  +++    +R+K +    + G+   P++R++V+G ++ P + + +     +QK + I  P+  SR  I + L++     +TNH ++  + +L+DGY+ +D+  L T+  +   R     I  + K  ++A    +F      + P   + + +A+  W KK
Sbjct:  321 LEGAKKALREIVVLPFKRPDVFTGIRAPP-KGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVG-EGEK-LVRALFSVARLKLPSVIFIDEIDSLLSSRS-ESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELD-EAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNH-NLERIRELTDGYSGADMRQLCTEAAMGPIRDIGDDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKK 583          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: spas-1 (Probable spastin homolog spas-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV0])

HSP 1 Score: 70.4774 bits (171), Expect = 2.327e-12
Identity = 61/205 (29.76%), Postives = 107/205 (52.20%), Query Frame = 1
Query: 1738 EFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIK-PEDRIMVIGTSSAPF---DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHN---GILTNHLDISSLTKLSDGYTMSDL 2325
            E  ILP  +P + +  + P +K +LL GP G GKT+L  ++  E     F+++AS+L  K+ G D  K +  L F++ R  QPSI+ +D+ + +  ++  K      +   + L +        +DRI+VIG ++ P    DA L+ F     K I++  PD  +R  +  K + +HN   G++++  DI  +   + G++ SDL
Sbjct:  192 EAVILPALNPNLFKGLRQP-VKGILLFGPPGNGKTLLAKAVAGESKQMFFNISASSLTSKWVG-DSEKTIRGL-FQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIGATNRPHELDDAVLRRF----PKRIMLNLPDEEARKELITKTLKKHNMMDGLISS--DIRYIASNTSGFSNSDL 387          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: spas-1 (Probable spastin homolog spas-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV0])

HSP 1 Score: 70.4774 bits (171), Expect = 2.456e-12
Identity = 61/205 (29.76%), Postives = 107/205 (52.20%), Query Frame = 1
Query: 1738 EFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIK-PEDRIMVIGTSSAPF---DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHN---GILTNHLDISSLTKLSDGYTMSDL 2325
            E  ILP  +P + +  + P +K +LL GP G GKT+L  ++  E     F+++AS+L  K+ G D  K +  L F++ R  QPSI+ +D+ + +  ++  K      +   + L +        +DRI+VIG ++ P    DA L+ F     K I++  PD  +R  +  K + +HN   G++++  DI  +   + G++ SDL
Sbjct:  253 EAVILPALNPNLFKGLRQP-VKGILLFGPPGNGKTLLAKAVAGESKQMFFNISASSLTSKWVG-DSEKTIRGL-FQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIGATNRPHELDDAVLRRF----PKRIMLNLPDEEARKELITKTLKKHNMMDGLISS--DIRYIASNTSGFSNSDL 448          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: mspn-1 (Mitochondrial sorting homolog [Source:UniProtKB/Swiss-Prot;Acc:P54815])

HSP 1 Score: 67.3958 bits (163), Expect = 1.072e-11
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = 1
Query: 1795 KSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAE---LKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKK-------PLQANEF 2403
            + +LL GP G GKT+L  ++    G    +L  SNL  K+ G+   + L   VF V +  QP+I+ +D+ +   + +      S      + +          D+I+V+G ++ P D +   L+   + +Q    +P P+   R+ I   +ILR+  I  N +++  + + ++G + SDL  V +  L  R  A ++         PL+ ++F
Sbjct:  115 RGILLYGPPGCGKTLLAKAVARAAGCRFINLQVSNLTDKWYGES--QKLAAAVFSVAQKFQPTIIFIDEIDSFLRDRQSHDHESTAMMKAQFMTLWDGFSSSGDQIIVMGATNRPRDVDAAILRRMTARFQ----VPVPNAKQRSQIL-NVILRNEKI-NNTVNLGEIAQAAEGLSGSDLKEVCRLALLARAKATVASGGSVNQLLPLEQSDF 319          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: CG16789 (gene:FBgn0037712 transcript:FBtr0332806)

HSP 1 Score: 481.871 bits (1239), Expect = 8.415e-158
Identity = 322/836 (38.52%), Postives = 489/836 (58.49%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQ--DILAYEEIPEKPEKSQLAAFQLLSTM-----------------YIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNE-AALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP---LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKR 2496
            MS   +N  WH++Q   +    + YE   +  E +       + ++                 Y++YI +  +LE  YD ++ PQKR++++K+LD  +GR++E+K+++VN++L E+ Y D+V+  L+LTP + E+ IP+YF+ ER++ L  R+K + +IL K    E  E  +      EAIRM+Q+HERARQGR+RA  M+EIR  ++K ++      +  D    AA+KIQ+MWRG  +RR  ++ K EE + +GM  P   +V   + K  +LQ   K    R   QA + +E+ +    +K++IR   G+ M E + D+IR W  +  D  GK PD+P E+ GGS++IF     E        +         K   K KD      +       ++ +EE  ++ + S  LP I     ++   W++++E    +Q    ++I  +K +EVE E R  VD++MRQE+  L+ +V     K++ K  +K ++  K  K KKEKDLTP              +RT ESLYEELV  GII+K    +L ++      LG       I   PS  D+R+++TE+CILP+GS  +    PLI+S+LL GP+G GK  L+H+ICTE+GA LFDLT +N+ GKYPGK GL ML+HLV KV RLLQP+++ +   E+ F KKIPKTD +DPKRLKKDLPKL+K I PEDR++ IGTS+ P++A+ K   S+Y + I IPRPDY + +  W+ L+  ++G ++N LD S++ K+SDGYT+  ++   ++V+T +R  QL  +PL   E I  +   DPVY EEEEAF+ W+ KTPLG++R
Sbjct:    1 MSSTYFNDIWHQSQHECELLSTIDYERQHQDVETTVATMNAAVGSVAADADAKALLQSSLYEFYLRYICLSNRLEDVYDNMIQPQKRQLVRKLLDACLGRVVELKHDLVNIDLMEFSYNDEVVERLRLTPMETELRIPRYFLRERQQELEFRKKTMHEILTKLGWLEEHELEETVTTEIEAIRMLQMHERARQGRLRAHFMKEIRILKEKGKSEERTEKERSDSGLLAAMKIQKMWRGHTARRITRRRKMEEMILIGMLPPPPAVVKERAEKLEKLQHNEK----RYQAQAFYGKEFEERQNALKEEIRAKHGASMKEDIADEIRAWVKDCYDKTGKLPDFPSEDQGGSLHIFSRPGTE-------SEHSRSSARSSKESRKTKDKSKSPARSGDLNVNENQDEEVSFQPAPSVCLPDIRAEIDLFNDTWRDKDETGVLSQAAYEDMIYSDKYQEVELEFRRAVDDVMRQEIELLQTAV----GKKVKKSSKKTRRSGKKSKKKKEKDLTP--------------DRTTESLYEELVTNGIIRKYPELRLKQF------LGDKALTARIGTNPSPGDIRQILTEYCILPLGSDAIHNCTPLIRSILLAGPKGSGKKALLHAICTEVGAVLFDLTPANIVGKYPGKSGLIMLIHLVLKVSRLLQPAVIFMGDAERPFMKKIPKTDRTDPKRLKKDLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIPRPDYGAMSHAWKTLLHDYSGGISN-LDTSAMAKISDGYTIGSIDACLKEVMTCKRKLQLRTQPLTNAELINVLCSRDPVYREEEEAFESWWSKTPLGRRR 800          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: CG16789 (gene:FBgn0037712 transcript:FBtr0082071)

HSP 1 Score: 481.485 bits (1238), Expect = 1.244e-157
Identity = 322/836 (38.52%), Postives = 489/836 (58.49%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQ--DILAYEEIPEKPEKSQLAAFQLLSTM-----------------YIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNE-AALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP---LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKR 2496
            MS   +N  WH++Q   +    + YE   +  E +       + ++                 Y++YI +  +LE  YD ++ PQKR++++K+LD  +GR++E+K+++VN++L E+ Y D+V+  L+LTP + E+ IP+YF+ ER++ L  R+K + +IL K    E  E  +      EAIRM+Q+HERARQGR+RA  M+EIR  ++K ++      +  D    AA+KIQ+MWRG  +RR  ++ K EE + +GM  P   +V   + K  +LQ   K    R   QA + +E+ +    +K++IR   G+ M E + D+IR W  +  D  GK PD+P E+ GGS++IF     E        +         K   K KD      +       ++ +EE  ++ + S  LP I     ++   W++++E    +Q    ++I  +K +EVE E R  VD++MRQE+  L+ +V     K++ K  +K ++  K  K KKEKDLTP              +RT ESLYEELV  GII+K    +L ++      LG       I   PS  D+R+++TE+CILP+GS  +    PLI+S+LL GP+G GK  L+H+ICTE+GA LFDLT +N+ GKYPGK GL ML+HLV KV RLLQP+++ +   E+ F KKIPKTD +DPKRLKKDLPKL+K I PEDR++ IGTS+ P++A+ K   S+Y + I IPRPDY + +  W+ L+  ++G ++N LD S++ K+SDGYT+  ++   ++V+T +R  QL  +PL   E I  +   DPVY EEEEAF+ W+ KTPLG++R
Sbjct:    1 MSSTYFNDIWHQSQHECELLSTIDYERQHQDVETTVATMNAAVGSVAADADAKALLQSSLYEFYLRYICLSNRLEDVYDNMIQPQKRQLVRKLLDACLGRVVELKHDLVNIDLMEFSYNDEVVERLRLTPMETELRIPRYFLRERQQELEFRKKTMHEILTKLGWLEEHELEETVTTEIEAIRMLQMHERARQGRLRAHFMKEIRILKEKGKSEERTEKERSDSGLLAAMKIQKMWRGHTARRITRRRKMEEMILIGMLPPPPAVVKERAEKLEKLQHNEK----RYQAQAFYGKEFEERQNALKEEIRAKHGASMKEDIADEIRAWVKDCYDKTGKLPDFPSEDQGGSLHIFSRPGTE-------SEHSRSSARSSKESRKTKDKSKSPARSGDLNVNENQDEEVSFQPAPSVCLPDIRAEIDLFNDTWRDKDETGVLSQAAYEDMIYSDKYQEVELEFRRAVDDVMRQEIELLQTAV----GKKVKKSSKKTRRSGKKSKKKKEKDLTP--------------DRTTESLYEELVTNGIIRKYPELRLKQF------LGDKALTARIGTNPSPGDIRQILTEYCILPLGSDAIHNCTPLIRSILLAGPKGSGKKALLHAICTEVGAVLFDLTPANIVGKYPGKSGLIMLIHLVLKVSRLLQPAVIFMGDAERPFMKKIPKTDRTDPKRLKKDLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIPRPDYGAMSHAWKTLLHDYSGGISN-LDTSAMAKISDGYTIGSIDACLKEVMTCKRKLQLRTQPLTNAELINVLCSRDPVYREEEEAFESWWSKTPLGRRR 800          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: CG14183 (gene:FBgn0036931 transcript:FBtr0074907)

HSP 1 Score: 121.709 bits (304), Expect = 5.687e-28
Identity = 86/314 (27.39%), Postives = 159/314 (50.64%), Query Frame = 1
Query: 1555 MNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQ--GGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIP--KTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARID--PVYTEEE---EAFKEWY 2469
            M  +RT+ESLY EL   GII++       E+  ++N++    R   G     P+  D++ ++ E  +L +G  +V    P  KS+LL GP   GK +L   I +EL A   +L+  N    Y     LK  LH++ KV +  QP+I+ +++  ++F KK+P    +++          K++K +K  D+I+++GTS+ P+ A        +QK++LIP+ DY +  ++W +L+  +          S+L ++   Y   D++   ++ L   R  +L  + L  NEF+ +    +  P++  +E   + F +W+
Sbjct:  543 MTGDRTLESLYNELKDAGIIEEIGHRDFDEFITDFNFVADDTRDEDGLTTLGPAKGDIKMVIQE-SMLGMGEFDV----PKPKSLLLIGPLNSGKRLLCEIIASELDAVFMNLSPENT---YKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLASKILKPLKKNDKIVLVGTSNMPWAAN-GGIKRAFQKVLLIPKCDYGTSFLLWLELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKETLNIDRKMRLKNEALDPNEFLEYFLSKNEPPIFPPDEKIMDKFNKWF 847          

HSP 2 Score: 95.5153 bits (236), Expect = 8.881e-20
Identity = 94/380 (24.74%), Postives = 170/380 (44.74%), Query Frame = 1
Query:  142 KPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERK-KILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRI-----------------RAKVMQEIRFQEDKDRNTHIK-TAQTMDF-------------------------------NEAALKIQRMWRGILSRRYV---KKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESD--RRIKQAMFEQEYNQALVTI----KDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEK--TPEELAEEL 1083
            +P + +  ++++ + +Y+ Y+++  KL   Y      QKR +++ +++    +++++K E+ +LE+SEY Y D  L   KLTP+D+        VV R  + L  R   +  I+A ++L    E+ + K     +P+ EA+++IQ HERAR+ R+                 R K+  +  F+ D+  +  +K T  + DF                               N AA KIQ  WRG  +R+ V   K+ KEE +   GM          K  +L+R  +  +      K  M +++ ++  + +    + ++ +     M E + D IR WF E  D  G F  YP+    G++ +  ++  TP E  E L
Sbjct:   31 EPPEEKAVSYKIYAELYVLYVELVNKLSFIYHNTFQVQKRALVRVLVENATQQLMQLKEELKDLEMSEYIYIDKALIARKLTPRDL--------VVWRSPQFLYRRPLDIQNIIADNRLYMNDEEKEEKAAQDWVPISEAVKLIQAHERARRARVYKSNIKYDKKKFLKVHQRKKINYKFTFKPDQAMSIPVKRTIFSADFLKADESCENLIKKDDVADTAIDDEEALSAIQNNAACKIQSCWRGYKTRKIVKIRKRFKEELY---GMK---------KIRKLKRPNQTANSIMEMYKNEMLKKKLDEDFINLINDERTRLLQFRSPWMMEDISDHIRAWFKEFYDATGNFHPYPDPVKQGTVLVVIDETMTPMEFQESL 390          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: Kat60 (gene:FBgn0040208 transcript:FBtr0078827)

HSP 1 Score: 80.4925 bits (197), Expect = 3.017e-15
Identity = 66/277 (23.83%), Postives = 140/277 (50.54%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDR----IMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQV-----------LTERRIAQLSKK----PLQANEFITHMARIDPVYTEEE-EAFKEWYKK 2475
            L D +RL+ E  +LP+  P+  +  + P  K VL+ GP G GKTML  ++ TE G   F+++++ L  KY G+   + ++ L+F++ R   PS + +D+ + +  ++  +++    +R+K +L   + G+   +     +MV+  ++ P+D + +      +K I IP P    R  +  K+ LR   +  + +D++ +     GY+ +D+  V ++            LT  +I QL+ +    P+   +F   M+R +   +  + + +++W ++
Sbjct:  298 LHDAKRLLEEAVVLPMLMPDYFKGIRRPW-KGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGES--EKMVRLLFEMARFYAPSTIFIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDID-EALRRRLEKRIYIPLPSDEGREALL-KINLREVKV-DDSVDLTYVANELKGYSGADITNVCREASMMSMRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVSRADLDKYEKWMRE 568          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: Kat60 (gene:FBgn0040208 transcript:FBtr0334909)

HSP 1 Score: 80.4925 bits (197), Expect = 3.187e-15
Identity = 66/277 (23.83%), Postives = 140/277 (50.54%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDR----IMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQV-----------LTERRIAQLSKK----PLQANEFITHMARIDPVYTEEE-EAFKEWYKK 2475
            L D +RL+ E  +LP+  P+  +  + P  K VL+ GP G GKTML  ++ TE G   F+++++ L  KY G+   + ++ L+F++ R   PS + +D+ + +  ++  +++    +R+K +L   + G+   +     +MV+  ++ P+D + +      +K I IP P    R  +  K+ LR   +  + +D++ +     GY+ +D+  V ++            LT  +I QL+ +    P+   +F   M+R +   +  + + +++W ++
Sbjct:  331 LHDAKRLLEEAVVLPMLMPDYFKGIRRPW-KGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGES--EKMVRLLFEMARFYAPSTIFIDEIDSLCSRRGSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDID-EALRRRLEKRIYIPLPSDEGREALL-KINLREVKV-DDSVDLTYVANELKGYSGADITNVCREASMMSMRRKIAGLTPEQIRQLATEEVDLPVSNKDFNEAMSRCNKSVSRADLDKYEKWMRE 601          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: zgc:153738 (zgc:153738 [Source:ZFIN;Acc:ZDB-GENE-061013-622])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 409/820 (49.88%), Postives = 561/820 (68.41%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKM-PLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MSH+TYN  W EA + L  +L  E  E P +PE+ ++  FQ ++T Y++Y+QIFR LE+ YDQ VHPQKR+VI++VLD V+GR++E+KNEMV  E SEYHY DDV+ DLKLTP+D+EIPIP+YF+ ER K+L +RE++   IL +  + E      M+M  L+  I++IQ+ ERARQGR+RAK M+EI    ++ +   I+T  +   ++AA+ IQ++WRG + R+  K+++EEE ++LGM+  L    S+ S     A   ++ RR +Q   E +Y +++ ++  ++RE EGS+M E+MKDQIRQWF+E RD  G FPDYPEEEDGGS  IF EKTPEELA             +++   K    K  + ++ K    +D+EEE G KM  S  LP +    + Y  VWKNRNE  NF+Q H+ E+IKE+KR+E+E EIR QVDELMRQEL N K++VDKEK+ ++    +K K  K  K+ KK+KDLT               +RT ESL+EELV Q ++KK    +L +Y G+Y+YLGTTLRQ  IEP PSLSDVR++V  + ILP+GS  V EK+PL+K++LL GP GVGK MLVH+IC E GANLFDL+  N+  KYPG++GL+M+LHLVFKV RL+QPS++ +   EKMF +K+PK +     +  K     + K I+ ED ++++GT+S P  A+LK  C  Y KIILIPRPDYASR ++W++LI ++ G +T  LD+SSL K+SDGYT   +  V + +LTERRI Q  K+PL A+EF++ +ARIDPV+ EEEEA K WY KTPLGKKRIKA
Sbjct:    1 MSHSTYNSLWSEAHEELSCLLPQELPEEPIRPERDRVVFFQRIATFYVRYVQIFRHLEEAYDQSVHPQKRRVIRQVLDSVMGRVLELKNEMVEKEFSEYHYMDDVIQDLKLTPEDLEIPIPRYFIRERNKVLQDRERMFAAILNQMDVMEKSGPPVMRMLTLERTIKVIQVAERARQGRLRAKFMREIHRDSERQKRADIETVSS---DQAAVCIQKVWRGFMQRKITKRLREEEMIFLGMA--LDPKLSYPSQTELIAQNNKALRRTRQEEHEDDYQKSIGSVVHQLREVEGSEMKETMKDQIRQWFIECRDATGSFPDYPEEEDGGSALIFAEKTPEELA-------EELAAKEEEDANKNPKGKEDTKEKAKKGKIEDEEEEPGLKMLPSACLPDLERSHKTYSEVWKNRNESKNFSQRHELELIKEDKRKEIEVEIRKQVDELMRQELANWKLAVDKEKSGKVKGAAKKKKASKSAKRKKKDKDLT--------------ADRTTESLFEELVEQELLKKPENVKLKDYLGDYSYLGTTLRQSDIEPMPSLSDVRQVVALYAILPLGSQAVHEKSPLVKTILLVGPSGVGKKMLVHAICQETGANLFDLSPLNVAKKYPGRNGLQMMLHLVFKVARLMQPSVIWIGDAEKMFYRKVPKEEKELDPKRLKKDLPKILKSIRGEDCVLIVGTTSDPHSADLKSLCKFYNKIILIPRPDYASRYVMWKELIKKNGGEVTGDLDLSSLAKISDGYTQGHMVQVVRSILTERRIQQFPKRPLTASEFVSPLARIDPVFQEEEEALKNWYAKTPLGKKRIKA 794          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: iqca1 (IQ motif containing with AAA domain 1 [Source:ZFIN;Acc:ZDB-GENE-050208-768])

HSP 1 Score: 390.963 bits (1003), Expect = 6.614e-123
Identity = 222/433 (51.27%), Postives = 300/433 (69.28%), Query Frame = 1
Query: 1216 MSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKAQEA 2514
            M+ SNFLP + +G+++Y+ VW+NR+E+ NF Q  D ++++EEKR EVE E+R+QVDELMRQEL+NLK+ VD++K K+  K K+  KK KK  +   +K               +  +RTIESLYEELV++GII + +  +LS+Y GEY+YLGTTLRQ  IEP PSLSDVR+L+  + ILP+GS  V E+ PLI+++LLTGP+GVGK MLVH++CTE GANLF+L+ S L GKYPGK GL++LLH+VFK    ++P         K  KK +PK                +K IK EDR++V+GTS  PFDA++KPFC +Y+KIILIPRPDYASR  +W++L+  H  +L   LD+SSL K++DGYT   +    Q +L   R+   +K+PL A EFI  +AR DPVY EEEE+FK WY +TPLGKKR +A +A
Sbjct:  390 MTHSNFLPTVFKGAKLYKEVWQNRDEQQNFLQRFDAQLVREEKRLEVEVELRVQVDELMRQELKNLKLVVDRDKGKKKKKVKKSSKKKKKKGRKTGKKKKK--------KEKDLTADRTIESLYEELVLEGIIIRPMNVKLSDYIGEYSYLGTTLRQADIEPMPSLSDVRQLIALYGILPLGSQCVHERGPLIRALLLTGPQGVGKKMLVHALCTETGANLFNLSPSTLAGKYPGKSGLQLLLHMVFK----MEP---------KRLKKTLPKI---------------LKSIKAEDRVLVVGTSRRPFDADIKPFCKVYKKIILIPRPDYASRFTLWKELLQAHGALLDPKLDLSSLAKVTDGYTQGHILQAIQTILIPHRLELQAKRPLTAVEFIPPLARQDPVYKEEEESFKAWYSRTPLGKKRARAAKA 786          

HSP 2 Score: 321.627 bits (823), Expect = 9.302e-97
Identity = 164/342 (47.95%), Postives = 235/342 (68.71%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILA--YEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKE--KSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEEL 1071
            MS ++Y +    AQ  L+D+L   Y  +  +P+K +L  FQ L+T +++Y++IFR LE+ YDQIVHPQKR+V+ +VLDGV+GR++E+KNEMV LE SE+HYFDD+L D K+TP+D+E+PIP+YFV E+ + L EREK+L  +LAK    E K   +  + M ++ A+ ++Q+ ERARQGR+RA  M+ IR +E +    H+ ++  +D ++AA  IQ++WRG   RR V K   EE ++LGM  P    T     QL RA ++E  R I Q   E EY  ALV IK+ +R  +G+D+ ES+++QIRQWFLE RD  GKFPD+P  EDGGS +IF +KTPE++
Sbjct:    1 MSQSSYGRMLDAAQGALEDLLEDEYPTLELRPQKDRLQVFQTLATFFLRYMKIFRALEEVYDQIVHPQKRRVVHQVLDGVMGRLVELKNEMVELEHSEFHYFDDLLQDFKMTPEDLEVPIPRYFVREKMRALKEREKMLAHVLAKEGRPEHKSVNRPVLSMSMERAVWLLQVSERARQGRLRAHFMKTIRLEEQR---RHLGSS-MLDPDQAATCIQKVWRGYRDRRRVNKECLEEMIFLGM-IPAQQQTP-SPAQL-RAQQVERRRHIIQEEHEAEYQTALVNIKESVRAVDGADIKESLQEQIRQWFLECRDASGKFPDFPSPEDGGSASIFAQKTPEQV 335          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: zgc:153738 (zgc:153738 [Source:ZFIN;Acc:ZDB-GENE-061013-622])

HSP 1 Score: 338.191 bits (866), Expect = 1.618e-108
Identity = 167/341 (48.97%), Postives = 239/341 (70.09%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKM-PLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEEL 1071
            MSH+TYN  W EA + L  +L  E  E P +PE+ ++  FQ ++T Y++Y+QIFR LE+ YDQ VHPQKR+VI++VLD V+GR++E+KNEMV  E SEYHY DDV+ DLKLTP+D+EIPIP+YF+ ER K+L +RE++   IL +  + E      M+M  L+  I++IQ+ ERARQGR+RAK M+EI    ++ +   I+T  +   ++AA+ IQ++WRG + R+  K+++EEE ++LGM+  L    S+ S     A   ++ RR +Q   E +Y +++ ++  ++RE EGS+M E+MKDQIRQWF+E RD  G FPDYPEEEDGGS  IF EKTPEE+
Sbjct:    1 MSHSTYNSLWSEAHEELSCLLPQELPEEPIRPERDRVVFFQRIATFYVRYVQIFRHLEEAYDQSVHPQKRRVIRQVLDSVMGRVLELKNEMVEKEFSEYHYMDDVIQDLKLTPEDLEIPIPRYFIRERNKVLQDRERMFAAILNQMDVMEKSGPPVMRMLTLERTIKVIQVAERARQGRLRAKFMREIHRDSERQKRADIETVSS---DQAAVCIQKVWRGFMQRKITKRLREEEMIFLGMA--LDPKLSYPSQTELIAQNNKALRRTRQEEHEDDYQKSIGSVVHQLREVEGSEMKETMKDQIRQWFIECRDATGSFPDYPEEEDGGSALIFAEKTPEEV 336          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: iqca1 (IQ motif containing with AAA domain 1 [Source:ZFIN;Acc:ZDB-GENE-050208-768])

HSP 1 Score: 321.627 bits (823), Expect = 1.593e-101
Identity = 164/342 (47.95%), Postives = 235/342 (68.71%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILA--YEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKE--KSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEEL 1071
            MS ++Y +    AQ  L+D+L   Y  +  +P+K +L  FQ L+T +++Y++IFR LE+ YDQIVHPQKR+V+ +VLDGV+GR++E+KNEMV LE SE+HYFDD+L D K+TP+D+E+PIP+YFV E+ + L EREK+L  +LAK    E K   +  + M ++ A+ ++Q+ ERARQGR+RA  M+ IR +E +    H+ ++  +D ++AA  IQ++WRG   RR V K   EE ++LGM  P    T     QL RA ++E  R I Q   E EY  ALV IK+ +R  +G+D+ ES+++QIRQWFLE RD  GKFPD+P  EDGGS +IF +KTPE++
Sbjct:    1 MSQSSYGRMLDAAQGALEDLLEDEYPTLELRPQKDRLQVFQTLATFFLRYMKIFRALEEVYDQIVHPQKRRVVHQVLDGVMGRLVELKNEMVELEHSEFHYFDDLLQDFKMTPEDLEVPIPRYFVREKMRALKEREKMLAHVLAKEGRPEHKSVNRPVLSMSMERAVWLLQVSERARQGRLRAHFMKTIRLEEQR---RHLGSS-MLDPDQAATCIQKVWRGYRDRRRVNKECLEEMIFLGM-IPAQQQTP-SPAQL-RAQQVERRRHIIQEEHEAEYQTALVNIKESVRAVDGADIKESLQEQIRQWFLECRDASGKFPDFPSPEDGGSASIFAQKTPEQV 335          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: iqca1 (IQ motif containing with AAA domain 1 [Source:ZFIN;Acc:ZDB-GENE-050208-768])

HSP 1 Score: 313.923 bits (803), Expect = 1.078e-98
Identity = 161/330 (48.79%), Postives = 229/330 (69.39%), Query Frame = 1
Query:   94 AQQNLQDILA--YEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKE--KSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEEL 1071
            AQ  L+D+L   Y  +  +P+K +L  FQ L+T +++Y++IFR LE+ YDQIVHPQKR+V+ +VLDGV+GR++E+KNEMV LE SE+HYFDD+L D K+TP+D+E+PIP+YFV E+ + L EREK+L  +LAK    E K   +  + M ++ A+ ++Q+ ERARQGR+RA  M+ IR +E +    H+ ++  +D ++AA  IQ++WRG   RR V K   EE ++LGM  P    T     QL RA ++E  R I Q   E EY  ALV IK+ +R  +G+D+ ES+++QIRQWFLE RD  GKFPD+P  EDGGS +IF +KTPE++
Sbjct:    5 AQGALEDLLEDEYPTLELRPQKDRLQVFQTLATFFLRYMKIFRALEEVYDQIVHPQKRRVVHQVLDGVMGRLVELKNEMVELEHSEFHYFDDLLQDFKMTPEDLEVPIPRYFVREKMRALKEREKMLAHVLAKEGRPEHKSVNRPVLSMSMERAVWLLQVSERARQGRLRAHFMKTIRLEEQR---RHLGSS-MLDPDQAATCIQKVWRGYRDRRRVNKECLEEMIFLGM-IPAQQQTP-SPAQL-RAQQVERRRHIIQEEHEAEYQTALVNIKESVRTVDGADIKESLQEQIRQWFLECRDASGKFPDFPSPEDGGSASIFAQKTPEQV 327          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:NCBI gene;Acc:100145101])

HSP 1 Score: 354.369 bits (908), Expect = 8.379e-110
Identity = 179/341 (52.49%), Postives = 242/341 (70.97%), Query Frame = 1
Query:   61 SHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAE 1077
            S   YNK W EAQQ L  +L  E  ++P KPEK +LAA Q LST+Y++Y+QIFR LE  YDQ+ HPQKR+V++ VLDGV+GRI+E+KNE+V LE+SE+HYFDD+L DLK+ P+ +EIPIPKYF+ E+ K+L ERE++L  IL ++  G    +   +M LDEAIR+IQ+ ERARQGR+RAK M+EI  +E ++R   +   + +D   AAL IQ++WRG + R+  K+ +E E ++LGM  P   N S  S+    A K ES+R   Q   E EY  ALV IKD IRETE  DM E+++DQIRQWF+E R   GKFPD+P+E+DGGS  IF +KTPE++++
Sbjct:    2 SFRFYNKMWGEAQQALCHLLQQEMPDVPPKPEKDRLAAAQFLSTLYVRYLQIFRSLELAYDQMTHPQKRRVVRVVLDGVMGRILELKNELVELEISEFHYFDDILQDLKMGPECLEIPIPKYFIKEKLKVLKERERILSDILQRT--GTPDSEMVRQMSLDEAIRVIQVSERARQGRLRAKFMKEIHLEEKRERLAKLHGEKALDPEVAALLIQKVWRGYIQRKRTKQHRETEMIFLGMMPP--PNFSKVSMAEVLARKTESERCQLQEQHEAEYQHALVQIKDSIRETESLDMKETLQDQIRQWFIECRHATGKFPDFPDEDDGGSNVIFAQKTPEQVSQ 338          

HSP 2 Score: 344.354 bits (882), Expect = 6.087e-106
Identity = 171/323 (52.94%), Postives = 231/323 (71.52%), Query Frame = 1
Query: 1561 INRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIG--SPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGI--LTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKAQEA 2514
            I RTI+SLYEELV +G++ K    QLS+Y GEY+YLGTTLRQ  IEP PSLSDV++L+  + ILP+G     V EKAP +K++LL GP GVGK MLV+SIC E GANLF+L+  N+ GKYPGK GL+M+LH+V KV R LQPS++ +D  EK F KK+PKT+     +  K     + K +K EDRI+V+GTS  PF+A++K FC +Y+KIILIPRPDYASR +   K +  ++G    +  +++S+L K++DG+T + +    + VL +RR+ QL +KPL A EF+  + R +PVY EEEEAFK WY KTPLG+KR KA+ +
Sbjct:  392 ICRTIDSLYEELVTEGLLIKPKPVQLSDYLGEYSYLGTTLRQADIEPMPSLSDVKQLLVLYGILPLGKSCESVHEKAPSVKTLLLAGPSGVGKKMLVNSICNETGANLFNLSPENIAGKYPGKSGLQMMLHMVLKVARQLQPSVIWIDDAEKTFYKKVPKTEKQLDPKRLKKDLPKILKSLKSEDRILVVGTSQRPFEADIKSFCKVYKKIILIPRPDYASR-LGKSKAMEFYSGTDSASASVNLSALAKITDGFTPAHIVQAVESVLNDRRVGQLPRKPLTAAEFLNSLCRQEPVYKEEEEAFKGWYAKTPLGRKRSKAKAS 713          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: IQCA1 (IQ motif containing with AAA domain 1 [Source:NCBI gene;Acc:100145101])

HSP 1 Score: 353.214 bits (905), Expect = 7.619e-109
Identity = 172/331 (51.96%), Postives = 233/331 (70.39%), Query Frame = 1
Query: 1561 INRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIG--SPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASR----------NIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKAQEA 2514
            I RTI+SLYEELV +G++ K    QLS+Y GEY+YLGTTLRQ  IEP PSLSDV++L+  + ILP+G     V EKAP +K++LL GP GVGK MLV+SIC E GANLF+L+  N+ GKYPGK GL+M+LH+V KV R LQPS++ +D  EK F KK+PKT+     +  K     + K +K EDRI+V+GTS  PF+A++K FC +Y+KIILIPRPDYASR          +++W++LI       +  +++S+L K++DG+T + +    + VL +RR+ QL +KPL A EF+  + R +PVY EEEEAFK WY KTPLG+KR KA+ +
Sbjct:  429 ICRTIDSLYEELVTEGLLIKPKPVQLSDYLGEYSYLGTTLRQADIEPMPSLSDVKQLLVLYGILPLGKSCESVHEKAPSVKTLLLAGPSGVGKKMLVNSICNETGANLFNLSPENIAGKYPGKSGLQMMLHMVLKVARQLQPSVIWIDDAEKTFYKKVPKTEKQLDPKRLKKDLPKILKSLKSEDRILVVGTSQRPFEADIKSFCKVYKKIILIPRPDYASRLGKSKAMEFYSVLWKQLITVRADSASASVNLSALAKITDGFTPAHIVQAVESVLNDRRVGQLPRKPLTAAEFLNSLCRQEPVYKEEEEAFKGWYAKTPLGRKRSKAKAS 759          

HSP 2 Score: 346.665 bits (888), Expect = 2.283e-106
Identity = 175/334 (52.40%), Postives = 240/334 (71.86%), Query Frame = 1
Query:   85 WHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIK-EKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAE 1077
            W EAQQ L  +L  E  ++P KPEK +LAA Q LST+Y++Y+QIFR LE  YDQ+ HPQKR+V++ VLDGV+GRI+E+KNE+V LE+SE+HYFDD+L DLK+ P+ +EIPIPKYF+ E+ K+L ERE++L  IL ++   + +  K+  +M LDEAIR+IQ+ ERARQGR+RAK M+EI  +E ++R   +   + +D   AAL IQ++WRG + R+  K+ +E E ++LGM  P   N S  S+    A K ES+R   Q   E EY  ALV IKD IRETE  DM E+++DQIRQWF+E R   GKFPD+P+E+DGGS  IF +KTPE++++
Sbjct:    2 WGEAQQALCHLLQQEMPDVPPKPEKDRLAAAQFLSTLYVRYLQIFRSLELAYDQMTHPQKRRVVRVVLDGVMGRILELKNELVELEISEFHYFDDILQDLKMGPECLEIPIPKYFIKEKLKVLKERERILSDILQRTGTPDSEMAKAVKQMSLDEAIRVIQVSERARQGRLRAKFMKEIHLEEKRERLAKLHGEKALDPEVAALLIQKVWRGYIQRKRTKQHRETEMIFLGMMPP--PNFSKVSMAEVLARKTESERCQLQEQHEAEYQHALVQIKDSIRETESLDMKETLQDQIRQWFIECRHATGKFPDFPDEDDGGSNVIFAQKTPEQVSQ 333          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: FIGN (fidgetin, microtubule severing factor [Source:NCBI gene;Acc:100488151])

HSP 1 Score: 82.8037 bits (203), Expect = 1.460e-15
Identity = 76/270 (28.15%), Postives = 136/270 (50.37%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVREKA-----PLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI-KPEDRIMVIGTSSAP--FDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIA----QLSK------KPLQANEFITHMARIDPVYTEEE-EAFKEWYK 2472
            V+  + E  + P+    +R  A      L +S+LL GPRG GKT+L   I ++LGA  F ++ASNL  K+   +G K ++H  F V R  QPS++ V   + +   ++ +      +   + L +L   +   ED+I+VI  +S P   D  L+ +   + K +LIP PD  +R+ I  +L+ +HN  L N  +++ L + ++G++  D+  + Q+ +     A     LS       +P+   +F     +I P  +++E + + EW K
Sbjct:  489 VKAFIKEEVLWPV----IRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKISASNLVTKWI-TEGEK-IVHASFLVARCRQPSVIFVSDIDMLLSSQVNEEHSPISRMRTEFLMQLDTVLSSAEDQIVVICATSKPEQIDESLRRY---FMKRLLIPLPDSTARHQIIIQLLSQHNYCL-NDKEVALLVQRTEGFSGLDVARLCQEAVVGPLHAIPPSDLSAIMPNQLRPVTYQDFENVFCKIQPSISQKELDTYIEWNK 748          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: FIGN (fidgetin, microtubule severing factor [Source:NCBI gene;Acc:100488151])

HSP 1 Score: 82.4185 bits (202), Expect = 1.598e-15
Identity = 76/270 (28.15%), Postives = 136/270 (50.37%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVREKA-----PLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI-KPEDRIMVIGTSSAP--FDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIA----QLSK------KPLQANEFITHMARIDPVYTEEE-EAFKEWYK 2472
            V+  + E  + P+    +R  A      L +S+LL GPRG GKT+L   I ++LGA  F ++ASNL  K+   +G K ++H  F V R  QPS++ V   + +   ++ +      +   + L +L   +   ED+I+VI  +S P   D  L+ +   + K +LIP PD  +R+ I  +L+ +HN  L N  +++ L + ++G++  D+  + Q+ +     A     LS       +P+   +F     +I P  +++E + + EW K
Sbjct:  518 VKAFIKEEVLWPV----IRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKISASNLVTKWI-TEGEK-IVHASFLVARCRQPSVIFVSDIDMLLSSQVNEEHSPISRMRTEFLMQLDTVLSSAEDQIVVICATSKPEQIDESLRRY---FMKRLLIPLPDSTARHQIIIQLLSQHNYCL-NDKEVALLVQRTEGFSGLDVARLCQEAVVGPLHAIPPSDLSAIMPNQLRPVTYQDFENVFCKIQPSISQKELDTYIEWNK 777          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: FIGN (fidgetin, microtubule severing factor [Source:NCBI gene;Acc:100488151])

HSP 1 Score: 82.4185 bits (202), Expect = 1.611e-15
Identity = 76/270 (28.15%), Postives = 136/270 (50.37%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVREKA-----PLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI-KPEDRIMVIGTSSAP--FDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIA----QLSK------KPLQANEFITHMARIDPVYTEEE-EAFKEWYK 2472
            V+  + E  + P+    +R  A      L +S+LL GPRG GKT+L   I ++LGA  F ++ASNL  K+   +G K ++H  F V R  QPS++ V   + +   ++ +      +   + L +L   +   ED+I+VI  +S P   D  L+ +   + K +LIP PD  +R+ I  +L+ +HN  L N  +++ L + ++G++  D+  + Q+ +     A     LS       +P+   +F     +I P  +++E + + EW K
Sbjct:  501 VKAFIKEEVLWPV----IRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKISASNLVTKWI-TEGEK-IVHASFLVARCRQPSVIFVSDIDMLLSSQVNEEHSPISRMRTEFLMQLDTVLSSAEDQIVVICATSKPEQIDESLRRY---FMKRLLIPLPDSTARHQIIIQLLSQHNYCL-NDKEVALLVQRTEGFSGLDVARLCQEAVVGPLHAIPPSDLSAIMPNQLRPVTYQDFENVFCKIQPSISQKELDTYIEWNK 760          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Iqca (IQ motif containing with AAA domain [Source:MGI Symbol;Acc:MGI:1922168])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 427/821 (52.01%), Postives = 599/821 (72.96%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE-EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMS-TPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXX----XXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRI 2499
            MS+  YNK WH+ Q+ L  +L  E +   +P+ +++  FQ+L+T YI Y+QIFR +E  YDQIVHPQKR +I+KVLDGV+GRI+E+KNEMV LE++E+HYFDD+L DLKL+PQ +++PIP+YF+ ER +++  REK+L +IL +  L    + +   + L+EA+++IQI ERARQGR+RA  M++I  QE + +   +   + +D   AAL+IQ++WRG    +   K +EEE V+LGM  +PL    S   VQ ++ T +  + ++K    EQ+Y +ALV IK+ ++  EG D+ E ++DQIRQWF+E R++ G FPDYP EEDGGS  IF  KTPE++  ++   +  E+K KKK K + K++K K GK++K + ++  +E+E WKMS S FL  + EG+ +Y+ +W N++E  NF Q +DPE+IKEEKR+E+E EIR+QVDELMRQEL+NLK++V++E      ++  KKK KG+KG++GK+GKKEKDLT               +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + ILP+GS EV E+APL+KS+LL GP GVGK MLVH+ICTE GANLF+L+A N+ GKYPGK GL+M++HLVFKV R LQPS++ +   EK F KK+P+ +     KRLK+ LPKL+K +KP+DRI+++GT+  PFDAEL+PFC +YQKIIL+PRPDYASR ++W+++ILR+ G LTN L+IS L+K++DG+T   +  V + VLTERR+ Q + KPL A EFIT M  ++PVY EEEE+FK WY KTPLGKKR+
Sbjct:    1 MSNLMYNKMWHQTQEALNSLLDKEFQKMSEPQANKVLVFQMLATFYINYVQIFRNMENVYDQIVHPQKRMLIRKVLDGVMGRILELKNEMVELEMTEFHYFDDILQDLKLSPQQLDVPIPRYFLKERLEVIKGREKILARILTECGLNLPVKYAAKSIALEEAVKLIQIAERARQGRLRALFMKQIFLQECRAKEMKLLGHRLLDTKLAALQIQKVWRGFHQCKKTVKEREEEMVFLGMKPSPLFNEVSDAIVQSKQVTNLRDEVQLKH---EQDYQEALVNIKEDLKMLEGPDIKEHLQDQIRQWFIECRNLTGTFPDYPNEEDGGSALIFSNKTPEQVMGDIIATQEEEEKLKKKKKKEDKENKGKKGKKEKKEKKEKKDEDEEWKMSPSLFLQLMEEGNSLYKDIWLNKDESWNFPQDYDPELIKEEKRKELEMEIRVQVDELMRQELKNLKLAVNREMEIPPRQKKGKKKNKGRKGRRGKRGKKEKDLTA--------------DRTIESLYQELVEKGLLIQALKVNLSDYIGEYSYLGTTLRQVAIEPMPSLLDVRQLITLYGILPLGSAEVHERAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSALNIAGKYPGKTGLQMMIHLVFKVARQLQPSVVWIQDTEKTFYKKVPQAEKRFEPKRLKRYLPKLLKLLKPDDRILIVGTTHRPFDAELQPFCRVYQKIILVPRPDYASRYVLWKEIILRNGGKLTNSLNISCLSKVTDGFTQGQIVQVIKDVLTERRLRQQAHKPLTAIEFITMMTNMNPVYREEEESFKNWYAKTPLGKKRV 804          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Iqca (IQ motif containing with AAA domain [Source:MGI Symbol;Acc:MGI:1922168])

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 416/836 (49.76%), Postives = 587/836 (70.22%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE-EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMS-TPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPE-----RFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASR-----NIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRI 2499
            MS+  YNK WH+ Q+ L  +L  E +   +P+ +++  FQ+L+T YI Y+QIFR +E  YDQIVHPQKR +I+KVLDGV+GRI+E+KNEMV LE++E+HYFDD+L DLKL+PQ +++PIP+YF+ ER +++  REK+L +IL +  L    + +   + L+EA+++IQI ERARQGR+RA  M++I  QE + +   +   + +D   AAL+IQ++WRG    +   K +EEE V+LGM  +PL    S   VQ ++ T +  + ++K    EQ+Y +ALV IK+ ++  EG D+ E ++DQIRQWF+E R++ G FPDYP EEDGGS  IF  KTPE++  ++   +  E+K KKK K + K++K K GK++K + +            +E+E WKMS S FL  + EG+ +Y+ +W N++E  NF Q +DPE+IKEEKR+E+E EIR+QVDELMRQEL+NLK++V++E      +KK K ++     +               R +   +Y + N N TIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + ILP+GS EV E+APL+KS+LL GP GVGK MLVH+ICTE GANLF+L+A N+ GKYPGK GL+M++HLVFKV R LQPS++ +   EK F KK+P+ +     KRLK+ LPKL+K +KP+DRI+++GT+  PFDAEL+PFC +YQKIIL+PRPDYASR      ++W+++ILR+ G LTN L+IS L+K++DG+T   +  V + VLTERR+ Q + KPL A EFIT M  ++PVY EEEE+FK WY KTPLGKKR+
Sbjct:    1 MSNLMYNKMWHQTQEALNSLLDKEFQKMSEPQANKVLVFQMLATFYINYVQIFRNMENVYDQIVHPQKRMLIRKVLDGVMGRILELKNEMVELEMTEFHYFDDILQDLKLSPQQLDVPIPRYFLKERLEVIKGREKILARILTECGLNLPVKYAAKSIALEEAVKLIQIAERARQGRLRALFMKQIFLQECRAKEMKLLGHRLLDTKLAALQIQKVWRGFHQCKKTVKEREEEMVFLGMKPSPLFNEVSDAIVQSKQVTNLRDEVQLKH---EQDYQEALVNIKEDLKMLEGPDIKEHLQDQIRQWFIECRNLTGTFPDYPNEEDGGSALIFSNKTPEQVMGDIIATQEEEEKLKKKKKKEDKENKGKKGKKEKKEKKEKKVSLKEKAMKDEDEEWKMSPSLFLQLMEEGNSLYKDIWLNKDESWNFPQDYDPELIKEEKRKELEMEIRVQVDELMRQELKNLKLAVNREMEIPPRQKKGKKEQTIVFPREVFGNPRVALVSLHIRALWGISYLSFN-NGTIESLYQELVEKGLLIQALKVNLSDYIGEYSYLGTTLRQVAIEPMPSLLDVRQLITLYGILPLGSAEVHERAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSALNIAGKYPGKTGLQMMIHLVFKVARQLQPSVVWIQDTEKTFYKKVPQAEKRFEPKRLKRYLPKLLKLLKPDDRILIVGTTHRPFDAELQPFCRVYQKIILVPRPDYASRYGKFHEVLWKEIILRNGGKLTNSLNISCLSKVTDGFTQGQIVQVIKDVLTERRLRQQAHKPLTAIEFITMMTNMNPVYREEEESFKNWYAKTPLGKKRV 832          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Iqca1l (IQ motif containing with AAA domain 1 like [Source:MGI Symbol;Acc:MGI:3045319])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 358/825 (43.39%), Postives = 540/825 (65.45%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPEKS-QLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGM-STPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSE---SNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLI-LRHNGI-LTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            MS  TY + W  +   L+++L  E    +P  S +  +FQ  +S +Y+ Y+ + R+    YDQ+V PQKR++++++LDGV GR++E+K+E+V ++L E H  D VL DLKLTP D+E+PIPKYF +E+   +  R+++L  IL  ++L  +  + +++ +    A+ ++Q  ERARQGR+RA  M+EIR +E++DR       Q    ++ A+ IQ++W+G L R+ +++ +  E  ++GM  +P   N + +   L +A   E  RR++Q   E+E+ +A+    + + ETEG DM E MKDQIRQWF+E   + G+FPDYP+E  GGS  IF +KTPE++  +L  +     K  ++ K K K+ + +  ++KK K +++  ++E   M     S  +P I  G + Y  VWK+R +  + +Q  D E ++EEKR++VE EIR+QVDELMRQEL+NL+++VD  + +    K  K K GKK  K KKEKDLTP              +R+++SL+EELVI G+IKK+    LS+Y G+  YLG+TL      P PSL D+R+ +  + +L +GS ++   APL++S+LL GP G+GK MLV ++CTE GANLFDL+  NL GKYPGK+G ++L+H+VFKV RLLQPS++ +   EK F KK+PK + +   KR+KKDL +  K + P DR+M+IGT+  P  AE+K  C  Y++I+ IPRPDYASR ++W+++I  +  G+ LT+ LD+S+L ++SDGYT S +    Q VLTERR+ QL KKPL A+EF+ H+AR+DPVY EEEE+ KEW+ KTPLGKK +K
Sbjct:    1 MSEGTYQRLWEASHVTLEEVLEKEPSVLEPVPSRERQSFQYRISVLYLYYLGLLRRFNLAYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQDLKLTPADLEVPIPKYFQLEQSSAVKARQQMLADIL--NRLEPLVSQENLRGLSRTAALILVQSAERARQGRLRATFMREIRKEEERDRRIWENGQQKFSRDQGAIVIQKVWKGYLQRKRIEQDRRVEMEFIGMLPSP---NQTARLNTLNQAFLGEESRRMRQVEKEEEFQEAIGKTYESLTETEGPDMKERMKDQIRQWFIECHALTGRFPDYPDEASGGSYLIFADKTPEQVRLDLEAQAQESRKKDQEKKEKNKEKEKEKKEKKKKKVKEEKVKKEPEVMFRVLPSKSIPVINAGHEEYTSVWKSRYDNKHPSQNFDSETLREEKRKQVEMEIRVQVDELMRQELKNLRLAVD--REETRPLKSPKKKGGKKSGKKKKEKDLTP--------------DRSVDSLFEELVIIGLIKKSALVTLSDYIGDCLYLGSTLTLANKMPMPSLFDIRQNMALYGVLRLGSHDIHTMAPLVRSILLVGPSGMGKKMLVQAVCTETGANLFDLSPDNLMGKYPGKNGAQLLVHIVFKVARLLQPSVIWIGNTEKTFYKKVPKEERTMDPKRIKKDLMRATKQLSPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVLWKRMIESQGRGVQLTSSLDVSALARVSDGYTPSHILQSIQSVLTERRLLQLIKKPLVASEFVGHLARLDPVYREEEESLKEWFFKTPLGKKNMK 804          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Iqca1l (IQ motif containing with AAA domain 1 like [Source:MGI Symbol;Acc:MGI:3045319])

HSP 1 Score: 135.191 bits (339), Expect = 3.058e-35
Identity = 82/221 (37.10%), Postives = 138/221 (62.44%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDIL-----AYEEIPEKPEKSQLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQR 699
            MS  TY + W  +   L+++L       E +P +  +S    FQ  +S +Y+ Y+ + R+    YDQ+V PQKR++++++LDGV GR++E+K+E+V ++L E H  D VL DLKLTP D+E+PIPKYF +E+   +  R+++L  IL  ++L  +  + +++ +    A+ ++Q  ERARQGR+RA  M+EIR +E++DR       Q    ++ A+ IQ+
Sbjct:    1 MSEGTYQRLWEASHVTLEEVLEKEPSVLEPVPSRERQS----FQYRISVLYLYYLGLLRRFNLAYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQDLKLTPADLEVPIPKYFQLEQSSAVKARQQMLADIL--NRLEPLVSQENLRGLSRTAALILVQSAERARQGRLRATFMREIRKEEERDRRIWENGQQKFSRDQGAIVIQK 215          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Iqca (IQ motif containing with AAA domain [Source:MGI Symbol;Acc:MGI:1922168])

HSP 1 Score: 103.99 bits (258), Expect = 2.540e-26
Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
Query: 1762 SPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFK 1959
            S EV E+APL+KS+LL GP GVGK MLVH+ICTE GANLF+L+A N+ GKYPGK GL+M++HLVFK
Sbjct:    2 SAEVHERAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSALNIAGKYPGKTGLQMMIHLVFK 67          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86XH1|DRC11_HUMAN (Dynein regulatory complex protein 11 OS=Homo sapiens OX=9606 GN=IQCA1 PE=2 SV=1)

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 412/826 (49.88%), Postives = 587/826 (71.07%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEK---PEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-----MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTP-LVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MS+  YNK WH+ Q+ L  +L  E  P+K   P+++Q+  FQ L+T Y+KY+QIFR LE  YDQ VHPQKR +I+KVLDGV+GRI+E+KNEMV LEL+E+HYFDD+L DLKL PQ ++IPIPKYF+ E+ +++  REK+L QILA S +    + SDMK     +P DEA+++IQI ERARQGR+RA  M++I  QE + + + +   +  D   AAL+IQ++WR    R+  +K++EEE ++LGM+ P L    S   +Q ++  ++ ++ +IK    E++Y +ALVTIK+ ++  EG D+ E+++DQIR WF+E R++ G FPDYP+ E+GGS  IF +KT +++ E++   +  E+KNKKK K K K  K    ++K  K +  +E+E+   MS S FLP + EG   Y+ +W  ++E  NF+Q +DPE+IKEEKR+E+++EIRIQVDELMRQEL+NLK++VD+E+ + +   K+K KKGKKGKK +K+                +  +RTIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + I P+GS  V EKAPL+KS+LL GP GVGK MLVH+ICTE GANLF+L++SN+ GKYPGK+GL+M+LH VFKV R LQPS++ ++  EK F KK+P  +  +  +  K     + K +KP+DRI+++GT+  PFDAEL+ FC +YQKIIL+PRPDYASR ++W+++I R+ G+LT+ L++S L K++DG+T   +  V + VLT++RI +   KPL A EFIT +  ++PVY EEEE+FK WY KTPLGKKR  A
Sbjct:    1 MSNAMYNKMWHQTQEALGALLDKE--PQKMIEPQRNQVFIFQTLATFYVKYVQIFRNLENVYDQFVHPQKRILIRKVLDGVMGRILELKNEMVELELTEFHYFDDILQDLKLAPQQLDIPIPKYFLKEKLEVIKGREKILAQILADSGI----DTSDMKYPVKSIPFDEAVKLIQIAERARQGRLRALFMKQIYLQEYRAKQSKMLGKKVTDTWAAALRIQKVWRRFHQRKETEKLREEEMIFLGMNPPPLFNEVSATVIQAEKVDRLRNEVQIKH---EEDYREALVTIKNDLKLIEGVDIKENLQDQIRHWFIECRNLTGTFPDYPDVEEGGSAIIFSDKTIQQVIEDIIANQEEEEKNKKKKKKKEKQPKKAKKQKKGTKEKNKEEDEKWK-MSPSLFLPAMKEGCNAYKEIWMKKDESWNFSQDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKKGKKGKKKEKKAKKD----------KDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSYLGTTLRQVSIEPMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSSSNIAGKYPGKNGLQMMLHAVFKVARQLQPSVVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIRRQIHKPLTAVEFITAITSMNPVYKEEEESFKNWYAKTPLGKKRALA 806          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CUL5|DRC11_MOUSE (Dynein regulatory complex protein 11 OS=Mus musculus OX=10090 GN=Iqca1 PE=2 SV=2)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 416/836 (49.76%), Postives = 587/836 (70.22%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE-EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMS-TPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPE-----RFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASR-----NIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRI 2499
            MS+  YNK WH+ Q+ L  +L  E +   +P+ +++  FQ+L+T YI Y+QIFR +E  YDQIVHPQKR +I+KVLDGV+GRI+E+KNEMV LE++E+HYFDD+L DLKL+PQ +++PIP+YF+ ER +++  REK+L +IL +  L    + +   + L+EA+++IQI ERARQGR+RA  M++I  QE + +   +   + +D   AAL+IQ++WRG    +   K +EEE V+LGM  +PL    S   VQ ++ T +  + ++K    EQ+Y +ALV IK+ ++  EG D+ E ++DQIRQWF+E R++ G FPDYP EEDGGS  IF  KTPE++  ++   +  E+K KKK K + K++K K GK++K + +            +E+E WKMS S FL  + EG+ +Y+ +W N++E  NF Q +DPE+IKEEKR+E+E EIR+QVDELMRQEL+NLK++V++E      +KK K ++     +               R +   +Y + N N TIESLY+ELV +G++ + +   LS+Y GEY+YLGTTLRQ  IEP PSL DVR+L+T + ILP+GS EV E+APL+KS+LL GP GVGK MLVH+ICTE GANLF+L+A N+ GKYPGK GL+M++HLVFKV R LQPS++ +   EK F KK+P+ +     KRLK+ LPKL+K +KP+DRI+++GT+  PFDAEL+PFC +YQKIIL+PRPDYASR      ++W+++ILR+ G LTN L+IS L+K++DG+T   +  V + VLTERR+ Q + KPL A EFIT M  ++PVY EEEE+FK WY KTPLGKKR+
Sbjct:    1 MSNLMYNKMWHQTQEALNSLLDKEFQKMSEPQANKVLVFQMLATFYINYVQIFRNMENVYDQIVHPQKRMLIRKVLDGVMGRILELKNEMVELEMTEFHYFDDILQDLKLSPQQLDVPIPRYFLKERLEVIKGREKILARILTECGLNLPVKYAAKSIALEEAVKLIQIAERARQGRLRALFMKQIFLQECRAKEMKLLGHRLLDTKLAALQIQKVWRGFHQCKKTVKEREEEMVFLGMKPSPLFNEVSDAIVQSKQVTNLRDEVQLKH---EQDYQEALVNIKEDLKMLEGPDIKEHLQDQIRQWFIECRNLTGTFPDYPNEEDGGSALIFSNKTPEQVMGDIIATQEEEEKLKKKKKKEDKENKGKKGKKEKKEKKEKKVSLKEKAMKDEDEEWKMSPSLFLQLMEEGNSLYKDIWLNKDESWNFPQDYDPELIKEEKRKELEMEIRVQVDELMRQELKNLKLAVNREMEIPPRQKKGKKEQTIVFPREVFGNPRVALVSLHIRALWGISYLSFN-NGTIESLYQELVEKGLLIQALKVNLSDYIGEYSYLGTTLRQVAIEPMPSLLDVRQLITLYGILPLGSAEVHERAPLVKSLLLAGPSGVGKKMLVHAICTETGANLFNLSALNIAGKYPGKTGLQMMIHLVFKVARQLQPSVVWIQDTEKTFYKKVPQAEKRFEPKRLKRYLPKLLKLLKPDDRILIVGTTHRPFDAELQPFCRVYQKIILVPRPDYASRYGKFHEVLWKEIILRNGGKLTNSLNISCLSKVTDGFTQGQIVQVIKDVLTERRLRQQAHKPLTAIEFITMMTNMNPVYREEEESFKNWYAKTPLGKKRV 832          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Match: sp|A6H690|IQCAL_MOUSE (IQ and AAA domain-containing protein 1-like OS=Mus musculus OX=10090 GN=Iqca1l PE=1 SV=3)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 358/825 (43.39%), Postives = 540/825 (65.45%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPEKS-QLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGM-STPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSE---SNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLI-LRHNGI-LTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            MS  TY + W  +   L+++L  E    +P  S +  +FQ  +S +Y+ Y+ + R+    YDQ+V PQKR++++++LDGV GR++E+K+E+V ++L E H  D VL DLKLTP D+E+PIPKYF +E+   +  R+++L  IL  ++L  +  + +++ +    A+ ++Q  ERARQGR+RA  M+EIR +E++DR       Q    ++ A+ IQ++W+G L R+ +++ +  E  ++GM  +P   N + +   L +A   E  RR++Q   E+E+ +A+    + + ETEG DM E MKDQIRQWF+E   + G+FPDYP+E  GGS  IF +KTPE++  +L  +     K  ++ K K K+ + +  ++KK K +++  ++E   M     S  +P I  G + Y  VWK+R +  + +Q  D E ++EEKR++VE EIR+QVDELMRQEL+NL+++VD  + +    K  K K GKK  K KKEKDLTP              +R+++SL+EELVI G+IKK+    LS+Y G+  YLG+TL      P PSL D+R+ +  + +L +GS ++   APL++S+LL GP G+GK MLV ++CTE GANLFDL+  NL GKYPGK+G ++L+H+VFKV RLLQPS++ +   EK F KK+PK + +   KR+KKDL +  K + P DR+M+IGT+  P  AE+K  C  Y++I+ IPRPDYASR ++W+++I  +  G+ LT+ LD+S+L ++SDGYT S +    Q VLTERR+ QL KKPL A+EF+ H+AR+DPVY EEEE+ KEW+ KTPLGKK +K
Sbjct:    1 MSEGTYQRLWEASHVTLEEVLEKEPSVLEPVPSRERQSFQYRISVLYLYYLGLLRRFNLAYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQDLKLTPADLEVPIPKYFQLEQSSAVKARQQMLADIL--NRLEPLVSQENLRGLSRTAALILVQSAERARQGRLRATFMREIRKEEERDRRIWENGQQKFSRDQGAIVIQKVWKGYLQRKRIEQDRRVEMEFIGMLPSP---NQTARLNTLNQAFLGEESRRMRQVEKEEEFQEAIGKTYESLTETEGPDMKERMKDQIRQWFIECHALTGRFPDYPDEASGGSYLIFADKTPEQVRLDLEAQAQESRKKDQEKKEKNKEKEKEKKEKKKKKVKEEKVKKEPEVMFRVLPSKSIPVINAGHEEYTSVWKSRYDNKHPSQNFDSETLREEKRKQVEMEIRVQVDELMRQELKNLRLAVD--REETRPLKSPKKKGGKKSGKKKKEKDLTP--------------DRSVDSLFEELVIIGLIKKSALVTLSDYIGDCLYLGSTLTLANKMPMPSLFDIRQNMALYGVLRLGSHDIHTMAPLVRSILLVGPSGMGKKMLVQAVCTETGANLFDLSPDNLMGKYPGKNGAQLLVHIVFKVARLLQPSVIWIGNTEKTFYKKVPKEERTMDPKRIKKDLMRATKQLSPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVLWKRMIESQGRGVQLTSSLDVSALARVSDGYTPSHILQSIQSVLTERRLLQLIKKPLVASEFVGHLARLDPVYREEEESLKEWFFKTPLGKKNMK 804          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NCM1|IQCAL_HUMAN (IQ and AAA domain-containing protein 1-like OS=Homo sapiens OX=9606 GN=IQCA1L PE=3 SV=3)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 351/818 (42.91%), Postives = 523/818 (63.94%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPE-KSQLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            MS   Y + W  +   LQ++L  E++  +P    +  +FQ  L+++Y+ Y+ + R+ +  YDQ+V PQKR++++++LDGV GR++E+K+E+V  +L E H  D VL D KLTP D+E+PIPKYF++E+   + ER  +L +IL++ +     +KS   M   EAI ++Q  ERARQGR+RA  M+EIR  E++D              +AA+ IQ++W+G L R+  ++ +  E  ++GM  P        S+ + +   +E  +R++Q   E+E+  A+V   D + ETEG DM E MK+QIRQWF+E  D+ G+FPDYP+   GGS +IF +KTPE++  EL  +     K +++   +   D+ +  K K+ K +K + +     +  S  +P I  G + Y   WKNR E  + +Q +D E ++EEKR+EVE EIRIQVDELMRQELR L+++VDKE+ + +   K+   K    KK K   DLT               +R++ESLYEELVI G+++K+ +  L +Y G++ YLG+TL      P PSL D+R+ V  + +L +GSP++   APLI+S+LL GP G+GK MLV ++CTE GANLFDL+  NL GKYPG++G +M++H+VFKV RLLQPS++ +   EK F KK PK D     KR+KKDL K ++ + P DR+M+IGT+S P  AE++  C +Y++I+ +PRPDYASR ++W+++I       T HLDIS+L K+SDGYT   +    Q VL+ERR  QLSK+PL A+EF+  + ++DPVY EEEE+ K+WY KTPLGKK +K
Sbjct:    1 MSEGAYQRLWESSHATLQELLDQEQLLLEPAPDRERQSFQYRLASLYLHYLGLLRRFDTVYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRADLCENHCLDRVLQDFKLTPADLEVPIPKYFLLEQSTTVRERGLILAEILSRLEPVS-SQKSFTGMHRTEAIILVQKAERARQGRLRATFMREIRRDEEQDGRIREDGWHKFSQGQAAVTIQKVWKGYLQRKRTQQDRRMEMEFIGM-LPSPNQVEHLSI-ISQPCLVEDVQRLRQMEKEEEFRAAMVKAHDSLVETEGPDMKEKMKEQIRQWFIECHDLTGRFPDYPDASSGGSYSIFADKTPEQVRMELEMQMQENRKKEQEKSKEKGKDEKEKKKGKEEKAKKGEVDAVLQVLP-SKCIPMICAGHEEYLNTWKNRCESIHPSQNYDSETLREEKRKEVELEIRIQVDELMRQELRKLRLAVDKEEERPLRAPKKTPGKKTGKKKEK---DLTS--------------DRSVESLYEELVISGLLRKSESVALKDYIGDFLYLGSTLSLVKKLPMPSLFDIRQNVALYAVLRLGSPDIHIMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLFDLSPENLLGKYPGRNGAQMMVHIVFKVARLLQPSVIWIGNAEKNFYKKTPKEDKEMDPKRIKKDLTKALRLLTPGDRVMLIGTTSRPQLAEMRGLCRVYERILFMPRPDYASRYVLWKRMIEARGIQPTQHLDISALAKVSDGYTPGHILQAIQSVLSERRFLQLSKRPLVASEFLGQLVKLDPVYREEEESLKDWYFKTPLGKKSMK 797          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AXQ7|IQCAL_RAT (IQ and AAA domain-containing protein 1-like OS=Rattus norvegicus OX=10116 GN=Iqca1l PE=2 SV=2)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 356/831 (42.84%), Postives = 541/831 (65.10%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPEKS-QLAAFQL-LSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGI---LTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK----AQEAE 2517
            MS  TY + W  +   L+++L  E  P +P  + +  +FQ  +S +Y+ Y+ + R+    YDQ+V PQKR++++++LDGV GR++E+K+E+V ++L E H  D VL +LKLTP D+E+PIPKYF +E+   +  R+++L +ILA+  L  +  + +++ M   EA+ ++Q  ERARQGR+RA  M+EIR +E++DR       Q    ++ A+ IQ++W+G L R+ +++ +  E  ++GM  P  + T+ ++  L +A   E  RR +Q   E+E+ +A+    + + ETEG DM E MKDQIRQWF+E   + G+FPDYP+E  GGS  IF +KTPE++ +EL  +     K +++       +K +  K+K  + +   + E  +K+  S  +P I  G + +  +WK+R +  + +Q  D E ++EEKR++VE EIR+QVDELMRQELRNL+++VD  + +    K  K K GKK  K KKEKDLTP              +R+++SL+EELV+ G+IKK++   L++Y G+  YLG+TL      P PSL D+R+ +  + +L +GS ++   APL++S+LL GP G+GK MLV ++CTE GANLFDL+  N+ GKYPGK+G ++L+H+VFKV R+ QPS++ +   EK F KKIPK +     KR+KKDL +  + + P DR+M+IGT+  P  AE+K  C  Y++I+ IPRPDYASR ++W+++I  + GI    T  LDIS+L ++SDGYT   +    Q VLTERR+ QL+KKPL A+EF+ H+A++DPVY EEEE+ KEW+ KTPLGKK IK     QEAE
Sbjct:    1 MSEGTYQRLWEASHATLEEVLEKEPSPLEPVLTRERQSFQYRISVLYLYYLGLLRRFNLAYDQMVQPQKRRLLRRLLDGVAGRVLELKDELVRVDLCETHCLDRVLQELKLTPVDLEVPIPKYFQLEQTSTMKARQQMLAEILAR--LEPLASQENLRGMSRTEALIIVQCAERARQGRLRATFMREIRKEEERDRRIRENGRQKFSQDQGAIVIQKVWKGYLQRKRIEQDRRMEMEFIGM-LPSSSQTTRQNA-LAQAFVGEESRRTRQVEKEEEFQEAIAKTHESLTETEGPDMKERMKDQIRQWFIECHALTGRFPDYPDEASGGSYLIFADKTPEQVRQELEAQAQENKKKEQEKNKDKVKEKKEKKKKKTKEEKAKKDPEVMFKVLPSKSIPVINAGHEEFTSIWKSRYDNKHPSQSFDSETLREEKRKQVEMEIRVQVDELMRQELRNLRLAVD--REETRPLKSPKKKGGKKSGKKKKEKDLTP--------------DRSVDSLFEELVVIGLIKKSLLVTLNDYIGDCLYLGSTLTLANKIPMPSLFDIRQNIALYGVLRLGSHDIHTMAPLVRSILLVGPSGMGKKMLVQAVCTETGANLFDLSPGNVMGKYPGKNGSQLLMHIVFKVARVFQPSVIWIGNTEKTFYKKIPKEERRMDPKRIKKDLMRATRQLGPGDRVMLIGTTERPQLAEMKGLCRFYERILFIPRPDYASRYVLWKRMI-ENQGIGVQQTQSLDISALARVSDGYTPGHILQSIQSVLTERRLLQLTKKPLVASEFVVHLAKLDPVYREEEESLKEWFYKTPLGKKNIKFTKDQQEAE 810          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: K1RKE5 (IQ and AAA domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10020709 PE=4 SV=1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 515/828 (62.20%), Postives = 637/828 (76.93%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKE-KSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEEL-----FXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXX-------XXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKR 2496
            MSH+TYNKQW EAQ +L D+L  E  E P KPEK +LAAFQLL+TMYIKYIQIFRK+EQCYDQIVHPQKR+V++ VLDG +GRI+E+K+EMVNLE SEYHYFDDVLSDLKLTP D+EIPIPK+F+ ER  +L EREKLLG+ILAK    E ++ K ++KM L++AI+MIQ+HERARQGR+RAK M+EIR QE++DR    + A T+D + AA +IQ++W+G   RR  KK ++EE +++GM+ P +  TS K+     A K E+ RRI Q   E EY QAL TIK+KI+ETEG D+ E+M DQIRQWF+E RD  GKFP+YP+E+DGGS  IFKEK+PEEL  EL      KK+  +   K K   K      K  K KKGKG  D+EEEEGWKM+ES+F+P I EG+  Y+ VW  R+E++NF+Q HD E+IKEEKR+EVE EIRIQVDELMR EL+NLK +VD++K K+   KK   KK KKGKK  K       EKDLTP              +RTIESLYEELV +GII +    +LSE+EGEY+YLGTTLRQ  IEP PSLSDVRRLVTEF ILP+GS  V E+APL KS+LL GPRG GK MLV ++C E+GAN+FDLTA+N+ GKYPGKDGLKML+HLVFKVGR LQPS++ +  CE+MFKKKIPKTD +DPKRLKK+LPK +KG+K +DR++++GTS  PFD E+KP CSLYQ+IILIPRPDYASR+++WR+L+L++NG++TN LD+SSL+K++DGYT   +     QVLTERRI  LSKKPLQ+ EFI  +ARIDP+Y EEEEAFK WY KTPLGKKR
Sbjct:    1 MSHSTYNKQWQEAQSSLMDLLQQEIPEQPSKPEKDRLAAFQLLATMYIKYIQIFRKMEQCYDQIVHPQKRRVLRHVLDGTMGRILELKHEMVNLEFSEYHYFDDVLSDLKLTPNDVEIPIPKFFINERYDVLKEREKLLGKILAKIGPQEKEDQKEELKMSLEDAIKMIQVHERARQGRLRAKFMKEIREQEERDRLAQTRGAPTLDPDVAACRIQKVWKGFAQRRRTKKERDEEMIFIGMAPPPLP-TSIKNTPQALALKTEATRRITQGNHENEYQQALGTIKEKIKETEGPDIKETMMDQIRQWFIECRDAQGKFPEYPDEDDGGSALIFKEKSPEELEAELNDKDGDKKKKDKKGKKDKKDKKKDKKGKKDKKGKKGKGGDDEEEEEGWKMAESSFVPSINEGTDKYKSVWMTRDEKDNFSQKHDAELIKEEKRKEVEEEIRIQVDELMRAELKNLKAAVDRDKGKKGKGKKSGKKKKKKGKKSGKKGKKKKKEKDLTP--------------DRTIESLYEELVKEGIIVRCPQIRLSEFEGEYSYLGTTLRQANIEPMPSLSDVRRLVTEFGILPLGSQAVHEQAPLTKSILLAGPRGTGKKMLVQAVCNEVGANMFDLTAANIAGKYPGKDGLKMLIHLVFKVGRELQPSVIYIGDCERMFKKKIPKTDPTDPKRLKKELPKAMKGVKSDDRLLLVGTSRCPFDGEMKPLCSLYQRIILIPRPDYASRHLLWRRLVLKNNGVITNTLDVSSLSKVTDGYTPGHMLTAITQVLTERRIQTLSKKPLQSVEFIAPLARIDPIYKEEEEAFKGWYAKTPLGKKR 813          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: V4AB81 (ATPase_AAA_core domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_204242 PE=4 SV=1)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 497/829 (59.95%), Postives = 625/829 (75.39%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDIL--AYEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAK-SQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXX----XXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKAQEAE 2517
            MSH+ YNKQW + Q  L +IL       P KPE+ +LAAFQLL+TMYIKY+QIFRKLEQ YDQ+VHPQKR+V++ VLDGV+GRI+E+K+EMVNLE +EYHYFDDVLSDLKLTP DIEIPIPKYF+ ER K L EREKLLGQILAK     + K+  +++MPL+EAIR+IQ+HERARQGR+RAK M+EIR QE+++RN   +   T+D   A L+IQ++W+G   RR  K+ ++EE +++GM+ P + ++S K++    A K E  RR  Q   EQE+ QAL++IKDKIR+TEG D+ E+M DQIRQWF+E RD  GKFP+YP+E+DGGS  IFK++ P EL +++ +KE  + K KK  K   K DK     + KGK  K D++EE    KM++SNF+  + EGS+ Y+GVW+ R+E  NF+Q HD E+IKEEKR+EVE EIRIQVDELMR EL+NLK +VD++K K+  KK  K KK KK    K     EKDLTP              +RTIE LYEELV QGII ++ T  L +Y GEY+YLGTTLRQ  IEP PSLSDVRRLVTEF IL +GS  V EKAPL KS+LL GPRG GK MLVH+ICTE GANLFDL+ +NL GKYPGKDGLKML+HL+FKVGR LQPS+  +  CEKMFKKKIPKTD +DPKRLKK+LPK +K +K EDR++++GTS  PF+AE+KPF   YQ+IILIPRPDYASR+++WR LI ++ G ++N LDISSL+K++DGYT   +     QVLT+RRI QL+KKPLQ+ EFI  +ARIDP+Y EEEE+FK WY KTPLGKKR KA +A+
Sbjct:    1 MSHSYYNKQWTDGQSALVEILQQELPPEPPKPERDRLAAFQLLATMYIKYVQIFRKLEQSYDQVVHPQKRRVLRHVLDGVMGRILELKHEMVNLEFAEYHYFDDVLSDLKLTPNDIEIPIPKYFINERTKSLKEREKLLGQILAKIGPQDQDKDSDEVRMPLEEAIRLIQVHERARQGRLRAKFMREIRQQEERERNASKQGQSTLDPEVAVLRIQKIWKGFAQRRRTKRERDEEMIFIGMAPPPLPSSS-KNLPQTLAQKTEEQRRKVQDQHEQEFQQALISIKDKIRDTEGQDIKETMMDQIRQWFIECRDATGKFPEYPDEDDGGSALIFKQQDPAELEKQMKEKEDDKGKGKKDKKKDKKKDKKDKKGKGKGKKGKGDDDEEEEGWKMAQSNFVGAVQEGSEDYKGVWQTRDESENFSQKHDGELIKEEKRKEVEDEIRIQVDELMRTELKNLKTAVDRDKGKKKGKKSGKKKKKKKKSGKKGKKKKEKDLTP--------------DRTIEDLYEELVSQGIIVRSPTVSLKDYCGEYSYLGTTLRQANIEPMPSLSDVRRLVTEFGILHLGSAAVHEKAPLTKSLLLAGPRGTGKKMLVHAICTETGANLFDLSPANLAGKYPGKDGLKMLMHLIFKVGRALQPSVFYIGDCEKMFKKKIPKTDPTDPKRLKKELPKALKNVKGEDRLLLVGTSRCPFEAEMKPFVGCYQRIILIPRPDYASRHLLWRHLITKNGGTISNLLDISSLSKVTDGYTPGHMVTAVHQVLTDRRIQQLAKKPLQSVEFIAPLARIDPIYKEEEESFKSWYAKTPLGKKRAKAAQAD 814          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: R7UA00 (ATPase_AAA_core domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_153643 PE=4 SV=1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 504/831 (60.65%), Postives = 621/831 (74.73%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDIL--AYEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTP--QDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGM-STPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXX------XXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKAQEAE 2517
            MSH+ Y +QW EAQ  L D+L       P KPEK +LAAFQLL+TMYIKY+QIFRKLE  YDQIVHPQKR+V++ VLDG +GR++E+K+EMV LE SEYHYFDDVLSDLKLTP   DIE+P+PKYF  ER K L EREKLLGQILAK  LG   + S++ M L++AIRMIQIHERARQGR+RAK M+EIR QE+ +R    + A T+D + AA +IQ++W+G   RR   + +  E +++GM   PL TN   K +    A K E+DRR  Q + EQEY QAL+TIKDKIRE+EG DM E M+DQIRQWF+E RD  GKFP+YP+E++GGS  IFKEK P E+  EL K +      K K   K K DK K  KEKKGK   DDEE+EGWKM+ S+F+P + E ++ Y  VW+ ++E +NF+Q HD E+IKEEKR EVE E+R+Q+DELMRQEL+NLK++VD++K K+  K K   KK K  K GKK      EKDLTP              +RTIESLYEELV +GII ++    L++YEGEY+YLGTTLRQ  +EP PSLSDVRRLV EF ILPIGSP V EKAPLIKSV+L GPRG GK  LVH+ICTE GANLFDLTA+N+ GKYPGKDGLK+L+H++FKVGR LQPS++ + +CEKMFKKK+PKTDLSDPKRLKK+LPK +K IKPEDRI+++GT+  PFD E+KP  S YQKI+LIPRPDYASR+++WRKLI R  G +T+ LD+SSL K++DGYT   +      VL+ERRI QL+KKPL A EFI  +AR+DPVY EEEE+FK WY KTPLGKKR KA + +
Sbjct:    1 MSHSYYGRQWSEAQAALSDLLQQESPPDPPKPEKDRLAAFQLLATMYIKYVQIFRKLEHSYDQIVHPQKRRVLRHVLDGCMGRVLELKDEMVKLEFSEYHYFDDVLSDLKLTPASNDIEMPVPKYFTHERSKALKEREKLLGQILAK--LGPQDKDSEVTMSLEDAIRMIQIHERARQGRLRAKFMREIRQQEEDERMIANRGAPTLDPDVAATRIQKLWKGFSQRRKTTQERIGEMMFIGMIPPPLPTN--LKMLPQNLAVKTETDRRRTQEIHEQEYQQALITIKDKIRESEGPDMKERMQDQIRQWFIECRDASGKFPEYPDEDEGGSGAIFKEKDPAEIEAEL-KAKEDGKDGKGKKGKKEKKDKKKDKKEKKGKKGDDDEEDEGWKMAPSSFVPAMGEATETYSTVWEPKDEGDNFSQKHDVELIKEEKRMEVETEVRVQIDELMRQELKNLKLAVDRDKGKKGKKGKSGKKKKKGKKSGKKGKKGKKEKDLTP--------------DRTIESLYEELVTEGIIVRHPKVTLTDYEGEYSYLGTTLRQASVEPMPSLSDVRRLVAEFAILPIGSPSVHEKAPLIKSVMLAGPRGTGKHTLVHAICTETGANLFDLTATNIAGKYPGKDGLKLLMHMIFKVGRALQPSVIYIGECEKMFKKKVPKTDLSDPKRLKKELPKALKTIKPEDRILLVGTTRCPFDGEMKPMASTYQKIVLIPRPDYASRHLLWRKLITRSGGQVTSSLDVSSLAKITDGYTPGQMVQACTSVLSERRINQLAKKPLVAAEFIAPLARLDPVYKEEEESFKTWYSKTPLGKKRAKAAQGD 812          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: A0A210QR77 (IQ and AAA domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11196 PE=4 SV=1)

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 504/824 (61.17%), Postives = 627/824 (76.09%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAK-SQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEEL------FXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXX------XXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPL 2484
            MSH+TYNKQW EA+  L D+L  E    P KPEK +LAAFQLL+TMYIKYIQIFRKLEQ YDQIVHPQKR+V++ VLDG +GRI+EIK+EMVNLE SEYHYFDDVLSDLKLTP D+EIPIPKYF+ E+ +IL EREKLLGQIL K     +  +K ++KM L++AIR+IQIHERARQGR+RAK M+EIR QE+++     + A T+D + AA++IQ++W+G   RR  KK ++EE V++GM+ P +  TS K+     A K ES RR  Q  +E E+ Q+LVTIK+KI+ETEG D+ E+M DQIRQWF+E RD  GKFP+YP+E+DGGS  IFK+KTPEEL  E+        K+  +   KK  K K      K  K KKGKG  D+EEEEGWKM+ S F+P I EG+  Y+G+W+ R+E++NF+Q HD E+IKEEKR+EVE EIR+QVDELMR EL+NLK +VD++K K+  KK  K KK K  K GKK      EKDLTP              +RTIESLYEE+V+ GII +    +L++YEGEY+YLGTTLRQ  IEP PSLSDVRRLVTEF ILP+GSP V EKAPL KS+LL GPRG GK MLV +IC E GAN+FDL+ +N+ GKYPGKDGLKML+HLVFKVGR LQPS++ +  CE+MFKKK+PKTD +DPKRLKK+LPK +K IK +DR++++GTS  PFD E+KP  S YQ+IILIPRPDYASR+++WR++IL++NG+LT +LDISSL+K++DGYT   L    QQVLTERRI  LSKKPLQ+ EFI  +ARIDP+Y EEEE+FK WY KTPL
Sbjct:    1 MSHSTYNKQWSEAESALVDLLQQELPPEPPKPEKDRLAAFQLLATMYIKYIQIFRKLEQSYDQIVHPQKRRVLRHVLDGAMGRILEIKHEMVNLEFSEYHYFDDVLSDLKLTPNDVEIPIPKYFINEKMEILKEREKLLGQILTKVGPQDKEDQKEEVKMSLEDAIRVIQIHERARQGRLRAKFMKEIREQEEREIMAQTRGAPTLDPDVAAVRIQKVWKGFAQRRRTKKDRDEEMVFIGMAPPPMP-TSLKNTPQALALKTESQRRQTQGTYEHEFQQSLVTIKEKIQETEGPDIKETMMDQIRQWFIECRDASGKFPEYPDEDDGGSAAIFKQKTPEELEAEMREKEEGGGKKKDKKGKKKDKKDKKDKKDKKGKKGKKGKGGDDEEEEEGWKMAPSTFVPAINEGTDDYKGIWQTRDEKDNFSQKHDSELIKEEKRKEVEEEIRLQVDELMRTELKNLKAAVDRDKGKKKGKKSGKKKKKKGKKSGKKGKKKKKEKDLTP--------------DRTIESLYEEMVMNGIIVRTPNIKLTDYEGEYSYLGTTLRQANIEPMPSLSDVRRLVTEFGILPLGSPAVHEKAPLTKSILLAGPRGTGKKMLVQAICNETGANMFDLSPANIVGKYPGKDGLKMLMHLVFKVGRELQPSVIYIGDCERMFKKKVPKTDPTDPKRLKKELPKALKTIKSDDRLLLVGTSRCPFDGEMKPLTSCYQRIILIPRPDYASRHLLWRRIILKNNGVLTANLDISSLSKVTDGYTPGHLATAVQQVLTERRIQTLSKKPLQSVEFIAPLARIDPIYKEEEESFKSWYAKTPL 809          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: A0A2T7NTS1 (ATPase_AAA_core domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15045 PE=4 SV=1)

HSP 1 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 471/823 (57.23%), Postives = 593/823 (72.05%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYE--EIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEI-KEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-------XMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKR 2496
            MSH+ YNKQW EAQ  L D+L  E    P+KPE+ + AAFQLL+TMYIKYIQI R+LEQCYDQIV PQKR+V++  LDGV+GRI+E+KNEM++LE SEYHYFDDVLSDLKLTP D+EIPIP YF++ER K L +REKLLGQ+LA+    E+ ++K ++ M  D+AIR+IQ+HERARQGR+RA+ M+EIR QE++++   +  A T+D + AA++IQ++W+G   RR  KK +EEE +++GM  P + N            + E DRR  Q + EQEY QALV I DK+ ETEG D+ E+M DQIRQWF+E RD  GKFP++PEEEDGGS  IF +K P EL +EL  KE  + K KK  KGK      K  K+KKGK  K  ++ +         KM+ SNF+P + E +  Y+ VW+ R+E  NFAQ +D E+I+EEKR+EVE+EIR+ VDELMR EL NLK ++                      K   + +L P      G          IE LYEELV+QGII +    +L++Y GEY+YLGTTLRQ  IEP PSLSDVRRLVTEF ILP+GS  V E+APLIKSVLLTGPRG GK +LVH+IC E+GANLFDL+ +NL GKYPGKDGLKML+HL+FKVGR LQPS+  V  CEKM+KKKIPKTDL+DPKRLKK+LPK +K IKPEDR+++IGTS  PF+AE+KP    +Q+ ILIPRPDYASR ++WR LI + NGI+TN LDISSL+K++DGYT   +     QVLT+RRI  L+KKPLQA EFI  +ARIDP+Y EEEE+FK WY KTP+GKKR
Sbjct:    1 MSHSYYNKQWLEAQAALTDLLMQEIPTEPQKPERDRQAAFQLLATMYIKYIQIMRRLEQCYDQIVQPQKRRVLRHCLDGVMGRILELKNEMIDLEFSEYHYFDDVLSDLKLTPNDVEIPIPNYFILERTKALTKREKLLGQVLARLGPQELERDKEEVAMSWDQAIRIIQVHERARQGRLRARFMREIRQQEEREKRAQMFGAPTLDPDVAAIRIQKVWKGFSQRRRTKKEREEEMIFVGMLPPPLPNPKNMPQTF--CLRTEEDRRKTQDVHEQEYQQALVNIHDKLMETEGPDLKETMMDQIRQWFIECRDATGKFPEFPEEEDGGSAIIFAQKDPIELEKELKAKEEDQGKGKKGKKGKKGKKGKKGKKDKKGKKGKKGKKGKNDEEEDEGWKMAPSNFVPAVNEATDSYKAVWQTRDETENFAQKYDAELIREEKRKEVESEIRLHVDELMRVELTNLKTAI----------------------KCTHKHNLKP------GYRTLKESEGDIEDLYEELVMQGIIIRPNPIKLADYAGEYSYLGTTLRQANIEPMPSLSDVRRLVTEFAILPLGSAAVHEQAPLIKSVLLTGPRGTGKRLLVHAICNEVGANLFDLSPANLAGKYPGKDGLKMLMHLLFKVGRALQPSVFFVGDCEKMYKKKIPKTDLTDPKRLKKELPKSLKLIKPEDRLLLIGTSRCPFEAEMKPLIGCFQRTILIPRPDYASRFLLWRHLITKFNGIITNQLDISSLSKVTDGYTPGQMVTAVTQVLTDRRIQMLNKKPLQAVEFIAPLARIDPIYKEEEESFKAWYAKTPMGKKR 793          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: zgc:153738 (IQ and AAA domain-containing protein 1-like [Source:NCBI gene;Acc:103023638])

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 406/820 (49.51%), Postives = 569/820 (69.39%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEI--PEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGE-IKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXV-KGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MSH+ Y+K W  AQ+ L  +L  E    P +PE+ ++  FQ L+T+Y++Y+QIFR+LE+ YDQIV PQKR +I++VLD VIGR++E+KNEMV  E SEYHY DDV+ D+KLTP+D+EIPIP+YF+ ER K+L +R K+L  IL K ++ E  K  ++  + +++AIR+IQ+ ERARQGR+RAK M+EI+  +++ + +  +        +AA+ IQ++W+G + R+  K+  EEE ++LGM+          +  +   TK  + RRI+Q   E++Y +++++I + +RE EG DM E+MKDQIRQWF+E  D  G FPD+PEEEDGGS  IF +KTPE+L        M E   K++ +   +    +   +++    +++EEE G  M  S FL  +  G + +  VWKNR E  NF Q H+ E+IKEEKR+E+EAEIR+QVDELMRQEL N K++VD +K  +     +K K  K GKK KKEKDLT               +RTIESLY+ELV QG++K     +L +Y G+Y+YLGTTLR   IEP PSLSDVR+++  + +LP+GS  V EKAPL+K++LL GP GVGK MLVH+IC E GANLFDL+++NL GKYPGK+GL M+LH+VFKV RL+QPS++ +   EKMF KK+PK +     +  K     + KG+K EDR++++GT+++P +A+LK  C +Y KIILIPRPDYASR ++W++LI R+ G++T+ LDISSL K+SDGYT   +  V + VLTERRI  L+K+PL A EF++ +ARIDPV+ +EEEA K WY KTPLGKKRIKA
Sbjct:    1 MSHSLYSKLWSGAQEELGSLLTQELPVEPLRPERDRVVFFQRLATLYVRYVQIFRQLEEAYDQIVQPQKRILIRQVLDNVIGRVLELKNEMVEKEYSEYHYMDDVIQDMKLTPEDLEIPIPRYFISERSKVLRDRSKILSSILEKLEVVEKPKTGAERTLSMEKAIRIIQVTERARQGRLRAKFMREIQRDQERQKKSLNRDLGEAAAEQAAICIQKVWKGFMQRKRTKQESEEEMIFLGMAPDHSLPQPCPASVVAEDTK--NRRRIRQEEHEEDYQKSIISITNSLREVEGPDMKENMKDQIRQWFIECHDATGSFPDFPEEEDGGSSLIFADKTPEQL--------MEELAAKEEEETSKRPKGKEENIDRRKGPGEEEEEEPGLMMLPSAFLSQLQTGQKTFTDVWKNREESKNFNQRHEAELIKEEKRKEIEAEIRLQVDELMRQELANWKLAVDGDKGGKAKAAAKKKKASKSGKKKKKEKDLTA--------------DRTIESLYQELVEQGLLKPADNVKLQDYIGDYSYLGTTLRLTDIEPMPSLSDVRQVIALYAVLPLGSQVVHEKAPLVKAILLVGPSGVGKKMLVHAICQETGANLFDLSSANLVGKYPGKNGLTMMLHMVFKVARLMQPSVVWIGDAEKMFYKKVPKEEKELDPKRLKKDLPKILKGMKGEDRVLIVGTTNSPVNADLKSLCKVYTKIILIPRPDYASRYVMWKQLIQRNGGVVTSTLDISSLAKISDGYTQGHMVQVIRSVLTERRIQLLAKRPLVATEFVSPLARIDPVFQDEEEALKAWYAKTPLGKKRIKA 796          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: iqca1 (IQ motif containing with AAA domain 1 [Source:ZFIN;Acc:ZDB-GENE-050208-768])

HSP 1 Score: 357.451 bits (916), Expect = 3.195e-110
Identity = 183/316 (57.91%), Postives = 235/316 (74.37%), Query Frame = 1
Query: 1561 INRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            +NRTIESLYEELV++GI+ +    +LSEY GE++YLGT+LRQ  IEP PSLSDVR+L+  + +LP+GS  V E+ PLI+S+LL GP GVGK ML+H++CTE GANLF+L+  NL GKYPGK GL+ LLH+V KV R LQPS+L +   EK F KK+PK +     KRLKKDL K+VK IK EDR++++GTS  PFDA+LK    +Y+KIILIPRPDY+SR I+W+KL++     L   LD+SSL K++DGYT   +    + VL+ RR+ Q SK+PL A EFI  +AR DPVY EEEE  K WY +TPLGKKR +A
Sbjct:  471 LNRTIESLYEELVLEGILTRPHNVKLSEYLGEFSYLGTSLRQANIEPMPSLSDVRQLIALYGVLPLGSQSVHERGPLIRSLLLAGPSGVGKKMLLHALCTETGANLFNLSPGNLAGKYPGKSGLQYLLHMVLKVARQLQPSVLWIGDAEKTFYKKVPKAEKELEPKRLKKDLVKVVKSIKVEDRVLLVGTSRRPFDADLKSLSKVYKKIILIPRPDYSSRLILWKKLLVIGGAQLGPTLDLSSLAKVTDGYTQGHILQAVRSVLSSRRLNQQSKRPLTALEFIPPLARQDPVYKEEEETLKAWYSRTPLGKKRTRA 786          

HSP 2 Score: 352.829 bits (904), Expect = 1.470e-108
Identity = 197/434 (45.39%), Postives = 281/434 (64.75%), Query Frame = 1
Query:   55 LMSHNTYNKQWHEAQQNLQDILAYEEIPE---KPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDP 1323
            +   ++Y++ W EAQ  L D+L  +EIP    +P+K +  AF  L+T Y++Y+ IFR+LE+ YDQIVHPQKR+V+++VL+GV+GR++E+KNEMV LE SE+HY DD+L DLK+TP+D+++PIP+YF+ ER K L ERE++L  IL K      +  S   M ++ A++++Q+ ERARQGR+RA  M+EI  +E + R       +  D N AA  IQR+WRG   R+  KK + EE ++LGM  P V   S      QRA ++E  RR  Q   E EY QAL++IK  +R  + +D+ E+++DQIRQWFLE RD  GKFPD+P  EDGGS +IF +K+PEE+A EL  K+  ++K K KGK      K +  K+K  KG+   +  +          KMS SNFLP + EG+++Y  VW+ R+E  NF Q  DP
Sbjct:    1 MSDQHSYSRIWAEAQGALADLLE-DEIPPTSLRPQKDRFQAFHTLATFYLRYLHIFRRLEEVYDQIVHPQKRQVVRQVLEGVMGRLVELKNEMVELEFSEFHYLDDLLQDLKMTPEDLDVPIPRYFIRERMKALKERERMLAHILEKKGSLNQEPVSLQVMSVERAVQLLQVSERARQGRLRAHFMKEIWREERRIRQGEDGPTEA-DLNLAATLIQRVWRGYRERKRTKKERLEEMIFLGMVEPEVLELSPAQ---QRAQQVEKIRRQVQDQHEAEYQQALLSIKQSVRSVDEADIKETLQDQIRQWFLECRDATGKFPDFPSAEDGGSASIFSQKSPEEVAAELAAKQQEKEKKKSKGKKDKNASKERKEKKKDKKGKSKGKGGKSDIEEEEKGWKMSPSNFLPTVAEGAKLYREVWQTRDEGQNFPQRFDP 429          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: iqca1 (IQ motif containing with AAA domain 1 [Source:ZFIN;Acc:ZDB-GENE-050208-768])

HSP 1 Score: 329.717 bits (844), Expect = 8.021e-105
Identity = 169/350 (48.29%), Postives = 238/350 (68.00%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPE---KPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPL-----DEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEEL 1083
            MS  +Y++ W EAQ  L D+L  +EIP    +P+K +  AF  L+T Y++Y+ IFR+LE+ YDQIVHPQKR+V+++VL+GV+GR++E+KNEMV LE SE+HY DD+L DLK+TP+D+++PIP+YF+ ER K L ERE++L  IL K   G + ++     PL     + A++++Q+ ERARQGR+RA  M+EI  +E + R       +  D N AA  IQR+WRG   R+  KK + EE ++LGM  P V   S      QRA ++E  RR  Q   E EY QAL++IK  +R  + +D+ E+++DQIRQWFLE RD  GKFPD+P  EDGGS +IF +K+PEE+A EL
Sbjct:    1 MSEVSYSRIWAEAQGALADLLE-DEIPPTSLRPQKDRFQAFHTLATFYLRYLHIFRRLEEVYDQIVHPQKRQVVRQVLEGVMGRLVELKNEMVELEFSEFHYLDDLLQDLKMTPEDLDVPIPRYFIRERMKALKERERMLAHILEKK--GSLNQEPVTVNPLLVMSVERAVQLLQVSERARQGRLRAHFMKEIWREERRIRQGEDGPTEA-DLNLAATLIQRVWRGYRERKRTKKERLEEMIFLGMVEPEVLELSPAQ---QRAQQVEKIRRQVQDQHEAEYQQALLSIKQSVRSVDEADIKETLQDQIRQWFLECRDATGKFPDFPSAEDGGSASIFSQKSPEEVAAEL 343          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: zgc:153738 (IQ and AAA domain-containing protein 1-like [Source:NCBI gene;Acc:103023638])

HSP 1 Score: 318.161 bits (814), Expect = 1.613e-99
Identity = 158/336 (47.02%), Postives = 235/336 (69.94%), Query Frame = 1
Query:   73 YNKQWHEAQQNLQDILAYEEI--PEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGE-IKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEEL 1071
            Y+K W  AQ+ L  +L  E    P +PE+ ++  FQ L+T+Y++Y+QIFR+LE+ YDQIV PQKR +I++VLD VIGR++E+KNEMV  E SEYHY DDV+ D+KLTP+D+EIPIP+YF+ ER K+L +R K+L  IL K ++ E  K  ++  + +++AIR+IQ+ ERARQGR+RAK M+EI+  +++ + +  +        +AA+ IQ++W+G + R+  K+  EEE ++LGM+          +  +   TK  + RRI+Q   E++Y +++++I + +RE EG DM E+MKDQIRQWF+E  D  G FPD+PEEEDGGS  IF +KTPE+L
Sbjct:   84 YSKLWSGAQEELGSLLTQELPVEPLRPERDRVVFFQRLATLYVRYVQIFRQLEEAYDQIVQPQKRILIRQVLDNVIGRVLELKNEMVEKEYSEYHYMDDVIQDMKLTPEDLEIPIPRYFISERSKVLRDRSKILSSILEKLEVVEKPKTGAERTLSMEKAIRIIQVTERARQGRLRAKFMREIQRDQERQKKSLNRDLGEAAAEQAAICIQKVWKGFMQRKRTKQESEEEMIFLGMAPDHSLPQPCPASVVAEDTK--NRRRIRQEEHEEDYQKSIISITNSLREVEGPDMKENMKDQIRQWFIECHDATGSFPDFPEEEDGGSSLIFADKTPEQL 417          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: fign (fidgetin, microtubule severing factor [Source:NCBI gene;Acc:103027830])

HSP 1 Score: 82.4185 bits (202), Expect = 1.075e-15
Identity = 71/267 (26.59%), Postives = 137/267 (51.31%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVREK-APLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI--KPEDRIMVIGTSSAP--FDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQV----LTERRIAQLSK------KPLQANEFITHMARIDPVYTEEE-EAFKEWYK 2472
             +  + E  + PI  P++    APL +S+L  GP+G G+T+L   I ++LGA    ++ S L  K+ G+     ++   F V R  QPS++ V   + +   ++  ++ S   R+K +L   + G+   PED ++VI ++S P   D  L+ +   + K +LIP PD  +R+ +  +++ +HN  L++  +++ L + ++G++  D+  + Q+     L     A LS       +PL   +F     +I P  +++E + + EW K
Sbjct:  489 AKATIKEEVLWPILRPDMFSGLAPLPRSILFFGPQGTGRTLLARCIASQLGAAFLQISGSALVTKWLGEG--DKVVQASFLVARCRQPSVVFVSDVDLLLSGQL--SEESPVNRIKSELLLQLDGVISSPEDHVLVICSTSKPEEIDESLRRY---FVKRLLIPLPDTTARHQLISQVLAQHNYCLSDK-EVALLVQRTEGFSGLDVVRLCQEAIVGPLHGMSGADLSGIMPGQMRPLSYQDFENVFCKIQPSISQKELDTYTEWNK 747          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000520.1 (pep scaffold:Pmarinus_7.0:GL478568:5536:22262:-1 gene:ENSPMAG00000000463.1 transcript:ENSPMAT00000000520.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 431.024 bits (1107), Expect = 6.593e-139
Identity = 253/432 (58.56%), Postives = 319/432 (73.84%), Query Frame = 1
Query: 1216 MSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSV--DXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            M+ SNFLP I+EG + Y  VW+NR+E NNF+Q  + E++KEE R++VE EIR QVDELMR+ELRNLK+ V  D+ K  +  K  +K K  K GKK KKEKDLTP              +RTIESL+EELV+QGI+ +    QLS++ GEY+YLG+TLRQ  IEP PSLSDVR+LV  + ILP+GS  V EKAPL+KS+LLTGP GVGK  LV++ICTE GANLFDL+A  +  KYP K GL+ML+H+V KV RLLQPS++L++  EK F KK+PK D     KRLKKDLPK++K +K EDR+M++GTS  PF A+ K FC LYQKI+LIPRPDYASR ++WR L++   G +T  LD+SSL K++DGYT   +    Q VL+ERR+ QL+K+PL A EFI  ++RIDPV+ EEEEAFK WY KTPLGKKR K
Sbjct:  387 MAPSNFLPTISEGHKTYTDVWQNRDESNNFSQKFNAELVKEEMRKKVENEIRKQVDELMREELRNLKLVVEKDRGKKVKKKKGGKKKKNKKGGKKKKKEKDLTP--------------DRTIESLFEELVLQGILIRPPKVQLSDFVGEYSYLGSTLRQADIEPMPSLSDVRQLVALYAILPLGSQAVHEKAPLVKSMLLTGPNGVGKRTLVNAICTETGANLFDLSAKTIVDKYPSKSGLQMLMHMVLKVARLLQPSVVLIEDAEKTFYKKVPKDDKKLEPKRLKKDLPKMLKLLKAEDRVMLVGTSRQPFLADQKSFCKLYQKIVLIPRPDYASRFVLWRHLLVTSCGAVTPSLDLSSLAKVTDGYTQGQMVQAAQAVLSERRVQQLAKRPLTAGEFIGSLSRIDPVFLEEEEAFKSWYAKTPLGKKRAK 804          

HSP 2 Score: 271.166 bits (692), Expect = 5.183e-79
Identity = 153/338 (45.27%), Postives = 217/338 (64.20%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILA--YEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQ-EDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTP 1062
            ++ +TYN  W EA   +  +        P +PEK +LAAFQ+L+T+Y++Y+ I R LE  +DQ+V PQKR+V++ +LDGV+GR++E+K EMV LE SE+HY DDVL D KLTPQD+EIP+PKYF+ +R KI+ EREKLL  +L K  + +I++       ++  I +  I  R  +G  +   M     Q E  ++N H   +Q  +         +MW+G + RR  K+ +EEE ++LGM+ P  +N   KS+    A K+ES RR+ Q   E EY Q +V+IK K+ E EG DM E+M++QIRQWF+E RD  GKFP+YP+EEDGGS  IF EKTP
Sbjct:    1 LACSTYNALWAEANAGIAHLFGQELPPEPPRPEKDRLAAFQVLATLYVRYLGITRGLEAAHDQVVQPQKRRVLRHLLDGVMGRLLELKQEMVALECSEFHYVDDVLQDFKLTPQDLEIPVPKYFINDRLKIIKEREKLLETVLEKMGMEDIEK-------IECVIGVHCIFLRHFKGHTKLGTMSRSLLQSESMNKNHHAIVSQLFEREIMICVAVQMWKGFMQRRRTKREREEEMIFLGMTLP--SNLPKKSLAQVNAEKVESLRRLTQDEHETEYQQGIVSIKQKLLEVEGPDMKEAMQEQIRQWFIECRDATGKFPEYPDEEDGGSALIFAEKTP 329          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007508.1 (pep scaffold:Pmarinus_7.0:GL478692:23769:36372:1 gene:ENSPMAG00000006768.1 transcript:ENSPMAT00000007508.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 6.441e-18
Identity = 62/213 (29.11%), Postives = 117/213 (54.93%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIK--PEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQV 2346
             ++ + E  ILP   PE+    ++P  + +LL GP G GKT+L  ++ TE  A  F+++AS++  KY G +G K L+  +F V R +QPSI+ +D+ + +  ++  + +    +R+K +      G+K   EDR++V+G ++ P + + +     + K I +  PD A+R  I   L+ +H   L+   +++ L + + GY+ SDL  + +  
Sbjct:  229 AKQTLQEIVILPSLRPELFTGLRSP-ARGLLLFGPPGNGKTLLAKAVATECSATFFNISASSMMSKYVG-EGEK-LMRALFAVAREMQPSIIFIDEIDSLLCER-KEGEHDTSRRMKTEFLMQFDGVKSEAEDRVLVMGATNRPQELD-EAVLRRFPKRIYVDMPDEAARKQILNHLLSKHGSPLSEK-ELAVLARTTTGYSASDLTALAKDA 435          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 81.6481 bits (200), Expect = 1.798e-16
Identity = 62/213 (29.11%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKP--EDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQV 2346
             ++ + E  ILP   PE+    +AP  K +LL GP G GKTML  ++ +E  A  F+++A++L  KY G+   + L+  +F V R LQPSI+ +D+ + +  ++  + +    +RLK +      G++   EDR++V+G ++ P + + +     + K I +  P+      I   L  +H   L+ H D + L ++++GY+ SDL  + +  
Sbjct:  213 AKQALQEIVILPSLRPELFTGLRAP-AKGLLLFGPPGNGKTMLAKAVASESSATFFNISAASLTSKYVGEG--EKLVRALFSVARELQPSIIFIDEVDSVLCER-REGEHEASRRLKTEFLVEFDGVQSSGEDRVLVMGATNRPQELD-EAVLRRFSKRIYVSLPEEEVPTAIAVSLSWKHANPLS-HADRAHLARITEGYSGSDLTALAKDA 419          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Match: katnal2 (katanin p60 subunit A-like 2 [Source:ZFIN;Acc:ZDB-GENE-051113-156])

HSP 1 Score: 73.9442 bits (180), Expect = 7.437e-14
Identity = 60/226 (26.55%), Postives = 114/226 (50.44%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVREK--APLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXX---XVKGI-KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRH-------NGI-LTNHLDISSLTKLSDGYTMSDLNLVTQQV 2346
            L   +RLV E  + PI  P++     +P  K +LL GP G GKTML  ++ TE     F+++AS++  K+ G    + L+ ++F++ R   PS + +D+ E +  ++       + +  ++   +    + G+ + +D + V+  S+ P++ +      L +K IL+  P  A+R    R +IL H        G+ +   LD   L + ++GY+ SD+ LV ++ 
Sbjct:  262 LDAAKRLVKEAVVYPIKYPQLFTGILSPW-KGLLLYGPPGTGKTMLAKAVATECKTTFFNISASSIVSKWRGDS--EKLVKVLFELARYHAPSTIFLDELESVMGQRGAGGAGGEHEGSRRMKTELLVQMDGLARSDDLVFVLAASNLPWELDHAMLRRL-EKRILVDLPSAAAR----RAMILHHLPPVNSGTGLEIRTELDYEQLAQATEGYSGSDILLVCKEA 479          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 67.781 bits (164), Expect = 7.035e-12
Identity = 57/242 (23.55%), Postives = 120/242 (49.59%), Query Frame = 1
Query: 1795 KSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPED-RIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL-NLVTQQVLTERR-------IAQLSKKPLQANEFITHMARIDP-VYTEEEEAFKEWYKKTPLGK 2490
            K +LL GP G GKT++   I ++ GA  F ++AS L  K+ G +G KM+  L F V R  QP+++ +D+ + +  ++      S  +   + L +L       D R++++G ++ P + +      L ++ + +P PD A+R  +  +L+   +  L+   +++++ + S+G++ +D+  L  +  L   R       +  L  +P+   +F   +  + P V   + + + EW +    G+
Sbjct:  426 KGILLFGPPGTGKTLIGKCIASQSGATFFSISASCLTSKWVG-EGEKMVRAL-FAVARCRQPAVIFIDEIDSLLSQRADGEHDSSRRIKTEFLVQLDGATTARDERVLLVGATNRPQEIDEAARRRLAKR-LYVPLPDAAARRCLLERLLAPQSWQLSAE-ELAAVVERSEGFSGADVTQLCREAALGPIRAVPDITTVDALQVRPILIQDFAQALQVVRPSVSPRDLDLYVEWNRTFGCGQ 663          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Match: YTA6 (Putative ATPase of the CDC48/PAS1/SEC18 (AAA) family; localized to the cortex of mother cells but not to daughter cells; relocalizes from cytoplasm to plasma membrane foci upon DNA replication stress [Source:SGD;Acc:S000005995])

HSP 1 Score: 76.2554 bits (186), Expect = 1.104e-14
Identity = 55/231 (23.81%), Postives = 112/231 (48.48%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXX-----------XXXXXXXXXXXVKGIKPEDRIMVIGTSSAPF---DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTE 2355
            L + +  + E  + P   P++ +  + P ++ +LL GP G GKTM+  ++ TE  +  F ++AS+L  KY G+   + L+  +F + + L PSI+ +D+ + M   +    + S                        +    + R++V+G ++ P+   DA  + F     + + IP PDY +R    ++L+ +    L + LD   +T++++G++ SDL  + ++   E
Sbjct:  476 LRNAKNSLKEAVVYPFLRPDLFKGLREP-VRGMLLFGPPGTGKTMIAKAVATESNSTFFSVSASSLLSKYLGES--EKLVRALFYMAKKLSPSIIFIDEIDSMLTARSDNENESSRRIKTELLIQWSSLSSATAQSEDRNNTLDSRVLVLGATNLPWAIDDAARRRFS----RKLYIPLPDYETRLYHLKRLMAKQKNSLQD-LDYELITEMTEGFSGSDLTSLAKEAAME 698          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Match: MSP1 (Highly-conserved N-terminally anchored AAA-ATPase; distributed in the mitochondrial outer membrane and peroxisomes; involved in mitochondrial protein sorting; functions as an extraction engine in local organelle surveillance to remove and initiate degradation of mistargeted proteins, ensuring fidelity of organelle-specific localization of tail-anchored proteins; contains an N-terminal transmembrane domain and C-terminal cytoplasmic ATPase domain [Source:SGD;Acc:S000003260])

HSP 1 Score: 70.8626 bits (172), Expect = 2.037e-13
Identity = 60/216 (27.78%), Postives = 105/216 (48.61%), Query Frame = 1
Query: 1687 GGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKS---VLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL 2325
            GG++P   +SD+     E  I P+  PEV   +PL+++   VLL GP G GKTML  ++  E GAN   +  S++  K+ G+     ++  +F +   LQP I+ +D+ +   +++   TD      LK +   L  G+    R+M+IG ++   D +   F     K  L+  P    R  I   ++L+   +  +  D+  +   + G++ SDL
Sbjct:   94 GGLDPL--ISDLH----ESVIYPLMMPEVYSNSPLLQAPSGVLLYGPPGCGKTMLAKALAKESGANFISIRMSSIMDKWYGESN--KIVDAMFSLANKLQPCIIFIDEIDSFLRER-SSTDHEVTATLKAEFMTLWDGLLNNGRVMIIGATNRINDID-DAFLRRLPKRFLVSLPGSDQRYKIL-SVLLKDTKLDEDEFDLQLIADNTKGFSGSDL 298          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Match: VPS4 (AAA-ATPase involved in multivesicular body (MVB) protein sorting; ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane release; ATPase activity is activated by Vta1p; regulates cellular sterol metabolism [Source:SGD;Acc:S000006377])

HSP 1 Score: 70.0922 bits (170), Expect = 5.302e-13
Identity = 62/259 (23.94%), Postives = 129/259 (49.81%), Query Frame = 1
Query: 1696 EPQPSLSDVRRLVTEFCILPIGSPEV-REKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDR-IMVIGTSSAPF--DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFK 2460
            E    L   +  + E  ILP+  P + +        +LL GP G GK+ L  ++ TE  +  F +++S+L  K+ G+   + L+  +F + R  +PSI+ +D+ + +   +  + +    +R+K +L   + G+  + + ++V+G ++ P+  D+ ++     +++ I IP PD A+R  ++   +     +LT   D  +L  +++GY+ SD+ +V +  L +         P++  +  TH      V TE++E  K
Sbjct:  133 EDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGES--EKLVKQLFAMARENKPSIIFIDEVDALTGTR-GEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIR---RRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKE-DYRTLGAMTEGYSGSDIAVVVKDALMQ---------PIRKIQSATHFK---DVSTEDDETRK 372          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Match: SAP1 (Putative ATPase of the AAA family; interacts with the Sin1p transcriptional repressor in the two-hybrid system [Source:SGD;Acc:S000000849])

HSP 1 Score: 69.707 bits (169), Expect = 1.275e-12
Identity = 48/201 (23.88%), Postives = 94/201 (46.77%), Query Frame = 1
Query: 1792 IKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXX--------------------XXXXXXXXXVKGIKPEDRIMVIGTSSAPF---DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL 2325
            ++ +LL GP G GKTML  ++ TE  +  F ++AS+L  KY G+   + L+  +F + + L PSI+ VD+ + +   +  + +    +                               G + + R++V+  ++ P+   +A  + F     +   IP P+  +R++ ++KL+      LT   D   L K+++GY+ SD+
Sbjct:  638 VRGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSKYLGES--EKLVRALFAIAKKLSPSIIFVDEIDSIMGSRNNENENESSRRIKNEFLVQWSSLSSAAAGSNKSNTNNSDTNGDEDDTRVLVLAATNLPWSIDEAARRRFV----RRQYIPLPEDQTRHVQFKKLLSHQKHTLTES-DFDELVKITEGYSGSDI 831          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Match: YME1 (Catalytic subunit of i-AAA protease complex; complex is located in mitochondrial inner membrane; responsible for degradation of unfolded or misfolded mitochondrial gene products; serves as nonconventional translocation motor to pull PNPase into intermembrane space; also has role in intermembrane space protein folding; mutation causes elevated rate of mitochondrial turnover; human homolog YME1L1 can complement yeast null mutant [Source:SGD;Acc:S000006228])

HSP 1 Score: 56.9954 bits (136), Expect = 8.436e-9
Identity = 55/194 (28.35%), Postives = 94/194 (48.45%), Query Frame = 1
Query: 1789 LIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAP--FDAEL-KPFCSLYQKIILIPRPDYASRNIIWRKLILRHNG---ILTNHLDISSLTKLSDGYTMSDL-NLVTQQVL 2349
            L K VLLTGP G GKT+L  +   E G + F ++ S     Y G  G K +  L F   R   P+I+ +D+ + +  K+ PK   +  K+    L   + G      I++IG ++ P   D  L +P    + K++ +  PD     +  R  IL+H+     L +++D + + + + G + ++L NLV Q  +
Sbjct:  313 LPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGV-GAKRIRDL-FAQARSRAPAIIFIDELDAIGGKRNPKD-QAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRP--GRFDKVVNVDLPD-----VRGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAV 496          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO45340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT85])

HSP 1 Score: 447.203 bits (1149), Expect = 4.352e-145
Identity = 263/433 (60.74%), Postives = 321/433 (74.13%), Query Frame = 1
Query: 1216 MSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELK---PFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            M+ES+F+P + E +  Y+ VW+ R+E  NF Q HD E+IKE KR EVE EIR QVDELMRQEL+NLKM+VD         KK K    K GKK KKEKDLT               +RTIES+YEELV +GII +     L ++ GEY+YLGTTLRQ  IEP PSLSDVRR++TEF ILP+GS  V E++P+IKSVL+TGPRGVGK MLVH ICTE GANLFDLTA+N+ GKYPGK GL MLLH+VFKV R LQPS++ +   E+ F KK+PKTD SDPKRLKKDLPKL+K +KPEDR+++IGTS  PFD   K   P CS YQKI+L+PRPDYASR ++WR LIL++ G ++  +D+SSL K++DGYT   +    QQ+L+ERRI QLSK+PL A EF+  +ARIDP+Y EEEEAFK W+ KTPLGKKR KA
Sbjct:  360 MAESSFVPTVNEAAATYKDVWQFRDETGNFEQKHDAELIKEAKRIEVEEEIRKQVDELMRQELKNLKMAVD-RDKAGKKGKKGKKSGKKSGKKKKKEKDLT--------------ADRTIESIYEELVHEGIIVRPPKIHLRDFVGEYSYLGTTLRQANIEPMPSLSDVRRVITEFSILPLGSQAVHERSPMIKSVLITGPRGVGKKMLVHCICTETGANLFDLTAANIAGKYPGKAGLAMLLHMVFKVARQLQPSVVFIGDAERTFVKKVPKTDKSDPKRLKKDLPKLLKTLKPEDRVIIIGTSRQPFDILSKNPFPLCSSYQKILLVPRPDYASRYLLWRTLILKYGGRVSESMDLSSLAKITDGYTQGHMVQAIQQILSERRIQQLSKRPLTAAEFVAPLARIDPIYKEEEEAFKTWFSKTPLGKKRAKA 777          

HSP 2 Score: 370.163 bits (949), Expect = 1.235e-115
Identity = 179/308 (58.12%), Postives = 238/308 (77.27%), Query Frame = 1
Query:  142 KPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKS-DMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTP 1062
            KPEK ++AAFQ+ + MYIKYIQIFR++E+CYDQ+VHPQKR+V++ +LDG++GRI+E+KNEMV LE SE+HYFDDVLSDLKLTP DIEIPIPKYF+ E  K L EREKLLG ILAK  +G     +  ++M +D+AIR+IQ+HERARQGR+RAK M+EIR QE+++R   ++ A TMD + AA KIQ++W+G   R+  ++++EEE +++GMS     +   K   +  A K E+ R + Q   E+EY QALV+IK+KIRE EG DM E+M+DQIRQWF+E RD  GKFPDYP++++GGS  IFKEK P
Sbjct:    2 KPEKDRIAAFQMFAVMYIKYIQIFRRIEECYDQVVHPQKRRVLRHLLDGIMGRILELKNEMVQLEFSEFHYFDDVLSDLKLTPDDIEIPIPKYFIYENSKELQEREKLLGGILAK--MGPQDTPTVKIQMTVDDAIRLIQVHERARQGRLRAKFMREIRQQEERERQAQLRGAPTMDPDIAATKIQKVWKGFAQRKRTQRLREEELIFVGMSAEPEQDK--KDTPMFAADKTETHRHVIQEEHEREYQQALVSIKEKIREIEGPDMKENMQDQIRQWFIECRDKSGKFPDYPDDDEGGSAAIFKEKDP 305          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: KATNA1 (Katanin p60 ATPase-containing subunit A1 [Source:UniProtKB/TrEMBL;Acc:A7RMS0])

HSP 1 Score: 71.2478 bits (173), Expect = 6.218e-13
Identity = 61/235 (25.96%), Postives = 122/235 (51.91%), Query Frame = 1
Query: 1708 SLSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI--KPED----RIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGI-LTNHLDISSLTKLSDGYTMSDLNLVTQQ---VLTERRIAQLS 2376
             L + ++L+ E  +LP+  P+  +  + P  + VL+ GP G GKTML  ++ TE G   F++++S L  KY G+   + L+ ++F++ R   PS + VD+ + +  ++   ++    +R+K +L   + G+    +D    ++MV+  ++ P+D + +      +K I IP P    R +   K+ LR  G+ ++  + +  +    DGY+ +D+  V +    +   RRI  L+
Sbjct:  207 DLHEAKKLLEEAVVLPLLMPDYFQGIRRPW-RGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGES--EKLVRILFEMARFYAPSTIFVDEIDSICSRRGSDSEHEASRRVKSELLVQMDGVGGSSDDGETKQVMVLAATNFPWDLD-EALRRRLEKRIYIPLPTAEGR-LELLKINLR--GVQMSEDVILEEVANKMDGYSGADITNVCRDASMMAMRRRIKGLT 434          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO42053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J4])

HSP 1 Score: 66.2402 bits (160), Expect = 1.237e-11
Identity = 57/203 (28.08%), Postives = 94/203 (46.31%), Query Frame = 1
Query: 1732 VTEFCILPIGSPEVREKAPLI---KSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI--KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL 2325
            V E  ILPI    +  K+ L+   K VLL GP G GKTM+  +   E G    +L  S+L  K+ G+   + L   VF +   LQP I+ +D+ +   + +  K+D      +K     L  G+  +P  +++V+G ++ P D + K           +  PD   R  I R ++   N      L++  L  ++ G++ SDL
Sbjct:   95 VKETIILPIQKSHIFSKSKLLSPPKGVLLHGPPGCGKTMIAKATAKEAGCRFLNLQVSSLTDKWYGES--QKLAAAVFSLALKLQPCIIFIDEIDSFLRAR-DKSDHEATAMMKAQFMSLWDGLVTEPNCQVIVMGATNRPQDVD-KAILRRMPAAFHVGLPDERQREEILRIILQSENVDGEVFLNLDELAAITCGFSGSDL 293          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO36214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJD2])

HSP 1 Score: 60.8474 bits (146), Expect = 7.905e-10
Identity = 58/232 (25.00%), Postives = 114/232 (49.14%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVREK--APLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIP---KTXXXXXXXXXXXXXXXVKGI-KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHN-----------GI-LTNHLDISSLTKL--SDGYTMSDLNLVTQQV 2346
            L   +RLV E  + PI  P++     +P  K +LL GP G GKT+L  ++ TE     F+++AS++  K+ G    + L+ ++F++ R   PS + +D+ E +  ++       +     R+K +L   + G+ + +D + ++  S+ P++ +      L +K IL+  P   +     RK +L  N           G+ +   +D   L K+  ++GY+ SD+ L+ ++ 
Sbjct:   42 LDAAKRLVKEAVVYPIKYPQLFTGILSPW-KGLLLYGPPGTGKTLLAKAVATECNTTFFNISASSIVSKWRGDS--EKLVRVLFELARFHAPSTIFLDELESLMSQRGTGGGGAEHEGSLRMKTELLVQMDGLARSDDLVFLLAASNLPWELDHAMLRRL-EKRILVDLPTLEA-----RKAMLMQNLPPVISASDGKGVEIRTEIDYDMLAKVTRAEGYSGSDIKLLAKEA 264          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO34160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ60])

HSP 1 Score: 58.5362 bits (140), Expect = 5.721e-9
Identity = 58/220 (26.36%), Postives = 110/220 (50.00%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVREKAPLI--KSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPK--TXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAP--FD-AELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNH--LDISSLTKLSDGYTMSDL-NLVTQ 2340
            LS+  R + E   LP+ +PE+ ++  +   K  LL GP G GKT+L  ++ ++L AN   + +S +  KY G+     L+  +F   R  +P I+ +D+ + +  ++  +  +   + +R   +L   + G     ++ +I  ++ P   D A L+P      + I I  P+  +R  I +     H+  +T H  +D  ++ KLSDG+  +DL N+ T+
Sbjct:  140 LSEQIRELREVIELPLTNPELFQRVGIAPPKGCLLFGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESA--RLIREMFGYARDHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDVLGQVKMIMATNRPDTLDPALLRP--GRLDRKIEIALPNEQARMDILKI----HSSRITKHGEIDYEAVVKLSDGFNGADLRNVCTE 351          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: IQCA1L (IQ motif containing with AAA domain 1 [Source:NCBI gene;Acc:101169434])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 391/822 (47.57%), Postives = 540/822 (65.69%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPE--KSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMK-MPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSF--KSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXX-XXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIKA 2505
            MS   YN  W +AQ  L  +LA E+  E+P+  K ++  FQ L+ +Y++YIQI RKL++ ++ I+HPQKR+ I+KV+D V+GR++E+KNEMV  E  EYHY DD+L D+KLTP  +EIP+P+YF  +  K + ER+ +L +I    +  E  E S  K M  +EAIR+IQ+ ERARQGR+R+K+ +E R  E   R+T+  T  T     AA+ IQ++WRG + R+  K  + +E + LGM    V +  +   S         E+  R+KQ   E  Y +A+V + +++RE EG++M+ ++K Q+R+WF + R++ G FPDYP+EEDGGS  IF EK+P+++ EE+        K  +    K +  + +  K K  K   D++EE G KM  S FL  +    + +   W +R+E  NF+Q HD E+IKEEKR+ VE EIR+QVDE MRQEL  LK+SVDK+K  +     +K K  K GKK KKEKDLT               +RT+ESL +ELV QG++K+    +L ++ G++NYLGTTLRQ  IEP PSLSDVR++++ + ILP+GS  V EKAPLIKS+LL GP G GK MLVH++C E GA LFDL+  N  GKYPGK GL M++H+VFKV RLLQPS++ +   EKMF KK+PK +     KRLKKDLPK +K IK EDR+++IGT+  P  A++K  C +Y KI+LIPRPDY SR I+W++LI +  G  T  LD+SSL K+SDGYT   +    Q V+TERRI Q   +PL A EF+  +ARIDPV+ E+EEA K WY KTPLG+KR+KA
Sbjct:    1 MSQRAYNDLWADAQLELSRLLAEEQPAEQPQPQKDRVVFFQRLAMLYVRYIQILRKLQKAHELIIHPQKRRAIRKVIDSVMGRVVELKNEMVEKEFLEYHYMDDILHDMKLTPDKLEIPLPQYFPNDHSKEVQERKAMLMKIFKMVEATESLEPSTEKEMTQEEAIRVIQVAERARQGRMRSKLYEESR--EASLRSTNAGTEST---ELAAICIQKVWRGYIQRKKTKIERVKELIALGM----VMDPKYLAPSPAEVALLAAEACTRLKQQEHEAAYQKAVVAVTNQLREMEGNNMSNTLKSQVREWFFKCRNVTGSFPDYPDEEDGGSAFIFAEKSPQQVLEEI------AAKEDEASSNKSRGKEEQKEKRKPDKKMIDEQEEAGLKMHPSAFLSDLEAADKTFNDFWSSRDETENFSQKHDVELIKEEKRKVVEDEIRVQVDEQMRQELAELKLSVDKDKGGKTKANTKKKKGSKSGKKKKKEKDLT--------------ADRTLESLCQELVEQGLLKQPNDVRLQDFLGDFNYLGTTLRQNDIEPMPSLSDVRQVISLYAILPLGSQVVHEKAPLIKSILLVGPEGAGKKMLVHAVCQETGATLFDLSPLNTAGKYPGKSGLAMMVHVVFKVARLLQPSVIWIGDAEKMFYKKVPKEEKELDPKRLKKDLPKSLKLIKGEDRVLIIGTTEDPMSADIKSMCKMYNKILLIPRPDYGSRYIMWKELINQKGGETTKALDLSSLAKISDGYTPGHMVKAIQSVVTERRIRQQGSRPLTAAEFVAPLARIDPVFQEQEEALKNWYAKTPLGRKRVKA 793          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: spast (spastin [Source:NCBI gene;Acc:101167644])

HSP 1 Score: 85.5001 bits (210), Expect = 5.639e-17
Identity = 70/267 (26.22%), Postives = 137/267 (51.31%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKP--EDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVL----------TERRIAQLSKKPLQANEFITHMARIDPVYTEEE-EAFKEWYKK 2475
             ++ + E  ILP   PE+    +AP  + +LL GP G GKTML  ++  E  A  F+++A++L  KY G +G K L+  +F V R LQPS++ +D+ + +  ++  + +    +RLK +      G++   +DR++V+G ++ P + + +     + K I +  PD  +R  + + L+ +H   L  + DI+ L+K++ G++ SDL  + +               R ++    + +Q  +F   + RI P  +    + + +W K+
Sbjct:  207 AKQALQEIVILPALRPELFTGLRAP-ARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVG-EGEK-LVRALFAVARELQPSVIFIDEVDSLLCER-REGEHDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELD-EAILRRFAKRIYVSLPDEKTRFTLLKNLLGKHGNPLGTN-DITYLSKVTAGFSGSDLTSLAKDAALGPIRELGPDQVRNMSASEVRNIQKKDFEDSLKRIKPTVSPATLDMYAKWNKE 467          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: katna1 (katanin catalytic subunit A1 [Source:NCBI gene;Acc:101169256])

HSP 1 Score: 77.0258 bits (188), Expect = 2.663e-14
Identity = 64/238 (26.89%), Postives = 116/238 (48.74%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI-------KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASR----NIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQ---VLTERRIAQLS 2376
            L D ++L+ E  +LP+  PE  +  + P  K VL+ GP G GKT+L  ++ TE     F++++S L  KY G+   + L+ L+F++ R   P+ + +D+ + M  ++    +    +R+K +L   + G+        P   +MV+  ++ P+D + +      +K I IP P    R     I  R+L L  N +L        + +  DGY+ +D+  V +    +   RRI  L+
Sbjct:  214 LEDAKKLLKEAVVLPMWMPEFFKGIRRPW-KGVLMVGPPGTGKTLLAKAVATECRTTFFNVSSSTLTSKYRGES--EKLVRLLFEMARFYAPTTIFIDEIDSMCSRRGTSEEHEASRRVKAELLVQMDGVGGASENEDPSKMVMVLAATNFPWDID-EALRRRLEKRIYIPLPSTTGRVELLRINLRELELASNVVL------DKIAEQMDGYSGADITNVCRDASLMAMRRRIEGLT 441          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: katnal1 (katanin p60 ATPase-containing subunit A-like 1 [Source:NCBI gene;Acc:101163120])

HSP 1 Score: 74.7146 bits (182), Expect = 1.805e-13
Identity = 62/241 (25.73%), Postives = 122/241 (50.62%), Query Frame = 1
Query: 1708 SLSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI-------KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQ---VLTERRIAQLSKKPLQA 2394
             L D ++L+ E  +LP+  P+  +  + P  K VL+ GP G GKTML  ++ TE G   F++++S L  KY G+   + L+ L+F++ R   P+ + +D+ + +  ++    +    +R+K +L   + G+        P   +MV+  ++ P+D + +      +K I IP P    R +   K+ L+    L   +++  + +  +GY+ +D+  V +    +   RRI  LS + ++A
Sbjct:  209 DLEDAKKLLREAVVLPMWMPDFFKGIRRPW-KGVLMIGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGES--EKLVRLLFEMARFYAPATIFIDEIDSICGRRGTSDEHEASRRVKSELLVQMDGVGGAQENDDPSKMVMVLAATNFPWDID-EALRRRLEKRIYIPLPTAVGR-VELLKINLKEVE-LAPDVELDLIAQKIEGYSGADITNVCRDASMMAMRRRIHGLSPEEIRA 443          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: katnal2 (katanin catalytic subunit A1 like 2 [Source:NCBI gene;Acc:101168474])

HSP 1 Score: 72.0182 bits (175), Expect = 9.587e-13
Identity = 60/221 (27.15%), Postives = 109/221 (49.32%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVREK--APLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVK--GI-KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNII---WRKLILRHNGI-LTNHLDISSLTKLSDGYTMSDLNLVTQQV 2346
            L D +RLV E  + PI  P++     +P  K +LL GP G GKT+L  ++ TE     F+++AS++  K+ G    + L+ ++F++ R   PS + +D+ E +  ++            +     LV+  G+ + ED + V+  S+ P++ +      L +K IL+  P   +R  +   W   +    G+ L   LD   L +  +GY+ SD+ LV ++ 
Sbjct:  207 LEDAKRLVKEAVVYPIKYPQLFTGILSPW-KGLLLYGPPGTGKTLLAKAVATECRTTFFNISASSIVSKWRGDS--EKLVRVLFELARYHAPSTIFLDELESVMGQRGTSLGGEHEGSRRMKTELLVQMDGLSRSEDLVFVLAASNLPWELDHAMLRRL-EKRILVGLPSSPARQAMISHWLPPLSSTGGMELRTSLDYKMLAEQMEGYSGSDIRLVCKEA 423          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000073596.1 (SMESG000073596.1)

HSP 1 Score: 1382.85 bits (3578), Expect = 0.000e+0
Identity = 797/815 (97.79%), Postives = 800/815 (98.16%), Query Frame = 1
Query:   58 MSHNTYNKQWHEAQQNLQDILAYEEIPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPXXXXXXXXXXXXXXXXXQVDELMRQELRNLKMSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTPERFIL*GTYCTMNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 2502
            MSHNTYNKQWHEAQQNLQDILAYE +PEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFKKEMGEDKNKKKGKGKGKDDKIKSGKEKKGKG+KDDEEEEGWKMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPEIIKEEKRREVEAEIRIQVDELMRQELRNLKMSVDKEKAKRINKKKRKGKKGKKGKKGKKEKDLTPER              TIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILP+GSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTDLSDPKRLKKDLPKLVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK
Sbjct:    1 MSHNTYNKQWHEAQQNLQDILAYEAVPEKPEKSQLAAFQLLSTMYIKYIQIFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYFDDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIKEKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTAQTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKSVQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQIRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFKKEMGEDKNKKKGKGKGKDDKIKSGKEKKGKGKKDDEEEEGWKMSESNFLPFITEGSQIYEGVWKNRNEENNFAQGHDPEIIKEEKRREVEAEIRIQVDELMRQELRNLKMSVDKEKAKRINKKKRKGKKGKKGKKGKKEKDLTPER--------------TIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQPSLSDVRRLVTEFCILPMGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTDLSDPKRLKKDLPKLVKGIKPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEAFKEWYKKTPLGKKRIK 801          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000045800.1 (SMESG000045800.1)

HSP 1 Score: 78.9518 bits (193), Expect = 7.151e-15
Identity = 56/210 (26.67%), Postives = 120/210 (57.14%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGI--KPEDRIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDY-ASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL 2325
            L   ++++ E  +LP+  P++    +AP  K +LL GP G GKT++   I ++  +  F ++AS+L  K+ G DG KM + ++F V RLLQP+++ +D+ + +  ++  +T+    +++K      ++G+     ++++ IG ++ P++ + +     + K + IP P   A R II++  +L++  +     ++ S+ + SDGY+ +D+
Sbjct:  272 LESPKQIIQEIVMLPMLRPDLFTGIRAP-AKGLLLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVG-DGEKM-VRIMFTVARLLQPAVIFIDEIDSLLSQR-NETEHESSRKIKTQFLVEMEGVGTGENEKLLFIGATNRPYEID-EAVRRRFVKRVYIPLPSAKARRQIIYK--LLKNESLNITEEELESILEKSDGYSGADM 474          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000070700.1 (SMESG000070700.1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.035e-15
Identity = 72/254 (28.35%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 1720 VRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKP--EDRIMVIGTSSAPF---DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL-NLVTQQVLTERR---------IAQLSKKPLQANEFITHMARIDP 2430
             ++ + E  I P   PE+    ++P  K +LL GP G GKT+L  ++  E     F+++A++L  K+ G +G KM+  L F V   + PS++ +D+ + +   +    D S  +R+     + + G     E +++V+  ++ P    DA L+ F    QK I I  P+ +SR  +++KL+ + N  L ++ DI  L +L+ GY+ SDL NL     +   R         +   S +PL+ N+F+  + +I P
Sbjct:  278 AKQCLLETVIYPKLRPELFTGLRSP-AKGILLFGPPGNGKTLLAKAVANESQCVFFNISAASLMSKWVG-EGEKMVRAL-FAVAHYVSPSVIFLDEVDSLLSAR-NSDDKSVSRRMLTQFLQEIDGAATDGEGKVLVMAATNRPDELDDAALRRF----QKKIYIKMPEASSRKFLFKKLLTQQNTKLKDN-DIEKLVELTKGYSSSDLTNLAKTAAMIPIRELSFEQICSVTVDSMRPLKLNDFMLALKQIKP 522          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000069747.1 (SMESG000069747.1)

HSP 1 Score: 75.0998 bits (183), Expect = 9.301e-14
Identity = 65/280 (23.21%), Postives = 135/280 (48.21%), Query Frame = 1
Query: 1708 SLSDVRRLVTEFCILPIGSPEVRE--KAPLIKSVLLTGPRGVGKTMLVHSICTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPED--------RIMVIGTSSAPFDAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGI-LTNHLDISSLTKLSDGYTMSDLNLVT--------QQVLTERRIAQLSK-------KPLQANEFITHMARIDPVYTEEE-EAFKEW 2466
             L + +RL+ E  +LP+  P      + P  K VL+ GP G GKT+L  ++ TE     F +T+S+L  K+ G+   + L+ ++F + R   PS + +D+ + +  K+   +     +R+  +L   + GI   +         + ++G ++ P+D + +      +K I IP P    R ++   L +    I L++ +D+ ++ +   GY+ SD+  V         ++V+  + + +L K        P+   +F T ++RI+   ++ + E +++W
Sbjct:  193 DLDEAKRLLKEAIVLPLLLPNYFTGLRKPW-KGVLMFGPPGTGKTLLAKAVATECQTTFFSVTSSSLTSKWRGES--EKLIRILFDMARFYAPSTIFIDEIDAIGSKRDDGSGNESNRRVMSELLIQIDGISSSNGQEYDATKSVTILGATNLPWDLD-EALRRRLEKRIYIPLPGGVGRRVL---LDINLKAIDLSDDVDLDAIAEKLTGYSGSDITQVCRDAAMMQLRRVVEGKSVEELKKLAAGDTTLPISMEDFETSVSRINKSVSQADIEKYEKW 465          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000009448.1 (SMESG000009448.1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.080e-13
Identity = 64/238 (26.89%), Postives = 131/238 (55.04%), Query Frame = 1
Query: 1711 LSDVRRLVTEFCILPIGSPEV--REKAPLIKSVLLTGPRGVGKTMLVHSICTEL-GANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQCEKMFKKKIPKTXXXXXXXXXXXXXXXVKGIKPE-DRIMVIGTSSAPF--DAELKPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSDGYTMSDL-NLVTQQVLTERRIAQLSKKPLQANEF 2403
            L   +  + E  ILP+  P++   ++ P  + +LL GP G GK+ L  ++ TE   +  F +++S+L  K+ G+   + L+  +F++ R  +PSI+ +D+ + M   +  +++    +R+K +    ++G+  + D+++V+  ++ P+  D+ ++     ++K I IP PD  +R +++R L L       +  DI+SL+K ++GY+ SD+ NLV + ++      Q  KK + A  F
Sbjct:  127 LHGAKEALQEAVILPLKFPDLFTGKRKPW-RGILLYGPPGTGKSYLAKAVATEAENSTFFAISSSDLVSKWLGES--EKLVKNLFELAREHRPSIIFIDEIDSMCGSRS-ESESESARRIKTEFLVQMEGVGAQNDKVLVLAATNIPWALDSAIR---RRFEKRIYIPLPDLGARALLFR-LSLGDTPNTISEADINSLSKRTEGYSGSDIANLVREAIM------QPVKKVMSATHF 350          
The following BLAST results are available for this feature:
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQCA10.000e+049.88IQ motif containing with AAA domain 1 [Source:HGNC... [more]
IQCA10.000e+048.31IQ motif containing with AAA domain 1 [Source:HGNC... [more]
IQCA10.000e+049.39IQ motif containing with AAA domain 1 [Source:HGNC... [more]
IQCA10.000e+049.93IQ motif containing with AAA domain 1 [Source:HGNC... [more]
IQCA1L0.000e+042.91IQ motif containing with AAA domain 1 like [Source... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
figl-18.934e-1526.77Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
figl-18.934e-1526.77Fidgetin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
spas-12.327e-1229.76Probable spastin homolog spas-1 [Source:UniProtKB... [more]
spas-12.456e-1229.76Probable spastin homolog spas-1 [Source:UniProtKB... [more]
mspn-11.072e-1124.88Mitochondrial sorting homolog [Source:UniProtKB/S... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG167898.415e-15838.52gene:FBgn0037712 transcript:FBtr0332806[more]
CG167891.244e-15738.52gene:FBgn0037712 transcript:FBtr0082071[more]
CG141835.687e-2827.39gene:FBgn0036931 transcript:FBtr0074907[more]
Kat603.017e-1523.83gene:FBgn0040208 transcript:FBtr0078827[more]
Kat603.187e-1523.83gene:FBgn0040208 transcript:FBtr0334909[more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1537380.000e+049.88zgc:153738 [Source:ZFIN;Acc:ZDB-GENE-061013-622][more]
iqca16.614e-12351.27IQ motif containing with AAA domain 1 [Source:ZFIN... [more]
zgc:1537381.618e-10848.97zgc:153738 [Source:ZFIN;Acc:ZDB-GENE-061013-622][more]
iqca11.593e-10147.95IQ motif containing with AAA domain 1 [Source:ZFIN... [more]
iqca11.078e-9848.79IQ motif containing with AAA domain 1 [Source:ZFIN... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQCA18.379e-11052.49IQ motif containing with AAA domain 1 [Source:NCBI... [more]
IQCA17.619e-10951.96IQ motif containing with AAA domain 1 [Source:NCBI... [more]
FIGN1.460e-1528.15fidgetin, microtubule severing factor [Source:NCBI... [more]
FIGN1.598e-1528.15fidgetin, microtubule severing factor [Source:NCBI... [more]
FIGN1.611e-1528.15fidgetin, microtubule severing factor [Source:NCBI... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iqca0.000e+052.01IQ motif containing with AAA domain [Source:MGI Sy... [more]
Iqca0.000e+049.76IQ motif containing with AAA domain [Source:MGI Sy... [more]
Iqca1l0.000e+043.39IQ motif containing with AAA domain 1 like [Source... [more]
Iqca1l3.058e-3537.10IQ motif containing with AAA domain 1 like [Source... [more]
Iqca2.540e-2671.21IQ motif containing with AAA domain [Source:MGI Sy... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86XH1|DRC11_HUMAN0.000e+049.88Dynein regulatory complex protein 11 OS=Homo sapie... [more]
sp|Q9CUL5|DRC11_MOUSE0.000e+049.76Dynein regulatory complex protein 11 OS=Mus muscul... [more]
sp|A6H690|IQCAL_MOUSE0.000e+043.39IQ and AAA domain-containing protein 1-like OS=Mus... [more]
sp|A6NCM1|IQCAL_HUMAN0.000e+042.91IQ and AAA domain-containing protein 1-like OS=Hom... [more]
sp|Q6AXQ7|IQCAL_RAT0.000e+042.84IQ and AAA domain-containing protein 1-like OS=Rat... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RKE50.000e+062.20IQ and AAA domain-containing protein 1 OS=Crassost... [more]
V4AB810.000e+059.95ATPase_AAA_core domain-containing protein OS=Lotti... [more]
R7UA000.000e+060.65ATPase_AAA_core domain-containing protein OS=Capit... [more]
A0A210QR770.000e+061.17IQ and AAA domain-containing protein 1 OS=Mizuhope... [more]
A0A2T7NTS10.000e+057.23ATPase_AAA_core domain-containing protein OS=Pomac... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1537380.000e+049.51IQ and AAA domain-containing protein 1-like [Sourc... [more]
iqca13.195e-11057.91IQ motif containing with AAA domain 1 [Source:ZFIN... [more]
iqca18.021e-10548.29IQ motif containing with AAA domain 1 [Source:ZFIN... [more]
zgc:1537381.613e-9947.02IQ and AAA domain-containing protein 1-like [Sourc... [more]
fign1.075e-1526.59fidgetin, microtubule severing factor [Source:NCBI... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000520.16.593e-13958.56pep scaffold:Pmarinus_7.0:GL478568:5536:22262:-1 g... [more]
ENSPMAT00000007508.16.441e-1829.11pep scaffold:Pmarinus_7.0:GL478692:23769:36372:1 g... [more]
spast1.798e-1629.11spastin [Source:NCBI gene;Acc:405851][more]
katnal27.437e-1426.55katanin p60 subunit A-like 2 [Source:ZFIN;Acc:ZDB-... [more]
fignl17.035e-1223.55fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YTA61.104e-1423.81Putative ATPase of the CDC48/PAS1/SEC18 (AAA) fami... [more]
MSP12.037e-1327.78Highly-conserved N-terminally anchored AAA-ATPase;... [more]
VPS45.302e-1323.94AAA-ATPase involved in multivesicular body (MVB) p... [more]
SAP11.275e-1223.88Putative ATPase of the AAA family; interacts with ... [more]
YME18.436e-928.35Catalytic subunit of i-AAA protease complex; compl... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453404.352e-14560.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
KATNA16.218e-1325.96Katanin p60 ATPase-containing subunit A1 [Source:... [more]
EDO420531.237e-1128.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362147.905e-1025.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341605.721e-926.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQCA1L0.000e+047.57IQ motif containing with AAA domain 1 [Source:NCBI... [more]
spast5.639e-1726.22spastin [Source:NCBI gene;Acc:101167644][more]
katna12.663e-1426.89katanin catalytic subunit A1 [Source:NCBI gene;Acc... [more]
katnal11.805e-1325.73katanin p60 ATPase-containing subunit A-like 1 [So... [more]
katnal29.587e-1327.15katanin catalytic subunit A1 like 2 [Source:NCBI g... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073596.10.000e+097.79SMESG000073596.1[more]
SMESG000045800.17.151e-1526.67SMESG000045800.1[more]
SMESG000070700.18.035e-1528.35SMESG000070700.1[more]
SMESG000069747.19.301e-1423.21SMESG000069747.1[more]
SMESG000009448.13.080e-1326.89SMESG000009448.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018495 ID=SMED30018495|Name=ATPase_AAA_core domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2518bp
TTTGTTTTAATGTTCTAAAGATTTTATATTAATTCTATAGTAACACGAAA
ATATTTAATGTCTCATAATACATATAATAAACAATGGCATGAAGCTCAGC
AAAATCTTCAGGATATTTTAGCGTATGAAGAAATTCCTGAAAAACCTGAG
AAAAGTCAATTAGCTGCTTTCCAATTATTATCCACAATGTATATAAAATA
CATCCAAATTTTCAGAAAGTTAGAACAATGTTACGATCAAATAGTTCATC
CACAGAAGAGAAAAGTCATTAAAAAAGTGTTAGATGGTGTTATAGGTCGA
ATAATCGAAATAAAAAATGAAATGGTGAATCTTGAACTTTCCGAATACCA
TTACTTTGATGATGTTTTATCTGATTTGAAACTTACCCCACAGGACATTG
AAATTCCCATTCCAAAATATTTTGTAGTTGAAAGGAAAAAGATTTTAAAC
GAACGGGAAAAGCTATTAGGACAAATATTAGCGAAATCTCAATTAGGGGA
AATTAAAGAGAAATCTGACATGAAAATGCCTTTAGATGAAGCAATACGTA
TGATTCAAATTCACGAAAGAGCTCGTCAAGGTAGAATAAGAGCTAAGGTA
ATGCAGGAAATTCGATTTCAGGAAGATAAAGATAGAAATACTCATATTAA
AACAGCTCAAACTATGGATTTCAATGAAGCAGCTTTAAAGATTCAGAGAA
TGTGGCGTGGAATTTTGTCAAGACGTTATGTTAAAAAGATTAAGGAAGAA
GAATTTGTTTGGCTTGGAATGTCAACACCTTTGGTGACTAATACATCATT
TAAAAGTGTGCAACTTCAAAGAGCAACTAAGATTGAAAGTGATCGTCGAA
TCAAGCAGGCAATGTTTGAACAAGAATATAATCAAGCATTAGTAACAATA
AAAGATAAAATTCGAGAAACAGAAGGATCAGATATGAATGAATCAATGAA
AGATCAAATTCGGCAGTGGTTTCTTGAATCAAGGGATATTCTAGGAAAAT
TTCCTGATTATCCAGAAGAAGAAGATGGGGGTTCAATAAATATATTCAAA
GAAAAAACTCCAGAAGAATTAGCTGAAGAGTTATTTAAAAAAGAAATGGG
AGAAGATAAAAACAAAAAGAAAGGTAAAGGTAAAGGCAAAGATGATAAAA
TTAAATCTGGTAAAGAGAAAAAAGGTAAAGGTAGAAAGGATGATGAAGAA
GAAGAAGGTTGGAAAATGTCAGAATCAAATTTTCTTCCTTTCATTACAGA
AGGTAGTCAAATATATGAAGGTGTGTGGAAAAATAGAAATGAGGAAAATA
ATTTTGCTCAAGGTCATGATCCAGAAATTATTAAAGAAGAAAAGCGACGC
GAAGTTGAAGCTGAAATAAGAATACAGGTAGACGAACTAATGAGGCAAGA
ATTAAGAAATTTGAAAATGAGTGTGGATAAAGAAAAAGCAAAAAGAATAA
ATAAAAAGAAGAGGAAAGGAAAGAAGGGTAAGAAAGGTAAAAAAGGAAAA
AAGGAAAAAGATTTAACTCCAGAAAGGTTTATTTTATGAGGCACTTATTG
TACTATGAATATTAATAGAACTATTGAATCTTTGTATGAAGAATTGGTTA
TTCAAGGAATAATTAAAAAGAATGTAACAACACAACTTTCTGAATATGAA
GGTGAATACAATTATCTTGGGACGACGTTACGTCAAGGAGGTATTGAACC
TCAGCCTTCTTTGAGTGACGTTAGACGATTAGTAACAGAATTTTGTATTT
TACCAATTGGATCACCAGAAGTTAGGGAAAAAGCTCCATTGATTAAATCG
GTTTTACTTACTGGACCTAGAGGTGTTGGAAAAACCATGTTAGTACATTC
CATATGTACTGAGTTAGGAGCTAATCTTTTTGATTTAACAGCATCAAATC
TTCAAGGAAAATATCCTGGCAAAGACGGCTTAAAAATGTTATTACATTTG
GTATTTAAAGTAGGACGACTATTGCAACCTTCAATATTATTGGTAGATCA
ATGTGAAAAAATGTTTAAAAAGAAAATACCTAAAACTGACTTGTCCGACC
CGAAAAGATTAAAAAAAGATCTTCCTAAGTTAGTGAAAGGAATTAAACCT
GAAGATCGTATTATGGTCATTGGAACTTCTTCAGCCCCATTTGATGCTGA
ACTCAAACCGTTTTGTTCTCTTTATCAAAAAATTATTTTGATTCCCAGAC
CGGATTACGCATCTAGAAATATTATTTGGAGGAAACTAATACTTCGGCAC
AATGGTATTTTAACTAATCACCTTGATATTAGTTCACTAACTAAACTTTC
TGACGGATATACAATGAGTGACTTGAATTTAGTTACTCAGCAAGTTCTTA
CAGAACGAAGAATAGCCCAGCTATCGAAAAAACCTCTTCAAGCCAATGAA
TTTATTACTCACATGGCTCGTATTGATCCTGTTTATACGGAAGAAGAAGA
AGCTTTTAAAGAATGGTATAAAAAAACTCCCCTAGGTAAGAAAAGAATAA
AGGCTCAAGAAGCGGAAT
back to top

protein sequence of SMED30018495-orf-1

>SMED30018495-orf-1 ID=SMED30018495-orf-1|Name=SMED30018495-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MNINRTIESLYEELVIQGIIKKNVTTQLSEYEGEYNYLGTTLRQGGIEPQ
PSLSDVRRLVTEFCILPIGSPEVREKAPLIKSVLLTGPRGVGKTMLVHSI
CTELGANLFDLTASNLQGKYPGKDGLKMLLHLVFKVGRLLQPSILLVDQC
EKMFKKKIPKTDLSDPKRLKKDLPKLVKGIKPEDRIMVIGTSSAPFDAEL
KPFCSLYQKIILIPRPDYASRNIIWRKLILRHNGILTNHLDISSLTKLSD
GYTMSDLNLVTQQVLTERRIAQLSKKPLQANEFITHMARIDPVYTEEEEA
FKEWYKKTPLGKKRIKAQEAE
back to top

protein sequence of SMED30018495-orf-2

>SMED30018495-orf-2 ID=SMED30018495-orf-2|Name=SMED30018495-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=494bp
MSHNTYNKQWHEAQQNLQDILAYEEIPEKPEKSQLAAFQLLSTMYIKYIQ
IFRKLEQCYDQIVHPQKRKVIKKVLDGVIGRIIEIKNEMVNLELSEYHYF
DDVLSDLKLTPQDIEIPIPKYFVVERKKILNEREKLLGQILAKSQLGEIK
EKSDMKMPLDEAIRMIQIHERARQGRIRAKVMQEIRFQEDKDRNTHIKTA
QTMDFNEAALKIQRMWRGILSRRYVKKIKEEEFVWLGMSTPLVTNTSFKS
VQLQRATKIESDRRIKQAMFEQEYNQALVTIKDKIRETEGSDMNESMKDQ
IRQWFLESRDILGKFPDYPEEEDGGSINIFKEKTPEELAEELFKKEMGED
KNKKKGKGKGKDDKIKSGKEKKGKGRKDDEEEEGWKMSESNFLPFITEGS
QIYEGVWKNRNEENNFAQGHDPEIIKEEKRREVEAEIRIQVDELMRQELR
NLKMSVDKEKAKRINKKKRKGKKGKKGKKGKKEKDLTPERFIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR003959ATPase_AAA_core
IPR027417P-loop_NTPase
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 207..226
e-value: 2.1E-4
score: 20.8
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 206..232
score: 9.157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..493
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 344..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 344..389
NoneNo IPR availablePANTHERPTHR14690:SF8DYNEIN REGULATORY COMPLEX PROTEIN 11coord: 1..492
NoneNo IPR availablePANTHERPTHR14690UNCHARACTERIZEDcoord: 1..492