Disheveled-associated activator of morphogenesis

Overview
NameDisheveled-associated activator of morphogenesis
Smed IDSMED30018494
Length (bp)3443
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disheveled-associated activator of morphogenesis (SMED30018494) t-SNE clustered cells

Violin plots show distribution of expression levels for Disheveled-associated activator of morphogenesis (SMED30018494) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disheveled-associated activator of morphogenesis (SMED30018494) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disheveled-associated activator of morphogenesis (SMED30018494) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018494

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018494h1SMcG0021060 dd_Smed_v4_7476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018494h1SMcG0021060 dd_Smed_v4_7476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Match: DAAM1 (dishevelled associated activator of morphogenesis 1 [Source:HGNC Symbol;Acc:HGNC:18142])

HSP 1 Score: 148.288 bits (373), Expect = 1.778e-35
Identity = 106/366 (28.96%), Postives = 183/366 (50.00%), Query Frame = 2
Query: 1958 LPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            L  K++P   + L K FNWSK+P +KL  ++W+ ID+   +  +DLE L+  FS              K   +  ++  LS  L    +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P +  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V  +           +++L    KD
Sbjct:  598 LKKKSIPQPTNAL-KSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSVVSQFITVASFSFSDVEDLLAEAKD 951          

HSP 2 Score: 101.679 bits (252), Expect = 5.457e-21
Identity = 98/402 (24.38%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            K LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Match: DAAM1 (dishevelled associated activator of morphogenesis 1 [Source:HGNC Symbol;Acc:HGNC:18142])

HSP 1 Score: 147.517 bits (371), Expect = 3.517e-35
Identity = 105/364 (28.85%), Postives = 181/364 (49.73%), Query Frame = 2
Query: 1958 LPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            L  K++P   + L K FNWSK+P +KL  ++W+ ID+   +  +DLE L+  FS         + I     S  +V          +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P +  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V  +           +++L    KD
Sbjct:  598 LKKKSIPQPTNAL-KSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQKEADAIDDTLSSKLKVKE--------LSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSVVSQFITVASFSFSDVEDLLAEAKD 941          

HSP 2 Score: 101.293 bits (251), Expect = 5.854e-21
Identity = 98/402 (24.38%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            K LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Match: DAAM2 (dishevelled associated activator of morphogenesis 2 [Source:HGNC Symbol;Acc:HGNC:18143])

HSP 1 Score: 139.043 bits (349), Expect = 1.295e-32
Identity = 99/355 (27.89%), Postives = 181/355 (50.99%), Query Frame = 2
Query: 1919 PHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGL-KNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            P+P+    L K  +P  + P      LK FNW K+   ++  ++W+ ID+   +  +DLE  +  FS       L  NP   K   S +     S     +++I+ +R+QN  + L + ++S  + +  +L+      D +  L   + E LLK  P   +I+LLE+    H I  +  A+ F+YE SR   YQ+RL  L F  K  E +     ++E +  + + ++ S  L ++ E++LA+GN MN+ +RG  YGF+V SLN   K+  T  SI    +LLH++++  EK  P+I  +P +L+++    KVN   + +++  +   L++++  ++  ++   +  +D F+ V 
Sbjct:  585 PYPSSDVPLRKKRVPQPSHP------LKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQELITNPSQQKELGSTEDIYLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAILKM-----DEQEDLAKDMLEQLLKFIPEKSDIDLLEE--HKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLN---KIADTKSSIDRNISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQ-VREPSDKFVPVM 922          

HSP 2 Score: 99.3673 bits (246), Expect = 2.280e-20
Identity = 104/413 (25.18%), Postives = 193/413 (46.73%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL 1723
            ++ + L  ALRT+ +++V  F++ +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         +  I + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L +TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+L
Sbjct:  128 QVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEA--------ISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAQL 511          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Match: DAAM2 (dishevelled associated activator of morphogenesis 2 [Source:HGNC Symbol;Acc:HGNC:18143])

HSP 1 Score: 136.346 bits (342), Expect = 8.596e-32
Identity = 99/357 (27.73%), Postives = 183/357 (51.26%), Query Frame = 2
Query: 1919 PHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV---DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            P+P+    L K  +P  + P      LK FNW K+   ++  ++W+ ID+   +  +DLE  +  FS       +LG    I L   +S +V          +++I+ +R+QN  + L + ++S  + +  +L+      D +  L   + E LLK  P   +I+LLE+    H I  +  A+ F+YE SR   YQ+RL  L F  K  E +     ++E +  + + ++ S  L ++ E++LA+GN MN+ +RG  YGF+V SLN   K+  T  SI    +LLH++++  EK  P+I  +P +L+++    KVN   + +++  +   L++++  ++  ++   +  +D F+ V 
Sbjct:  585 PYPSSDVPLRKKRVPQPSHP------LKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDIYL---ASRKVKE--------LSVIDGRRAQNCIILLSKLKLSNEEIRQAILKM-----DEQEDLAKDMLEQLLKFIPEKSDIDLLEE--HKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLN---KIADTKSSIDRNISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQ-VREPSDKFVPVM 913          

HSP 2 Score: 99.3673 bits (246), Expect = 2.689e-20
Identity = 104/413 (25.18%), Postives = 193/413 (46.73%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL 1723
            ++ + L  ALRT+ +++V  F++ +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         +  I + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L +TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+L
Sbjct:  128 QVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEA--------ISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAQL 511          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Match: DAAM2 (dishevelled associated activator of morphogenesis 2 [Source:HGNC Symbol;Acc:HGNC:18143])

HSP 1 Score: 136.346 bits (342), Expect = 8.596e-32
Identity = 99/357 (27.73%), Postives = 183/357 (51.26%), Query Frame = 2
Query: 1919 PHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV---DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            P+P+    L K  +P  + P      LK FNW K+   ++  ++W+ ID+   +  +DLE  +  FS       +LG    I L   +S +V          +++I+ +R+QN  + L + ++S  + +  +L+      D +  L   + E LLK  P   +I+LLE+    H I  +  A+ F+YE SR   YQ+RL  L F  K  E +     ++E +  + + ++ S  L ++ E++LA+GN MN+ +RG  YGF+V SLN   K+  T  SI    +LLH++++  EK  P+I  +P +L+++    KVN   + +++  +   L++++  ++  ++   +  +D F+ V 
Sbjct:  585 PYPSSDVPLRKKRVPQPSHP------LKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDIYL---ASRKVKE--------LSVIDGRRAQNCIILLSKLKLSNEEIRQAILKM-----DEQEDLAKDMLEQLLKFIPEKSDIDLLEE--HKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLN---KIADTKSSIDRNISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQ-VREPSDKFVPVM 913          

HSP 2 Score: 99.3673 bits (246), Expect = 2.689e-20
Identity = 104/413 (25.18%), Postives = 193/413 (46.73%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL 1723
            ++ + L  ALRT+ +++V  F++ +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         +  I + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L +TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+L
Sbjct:  128 QVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEA--------ISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAQL 511          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 115.546 bits (288), Expect = 8.896e-26
Identity = 116/469 (24.73%), Postives = 206/469 (43.92%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGN-LPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSIS---RDLNE----ISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH--RLFNVMREKK 3367
            +K  NW ++   K   ++W  ID+   Y ++DL  L   F+        K+      + +  +NRR   A I V  I+ +R QN  + L + ++S  + K  ++     S D +  L   + E +LK  PT EE+  + ++V  HG    L  A+ +MYE S  P +++RL CL       + V  L   ++++  +  S   +    ++  ++LA+GN +N  +R G  YGF++ S+N+L  +K    ++ N  NLLHF++   EK  P++ +  K    V    + + +  +   R+L E    +   L  L++T  +   +    END F  V          +   LD +   +K+  ++   +   +    +    E      K LN  + +   +   W  +  + + + Q   R   AK   +      K+ D +  IS L SGD FK+   RL    R KK
Sbjct:  533 MKTLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCFAASS---SHKDEDTDTLYGT--INRRPQQANITV--IDPRRYQNCTIMLSKLKLSHKEIKQAMM-----SMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVK---NALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQL---WAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISALQSGDIFKEELSRLRTSFRPKK 983          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 115.546 bits (288), Expect = 8.896e-26
Identity = 116/469 (24.73%), Postives = 206/469 (43.92%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGN-LPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSIS---RDLNE----ISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH--RLFNVMREKK 3367
            +K  NW ++   K   ++W  ID+   Y ++DL  L   F+        K+      + +  +NRR   A I V  I+ +R QN  + L + ++S  + K  ++     S D +  L   + E +LK  PT EE+  + ++V  HG    L  A+ +MYE S  P +++RL CL       + V  L   ++++  +  S   +    ++  ++LA+GN +N  +R G  YGF++ S+N+L  +K    ++ N  NLLHF++   EK  P++ +  K    V    + + +  +   R+L E    +   L  L++T  +   +    END F  V          +   LD +   +K+  ++   +   +    +    E      K LN  + +   +   W  +  + + + Q   R   AK   +      K+ D +  IS L SGD FK+   RL    R KK
Sbjct:  533 MKTLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCFAASS---SHKDEDTDTLYGT--INRRPQQANITV--IDPRRYQNCTIMLSKLKLSHKEIKQAMM-----SMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVK---NALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQL---WAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISALQSGDIFKEELSRLRTSFRPKK 983          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 114.39 bits (285), Expect = 1.417e-25
Identity = 116/469 (24.73%), Postives = 206/469 (43.92%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGN-LPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSIS---RDLNE----ISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH--RLFNVMREKK 3367
            +K  NW ++   K   ++W  ID+   Y ++DL  L   F+        K+      + +  +NRR   A I V  I+ +R QN  + L + ++S  + K  ++     S D +  L   + E +LK  PT EE+  + ++V  HG    L  A+ +MYE S  P +++RL CL       + V  L   ++++  +  S   +    ++  ++LA+GN +N  +R G  YGF++ S+N+L  +K    ++ N  NLLHF++   EK  P++ +  K    V    + + +  +   R+L E    +   L  L++T  +   +    END F  V          +   LD +   +K+  ++   +   +    +    E      K LN  + +   +   W  +  + + + Q   R   AK   +      K+ D +  IS L SGD FK+   RL    R KK
Sbjct:  364 MKTLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCFAASSSH---KDEDTDTLYGT--INRRPQQANITV--IDPRRYQNCTIMLSKLKLSHKEIKQAMM-----SMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVK---NALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQL---WAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISALQSGDIFKEELSRLRTSFRPKK 814          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 114.39 bits (285), Expect = 1.417e-25
Identity = 116/469 (24.73%), Postives = 206/469 (43.92%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGN-LPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSIS---RDLNE----ISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH--RLFNVMREKK 3367
            +K  NW ++   K   ++W  ID+   Y ++DL  L   F+        K+      + +  +NRR   A I V  I+ +R QN  + L + ++S  + K  ++     S D +  L   + E +LK  PT EE+  + ++V  HG    L  A+ +MYE S  P +++RL CL       + V  L   ++++  +  S   +    ++  ++LA+GN +N  +R G  YGF++ S+N+L  +K    ++ N  NLLHF++   EK  P++ +  K    V    + + +  +   R+L E    +   L  L++T  +   +    END F  V          +   LD +   +K+  ++   +   +    +    E      K LN  + +   +   W  +  + + + Q   R   AK   +      K+ D +  IS L SGD FK+   RL    R KK
Sbjct:  364 MKTLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCFAASSSH---KDEDTDTLYGT--INRRPQQANITV--IDPRRYQNCTIMLSKLKLSHKEIKQAMM-----SMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVK---NALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQL---WAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISALQSGDIFKEELSRLRTSFRPKK 814          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 90.5077 bits (223), Expect = 6.376e-19
Identity = 90/362 (24.86%), Postives = 160/362 (44.20%), Query Frame = 2
Query: 2318 VVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGN-LPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSIS---RDLNE----ISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH--RLFNVMREKK 3367
            ++S D +  L   + E +LK  PT EE+  + ++V  HG    L  A+ +MYE S  P +++RL CL       + V  L   ++++  +  S   +    ++  ++LA+GN +N  +R G  YGF++ S+N+L  +K    ++ N  NLLHF++   EK  P++ +  K    V    + + +  +   R+L E    +   L  L++T  +   +    END F  V          +   LD +   +K+  ++   +   +    +    E      K LN  + +   +   W  +  + + + Q   R   AK   +      K+ D +  IS L SGD FK+   RL    R KK
Sbjct:   16 MMSMDEKCKLPKDMIEQMLKFMPTKEELTQINESVQKHGSPTVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVK---NALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQL---WAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISALQSGDIFKEELSRLRTSFRPKK 371          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0070241)

HSP 1 Score: 141.354 bits (355), Expect = 1.602e-33
Identity = 109/387 (28.17%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1928 TLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV-NIINIQRSQNLAV---KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYP----TICEDVDKLDNLQTAVKDSVNEF 3061
            T+  +  K +LP KNVP   + L K FNWSK+P +KL  ++WS +DE+  YN ++LE +   FS        KN +     S   +      A   V ++I+ +R+QN  +   KLK + +  SK         ++S D    L   + E LLK  P+ EE  LL++   +  I +L  A+ F+YE S+ P Y++RL  L +  +    +  L   +  +  + + +  S  L +L ELVLA+GN MN+  RG   GF++ SLN   +L  T  S    + LLH+++   E+   ++ +L   + +V    KV+   + +D+  +   L  +   ++  +      + D FL V  + +        E  DK  +++T    +V  F
Sbjct:  589 TMAPAPPKVDLPKKNVPQPTNPL-KSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAYQ-----KNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKA--------ILSMDSNEQLQLDMVEQLLKFTPSAEERALLDE--HSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLN---RLADTKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLF 956          

HSP 2 Score: 70.4774 bits (171), Expect = 8.707e-12
Identity = 63/261 (24.14%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  410 SDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLF-DQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQ-----FIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            ++   E LK ++ H++    +    +  N+ +G   F D L  ALRT +  +V  F++ DGL  +   +    +   NS   +  I CI++L N+  G +++LA            ++ I + L + N  T     E+ GA+C    G  +V+ A L +        RF  +V+      + ++DN+++K +++S +NA+  +    ++L   R+HLRY+ L  G+   +       +  L + ++ F +   +D+ EF R
Sbjct:   64 AEHYIERLKELVVHISLSPEDSPSHELGNRLDGHAAFVDALKTALRTSTHSFVLRFVELDGLPALLDLLLQLDIRVANSPLHTSLIGCIKALMNNSMGRAHVLAHPT--------AIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLNYGPGQENLEF-RLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFAR 315          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0342731)

HSP 1 Score: 140.584 bits (353), Expect = 2.628e-33
Identity = 109/387 (28.17%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1928 TLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV-NIINIQRSQNLAV---KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYP----TICEDVDKLDNLQTAVKDSVNEF 3061
            T+  +  K +LP KNVP   + L K FNWSK+P +KL  ++WS +DE+  YN ++LE +   FS        KN +     S   +      A   V ++I+ +R+QN  +   KLK + +  SK         ++S D    L   + E LLK  P+ EE  LL++   +  I +L  A+ F+YE S+ P Y++RL  L +  +    +  L   +  +  + + +  S  L +L ELVLA+GN MN+  RG   GF++ SLN+L     T  S    + LLH+++   E+   ++ +L   + +V    KV+   + +D+  +   L  +   ++  +      + D FL V  + +        E  DK  +++T    +V  F
Sbjct:  628 TMAPAPPKVDLPKKNVPQPTNPL-KSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAY-----QKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKA--------ILSMDSNEQLQLDMVEQLLKFTPSAEERALLDE--HSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLNRLAD---TKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLF 995          

HSP 2 Score: 70.4774 bits (171), Expect = 9.838e-12
Identity = 63/261 (24.14%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  410 SDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLF-DQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQ-----FIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            ++   E LK ++ H++    +    +  N+ +G   F D L  ALRT +  +V  F++ DGL  +   +    +   NS   +  I CI++L N+  G +++LA            ++ I + L + N  T     E+ GA+C    G  +V+ A L +        RF  +V+      + ++DN+++K +++S +NA+  +    ++L   R+HLRY+ L  G+   +       +  L + ++ F +   +D+ EF R
Sbjct:  103 AEHYIERLKELVVHISLSPEDSPSHELGNRLDGHAAFVDALKTALRTSTHSFVLRFVELDGLPALLDLLLQLDIRVANSPLHTSLIGCIKALMNNSMGRAHVLAHPT--------AIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLNYGPGQENLEF-RLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFAR 354          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0310282)

HSP 1 Score: 140.584 bits (353), Expect = 2.628e-33
Identity = 109/387 (28.17%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1928 TLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV-NIINIQRSQNLAV---KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYP----TICEDVDKLDNLQTAVKDSVNEF 3061
            T+  +  K +LP KNVP   + L K FNWSK+P +KL  ++WS +DE+  YN ++LE +   FS        KN +     S   +      A   V ++I+ +R+QN  +   KLK + +  SK         ++S D    L   + E LLK  P+ EE  LL++   +  I +L  A+ F+YE S+ P Y++RL  L +  +    +  L   +  +  + + +  S  L +L ELVLA+GN MN+  RG   GF++ SLN+L     T  S    + LLH+++   E+   ++ +L   + +V    KV+   + +D+  +   L  +   ++  +      + D FL V  + +        E  DK  +++T    +V  F
Sbjct:  628 TMAPAPPKVDLPKKNVPQPTNPL-KSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAY-----QKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKA--------ILSMDSNEQLQLDMVEQLLKFTPSAEERALLDE--HSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLNRLAD---TKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLF 995          

HSP 2 Score: 70.4774 bits (171), Expect = 9.838e-12
Identity = 63/261 (24.14%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  410 SDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLF-DQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQ-----FIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            ++   E LK ++ H++    +    +  N+ +G   F D L  ALRT +  +V  F++ DGL  +   +    +   NS   +  I CI++L N+  G +++LA            ++ I + L + N  T     E+ GA+C    G  +V+ A L +        RF  +V+      + ++DN+++K +++S +NA+  +    ++L   R+HLRY+ L  G+   +       +  L + ++ F +   +D+ EF R
Sbjct:  103 AEHYIERLKELVVHISLSPEDSPSHELGNRLDGHAAFVDALKTALRTSTHSFVLRFVELDGLPALLDLLLQLDIRVANSPLHTSLIGCIKALMNNSMGRAHVLAHPT--------AIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLNYGPGQENLEF-RLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFAR 354          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0310283)

HSP 1 Score: 140.584 bits (353), Expect = 2.628e-33
Identity = 109/387 (28.17%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1928 TLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV-NIINIQRSQNLAV---KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYP----TICEDVDKLDNLQTAVKDSVNEF 3061
            T+  +  K +LP KNVP   + L K FNWSK+P +KL  ++WS +DE+  YN ++LE +   FS        KN +     S   +      A   V ++I+ +R+QN  +   KLK + +  SK         ++S D    L   + E LLK  P+ EE  LL++   +  I +L  A+ F+YE S+ P Y++RL  L +  +    +  L   +  +  + + +  S  L +L ELVLA+GN MN+  RG   GF++ SLN+L     T  S    + LLH+++   E+   ++ +L   + +V    KV+   + +D+  +   L  +   ++  +      + D FL V  + +        E  DK  +++T    +V  F
Sbjct:  628 TMAPAPPKVDLPKKNVPQPTNPL-KSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAY-----QKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKA--------ILSMDSNEQLQLDMVEQLLKFTPSAEERALLDE--HSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLNRLAD---TKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLF 995          

HSP 2 Score: 70.4774 bits (171), Expect = 9.838e-12
Identity = 63/261 (24.14%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  410 SDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLF-DQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQ-----FIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            ++   E LK ++ H++    +    +  N+ +G   F D L  ALRT +  +V  F++ DGL  +   +    +   NS   +  I CI++L N+  G +++LA            ++ I + L + N  T     E+ GA+C    G  +V+ A L +        RF  +V+      + ++DN+++K +++S +NA+  +    ++L   R+HLRY+ L  G+   +       +  L + ++ F +   +D+ EF R
Sbjct:  103 AEHYIERLKELVVHISLSPEDSPSHELGNRLDGHAAFVDALKTALRTSTHSFVLRFVELDGLPALLDLLLQLDIRVANSPLHTSLIGCIKALMNNSMGRAHVLAHPT--------AIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLNYGPGQENLEF-RLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFAR 354          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0070239)

HSP 1 Score: 140.584 bits (353), Expect = 2.628e-33
Identity = 109/387 (28.17%), Postives = 185/387 (47.80%), Query Frame = 2
Query: 1928 TLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV-NIINIQRSQNLAV---KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYP----TICEDVDKLDNLQTAVKDSVNEF 3061
            T+  +  K +LP KNVP   + L K FNWSK+P +KL  ++WS +DE+  YN ++LE +   FS        KN +     S   +      A   V ++I+ +R+QN  +   KLK + +  SK         ++S D    L   + E LLK  P+ EE  LL++   +  I +L  A+ F+YE S+ P Y++RL  L +  +    +  L   +  +  + + +  S  L +L ELVLA+GN MN+  RG   GF++ SLN+L     T  S    + LLH+++   E+   ++ +L   + +V    KV+   + +D+  +   L  +   ++  +      + D FL V  + +        E  DK  +++T    +V  F
Sbjct:  628 TMAPAPPKVDLPKKNVPQPTNPL-KSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAY-----QKNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDMEISKA--------ILSMDSNEQLQLDMVEQLLKFTPSAEERALLDE--HSEDIESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLNRLAD---TKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLF 995          

HSP 2 Score: 70.4774 bits (171), Expect = 9.838e-12
Identity = 63/261 (24.14%), Postives = 123/261 (47.13%), Query Frame = 2
Query:  410 SDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLF-DQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQ-----FIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            ++   E LK ++ H++    +    +  N+ +G   F D L  ALRT +  +V  F++ DGL  +   +    +   NS   +  I CI++L N+  G +++LA            ++ I + L + N  T     E+ GA+C    G  +V+ A L +        RF  +V+      + ++DN+++K +++S +NA+  +    ++L   R+HLRY+ L  G+   +       +  L + ++ F +   +D+ EF R
Sbjct:  103 AEHYIERLKELVVHISLSPEDSPSHELGNRLDGHAAFVDALKTALRTSTHSFVLRFVELDGLPALLDLLLQLDIRVANSPLHTSLIGCIKALMNNSMGRAHVLAHPT--------AIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDLDRSTYAYRDNVNLKTALMSFVNAVLNYGPGQENLEF-RLHLRYEFLMLGIQPVIDKLRTHENETLDRHLDFFEMVRAEDEKEFAR 354          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 147.517 bits (371), Expect = 2.250e-35
Identity = 102/347 (29.39%), Postives = 178/347 (51.30%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            ++L K N+P  + P      LK FNW+K+  +KL  ++W  +D+   + ++DLE ++  FS              +     + +   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   E+  P++  + + L+NV    KVN   + +D+N +   LKS++  ++  +  P +   D F+ V
Sbjct:  591 STLKKKNIPQPSNP------LKSFNWTKLSENKLEGTVWLDLDDVRVFKQLDLEDIEKTFSAYQ-----------RQQKESEDDTVTSKKVKELSVIDGRRAQNCNILLSKLKLSNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDVDLLEE--HKHELERMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALSKASKEVLQSKNLRQLLEIVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNVTLLHYLITVLEQKYPKVSLIHEDLQNVPVAAKVNMTELEKDINNLRSGLKSVETELEYQRTQP-QTYGDKFVSV 909          

HSP 2 Score: 94.3597 bits (233), Expect = 5.041e-19
Identity = 100/436 (22.94%), Postives = 205/436 (47.02%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQEN 1693
            +F  +++ +M    + L +   D ++ N     K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  ++++A L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              N  VD          I K +  T++  +  S+L H L +P ++  N   Y  ++D +VQQI +Q   G    DP ++ L+  ++ +++  L  +NE+K  +++ + +  +   L QK++  + +C     D  A E++  ++        K+ EKL++E+
Sbjct:  105 EFYIDQINSMAARKSLLALEKEDEEERN-----KTIESLKTALRTQPMRFVTRFIDQDGLTCILNFLKTMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILEAMLHYQKFACERTRFQTLLNDLDRSTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALAKRFE--------------NVHVDTKSATQMFELIRKRINHTDAFPHFISVLQHCLHMPYKKTGNTVQYWVLLDRIVQQIILQNDKGL---DPDVAPLENFDVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKEREC-----DAKAQEKEEMMQTL-----NKMKEKLEKES 499          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 147.517 bits (371), Expect = 2.250e-35
Identity = 102/347 (29.39%), Postives = 178/347 (51.30%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            ++L K N+P  + P      LK FNW+K+  +KL  ++W  +D+   + ++DLE ++  FS              +     + +   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   E+  P++  + + L+NV    KVN   + +D+N +   LKS++  ++  +  P +   D F+ V
Sbjct:  591 STLKKKNIPQPSNP------LKSFNWTKLSENKLEGTVWLDLDDVRVFKQLDLEDIEKTFSAYQ-----------RQQKESEDDTVTSKKVKELSVIDGRRAQNCNILLSKLKLSNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDVDLLEE--HKHELERMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALSKASKEVLQSKNLRQLLEIVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNVTLLHYLITVLEQKYPKVSLIHEDLQNVPVAAKVNMTELEKDINNLRSGLKSVETELEYQRTQP-QTYGDKFVSV 909          

HSP 2 Score: 94.3597 bits (233), Expect = 5.041e-19
Identity = 100/436 (22.94%), Postives = 205/436 (47.02%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQEN 1693
            +F  +++ +M    + L +   D ++ N     K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  ++++A L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              N  VD          I K +  T++  +  S+L H L +P ++  N   Y  ++D +VQQI +Q   G    DP ++ L+  ++ +++  L  +NE+K  +++ + +  +   L QK++  + +C     D  A E++  ++        K+ EKL++E+
Sbjct:  105 EFYIDQINSMAARKSLLALEKEDEEERN-----KTIESLKTALRTQPMRFVTRFIDQDGLTCILNFLKTMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILEAMLHYQKFACERTRFQTLLNDLDRSTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALAKRFE--------------NVHVDTKSATQMFELIRKRINHTDAFPHFISVLQHCLHMPYKKTGNTVQYWVLLDRIVQQIILQNDKGL---DPDVAPLENFDVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKEREC-----DAKAQEKEEMMQTL-----NKMKEKLEKES 499          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Match: daam1b (dishevelled associated activator of morphogenesis 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4212])

HSP 1 Score: 147.132 bits (370), Expect = 3.316e-35
Identity = 104/347 (29.97%), Postives = 180/347 (51.87%), Query Frame = 2
Query: 1943 LTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            L K N+P  + P      LK FNW+K+  +KL  ++W+ +D+   +  +DLE ++  FS      D  + N    K      ++   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E +LK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K +++S    +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   EK   ++    ++L+NV    KVN   + +++N +   LKS+++ +D  KK P +   D F+ V
Sbjct:  601 LKKKNIPQPSNP------LKSFNWAKLSENKLEGTVWADVDDGRVFKILDLEDIEKTFSAYQRQQDFFMVNNNKQKETEDDTLS---SKKVKELSVIDGRRAQNCNILLSRLKLSNEEIKRAIL-----TMDEQEDLPKDMLEQMLKFVPEKSDVDLLEE--HKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTKASKEVLHSRNFKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITILEKKYSKVMLFQEELKNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEY-GDKFVSV 927          

HSP 2 Score: 94.3597 bits (233), Expect = 4.842e-19
Identity = 98/367 (26.70%), Postives = 177/367 (48.23%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+  E+        + +I + L + N  T   + E+ GA+C    G  ++++A L Y        RF  L++        ++D + +K +I+S INA+         L   RVHLRY+ L  G+   +    +  ++ L + ++ F   + DD      L      + I  D+   TQV   EL      + K L  T++  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP  + L+  N+ +++  L  +NE+K  +++ + +  D   L QK++  + +C
Sbjct:  132 KTIESLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHTES--------INIIAQSLATDNIKTKVAVLEIMGAVCLVPGGHKKILEAMLHYQKFACERTRFQTLLNDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGESSLEF-RVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDD-----ELTLSRRFEAIHIDTKSATQV--FEL------VRKKLAHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDATPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKDHHELQQKMEKKEREC 473          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Match: daam1b (dishevelled associated activator of morphogenesis 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4212])

HSP 1 Score: 147.132 bits (370), Expect = 3.316e-35
Identity = 104/347 (29.97%), Postives = 180/347 (51.87%), Query Frame = 2
Query: 1943 LTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            L K N+P  + P      LK FNW+K+  +KL  ++W+ +D+   +  +DLE ++  FS      D  + N    K      ++   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E +LK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K +++S    +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   EK   ++    ++L+NV    KVN   + +++N +   LKS+++ +D  KK P +   D F+ V
Sbjct:  601 LKKKNIPQPSNP------LKSFNWAKLSENKLEGTVWADVDDGRVFKILDLEDIEKTFSAYQRQQDFFMVNNNKQKETEDDTLS---SKKVKELSVIDGRRAQNCNILLSRLKLSNEEIKRAIL-----TMDEQEDLPKDMLEQMLKFVPEKSDVDLLEE--HKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTKASKEVLHSRNFKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITILEKKYSKVMLFQEELKNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEY-GDKFVSV 927          

HSP 2 Score: 94.3597 bits (233), Expect = 4.842e-19
Identity = 98/367 (26.70%), Postives = 177/367 (48.23%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+  E+        + +I + L + N  T   + E+ GA+C    G  ++++A L Y        RF  L++        ++D + +K +I+S INA+         L   RVHLRY+ L  G+   +    +  ++ L + ++ F   + DD      L      + I  D+   TQV   EL      + K L  T++  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP  + L+  N+ +++  L  +NE+K  +++ + +  D   L QK++  + +C
Sbjct:  132 KTIESLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHTES--------INIIAQSLATDNIKTKVAVLEIMGAVCLVPGGHKKILEAMLHYQKFACERTRFQTLLNDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGESSLEF-RVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDD-----ELTLSRRFEAIHIDTKSATQV--FEL------VRKKLAHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDATPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKDHHELQQKMEKKEREC 473          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 146.747 bits (369), Expect = 3.515e-35
Identity = 102/347 (29.39%), Postives = 178/347 (51.30%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            ++L K N+P  + P      LK FNW+K+  +KL  ++W  +D+   + ++DLE ++  FS              +     + +   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   E+  P++  + + L+NV    KVN   + +D+N +   LKS++  ++  +  P +   D F+ V
Sbjct:  615 STLKKKNIPQPSNP------LKSFNWTKLSENKLEGTVWLDLDDVRVFKQLDLEDIEKTFSAYQ-----------RQQKESEDDTVTSKKVKELSVIDGRRAQNCNILLSKLKLSNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDVDLLEE--HKHELERMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALSKASKEVLQSKNLRQLLEIVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNVTLLHYLITVLEQKYPKVSLIHEDLQNVPVAAKVNMTELEKDINNLRSGLKSVETELEYQRTQP-QTYGDKFVSV 933          

HSP 2 Score: 93.9745 bits (232), Expect = 6.941e-19
Identity = 100/436 (22.94%), Postives = 205/436 (47.02%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQEN 1693
            +F  +++ +M    + L +   D ++ N     K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  ++++A L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              N  VD          I K +  T++  +  S+L H L +P ++  N   Y  ++D +VQQI +Q   G    DP ++ L+  ++ +++  L  +NE+K  +++ + +  +   L QK++  + +C     D  A E++  ++        K+ EKL++E+
Sbjct:  129 EFYIDQINSMAARKSLLALEKEDEEERN-----KTIESLKTALRTQPMRFVTRFIDQDGLTCILNFLKTMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILEAMLHYQKFACERTRFQTLLNDLDRSTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALAKRFE--------------NVHVDTKSATQMFELIRKRINHTDAFPHFISVLQHCLHMPYKKTGNTVQYWVLLDRIVQQIILQNDKGL---DPDVAPLENFDVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKEREC-----DAKAQEKEEMMQTL-----NKMKEKLEKES 523          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Match: tatdn1 (TatD DNase domain containing 1 [Source:Xenbase;Acc:XB-GENE-945962])

HSP 1 Score: 228.794 bits (582), Expect = 6.513e-61
Identity = 225/846 (26.60%), Postives = 399/846 (47.16%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALAN---EVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E     N   +VA+L  + Q+    +N +  L        A    + T L     P      P  PP PP   +      P   +  ++ + N+P    P      LK FNW K+  +KL  ++W  +D+   +  +DLE ++  FS      D  + N I  K            +    +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  120 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQE----LNSVSIL--------AYVFIVWTTLGSSALPDSHSGGPPPPPGPPLLGTAP----PGAPMGPAMKRKNIPQPKNP------LKSFNWVKLADNKLEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQDFFMNNGIKQKETDCTDDTLSSKMKVKELSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 896          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Match: tatdn1 (TatD DNase domain containing 1 [Source:Xenbase;Acc:XB-GENE-945962])

HSP 1 Score: 227.254 bits (578), Expect = 2.351e-60
Identity = 220/843 (26.10%), Postives = 396/843 (46.98%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E      E   +K +  +  + +  ++S+    P       + +T         P       PPPP PP        P   +  ++ + N+P    P      LK FNW K+  +KL  ++W  +D+   +  +DLE ++  FS      D  + N I               +    +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  120 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKE----TTEYKNVKQQVAELTAQIQELNSVTFPSP---LSIKYYITGTTLGSSALPDSHSGGPPPPPGPPLLGT--APPGAPMGPAMKRKNIPQPKNP------LKSFNWVKLADNKLEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQDFFMNNGIKQVKTDCTDDTLSSKMKVKELSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 900          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Match: tatdn1 (TatD DNase domain containing 1 [Source:Xenbase;Acc:XB-GENE-945962])

HSP 1 Score: 222.631 bits (566), Expect = 6.197e-59
Identity = 223/849 (26.27%), Postives = 398/849 (46.88%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFS--------TVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+    Q   + L  R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET   + +KQ+   L  ++ +L   S    ++VN        HP Q+   SF  +            PPP   PP            P   +  ++ + N+P    P      LK FNW+K     L  ++W  +D+   +  +DLE ++  FS        T   D  L + + +K                 +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  113 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAV--LSQGAGESLDFRLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQELN--SVSILAYVNEPQCKVILHPPQKW--SFYDSIKYYITGTTLGGPPPPPGPPLLGTAP------PGAPMGPAMKRKNIPQPKNP------LKSFNWNK-----LEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQKETDCTDDTLSSKMKVKE----------------LSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 886          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Match: tatdn1 (TatD DNase domain containing 1 [Source:Xenbase;Acc:XB-GENE-945962])

HSP 1 Score: 218.779 bits (556), Expect = 7.989e-58
Identity = 214/844 (25.36%), Postives = 390/844 (46.21%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALAN---EVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+    Q   + L  R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E     N   +VA+L  + Q+    +N +  L   +  Q          L   P                          P   +  ++ + N+P    P      LK FNW K+  +KL  ++W  +D+   +  +DLE ++  FS              + HS  +V          +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV           +   ++NI+ LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  120 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAV--LSQGAGESLDFRLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQE----LNSVSILAYVNEPQWPPPPPGPPLLGTAP--------------------------PGAPMGPAMKRKNIPQPKNP------LKSFNWVKLADNKLEGTLWIDLDDAKVFKILDLEDIERTFSAY------------QRHSKMKVKE--------LSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKV-----------SIDGLVNIT-LLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 850          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Match: tatdn1 (TatD DNase domain containing 1 [Source:Xenbase;Acc:XB-GENE-945962])

HSP 1 Score: 209.534 bits (532), Expect = 8.956e-55
Identity = 217/854 (25.41%), Postives = 395/854 (46.25%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALAN---EVAKLKIESQQ--PCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFS--------TVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+    Q   + L  R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E     N   +VA+L  + Q+    S + ++  +   HP Q+   SF                            S+  ++        +L  S LP  +     +     + +S    +KL  ++W  +D+   +  +DLE ++  FS        T   D  L + + +K                 +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  103 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAV--LSQGAGESLDFRLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQELNSVSILAYVFIVFILHPPQKW--SFY--------------------------DSIKYYITG-----TTLGSSALPDSHSG-FATYTFTPWAYSLYSANKLEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQKETDCTDDTLSSKMKVKE----------------LSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 858          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Match: Daam1 (dishevelled associated activator of morphogenesis 1 [Source:MGI Symbol;Acc:MGI:1914596])

HSP 1 Score: 150.214 bits (378), Expect = 3.272e-36
Identity = 105/345 (30.43%), Postives = 181/345 (52.46%), Query Frame = 2
Query: 1955 NLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
             L  KN+P   + L K FNWSK+P +KL+ ++W+ ID+   +  +DLE L+  FS      +  + N    K   +  ++  LS  L    +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P++  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V
Sbjct:  597 TLKKKNIPQPTNAL-KSFNWSKLPENKLDGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQEFFVNNS---KQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSRALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPKVLNLSEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSV 926          

HSP 2 Score: 100.138 bits (248), Expect = 8.848e-21
Identity = 97/402 (24.13%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            + LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRRRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Match: Daam1 (dishevelled associated activator of morphogenesis 1 [Source:MGI Symbol;Acc:MGI:1914596])

HSP 1 Score: 150.214 bits (378), Expect = 3.272e-36
Identity = 105/345 (30.43%), Postives = 181/345 (52.46%), Query Frame = 2
Query: 1955 NLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
             L  KN+P   + L K FNWSK+P +KL+ ++W+ ID+   +  +DLE L+  FS      +  + N    K   +  ++  LS  L    +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P++  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V
Sbjct:  597 TLKKKNIPQPTNAL-KSFNWSKLPENKLDGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQEFFVNNS---KQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSRALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPKVLNLSEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSV 926          

HSP 2 Score: 100.138 bits (248), Expect = 8.848e-21
Identity = 97/402 (24.13%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            + LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRRRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Match: Daam1 (dishevelled associated activator of morphogenesis 1 [Source:MGI Symbol;Acc:MGI:1914596])

HSP 1 Score: 150.214 bits (378), Expect = 3.674e-36
Identity = 103/341 (30.21%), Postives = 176/341 (51.61%), Query Frame = 2
Query: 1955 NLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
             L  KN+P   + L K FNWSK+P +KL+ ++W+ ID+   +  +DLE L+  FS         + I     S  +V          +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P++  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V
Sbjct:  597 TLKKKNIPQPTNAL-KSFNWSKLPENKLDGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQKEADAIDDTLSSKLKVKE--------LSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSRALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPKVLNLSEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSV 917          

HSP 2 Score: 100.138 bits (248), Expect = 9.745e-21
Identity = 97/401 (24.19%), Postives = 190/401 (47.38%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            + LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G Q+PD    +   NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRRRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKG-QDPDSTPLE-NFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Match: Daam2 (dishevelled associated activator of morphogenesis 2 [Source:MGI Symbol;Acc:MGI:1923691])

HSP 1 Score: 126.716 bits (317), Expect = 6.397e-29
Identity = 100/386 (25.91%), Postives = 183/386 (47.41%), Query Frame = 2
Query: 1943 LTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFST------------------VPVDLGLKNPIPL---KPHSSPQVNRRLSLATIP-------------------VNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            L K  +P  + P      LK FNW K+   +++ ++W+ ID++  +  +DLE  +  FS                   V        P+P      H + + +R +  AT                     +++I+ +R+QN  + L + ++S  + +  +L       D +  L   + E LLK  P   +I+LLE+    H I  +  A+ F+YE SR   YQ+RL  L F  K  E +     ++E +  + + +  S  L ++ E+VLA+GN MN+ +RG  YGF+V SLN   K+  T  SI    +LLH++++  EK  P+I  +P +L+++    KVN   + ++++ +   L++++  ++  ++   +  ND F+ V 
Sbjct:  593 LRKKRIPQPSHP------LKSFNWVKLNEERVSGTVWNEIDDSQVFRILDLEDFEKMFSAYQRHQACMQEGPQRERGNVRDGGAASRPLPAVEASAHRTEKASRSMVSATGAKKELGSTEDIYITSRKVKELSVIDGRRAQNCIILLSKLKLSNDEIRQAILRM-----DEQEDLAKDMLEQLLKFIPEKSDIDLLEE--HKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELTLSQRLKQMLEVVLAIGNFMNKGQRGGAYGFRVASLN---KIADTKSSIDRNISLLHYLIMILEKHFPDILNMPSELKHLSEAAKVNLAELEKEVSILRRGLRAVEVELE-YQRHQARDPNDKFVPVM 961          

HSP 2 Score: 100.138 bits (248), Expect = 9.524e-21
Identity = 104/412 (25.24%), Postives = 193/412 (46.84%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAK 1720
            ++ + L  ALRT+ +++V  F+D +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         + +I + L + N  T   + E+ GA+C    G  +V+ A L Y +      RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L  TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+
Sbjct:  128 QVVEDLKTALRTQPMRFVTRFIDLEGLTCLLNFLRGMDHTTCESRIHTSLIGCIKALMNNSQGRAHVLAQPE--------AISIIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQAYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKHTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELMSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAR 510          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Match: Daam2 (dishevelled associated activator of morphogenesis 2 [Source:MGI Symbol;Acc:MGI:1923691])

HSP 1 Score: 100.523 bits (249), Expect = 2.080e-21
Identity = 105/423 (24.82%), Postives = 197/423 (46.57%), Query Frame = 2
Query:  479 DIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAK 1720
            + +D    +  ++ + L  ALRT+ +++V  F+D +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         + +I + L + N  T   + E+ GA+C    G  +V+ A L Y +      RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L  TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+
Sbjct:  117 ETEDEETDKRNQVVEDLKTALRTQPMRFVTRFIDLEGLTCLLNFLRGMDHTTCESRIHTSLIGCIKALMNNSQGRAHVLAQPE--------AISIIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQAYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKHTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELMSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAR 510          
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Match: sp|B0DOB5|DAA1A_XENLA (Disheveled-associated activator of morphogenesis 1-A OS=Xenopus laevis OX=8355 GN=daam1-a PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.674e-36
Identity = 106/348 (30.46%), Postives = 178/348 (51.15%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            S+ K N+P    P      LK FNWSK+P +KL  ++W  +D+      +DLE ++  FS      D  + N I  K            +    +++++ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + ++++ +   LKS++N ++  K  PT    D F+ V
Sbjct:  600 SMKKKNIPQPKNP------LKSFNWSKLPDNKLEGTLWIDLDDAKVLKILDLEDIERTFSAYQRQQDFFVNNGIKQKEMDCTDDTLSSKMKVKELSVVDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKNLKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQTISVAAKVNMTELEKEISALRNGLKSVENELEYQKTQPT-LPGDKFVSV 930          

HSP 2 Score: 111.694 bits (278), Expect = 2.168e-23
Identity = 107/423 (25.30%), Postives = 201/423 (47.52%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL 1723
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA  E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S+LHH L +P +R  N   Y  ++D +VQQI +Q   G    DP  S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET   + +KQ+   L  ++ +L
Sbjct:  120 MDKEDEEERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKSMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHTES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSILHHCLQMPYKRSGNTVHYWLLLDRIVQQIVIQNEKGQ---DPDTSPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQEL 516          
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Match: sp|Q8BPM0|DAAM1_MOUSE (Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4)

HSP 1 Score: 150.214 bits (378), Expect = 2.289e-35
Identity = 105/345 (30.43%), Postives = 181/345 (52.46%), Query Frame = 2
Query: 1955 NLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
             L  KN+P   + L K FNWSK+P +KL+ ++W+ ID+   +  +DLE L+  FS      +  + N    K   +  ++  LS  L    +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P++  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V
Sbjct:  597 TLKKKNIPQPTNAL-KSFNWSKLPENKLDGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQEFFVNNS---KQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSRALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPKVLNLSEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSV 926          

HSP 2 Score: 100.138 bits (248), Expect = 6.189e-20
Identity = 97/402 (24.13%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            + LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRRRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Match: sp|Q9Y4D1|DAAM1_HUMAN (Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 8.539e-35
Identity = 106/366 (28.96%), Postives = 183/366 (50.00%), Query Frame = 2
Query: 1958 LPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            L  K++P   + L K FNWSK+P +KL  ++W+ ID+   +  +DLE L+  FS              K   +  ++  LS  L    +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   E   P +  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V  +           +++L    KD
Sbjct:  598 LKKKSIPQPTNAL-KSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSVVSQFITVASFSFSDVEDLLAEAKD 951          

HSP 2 Score: 101.679 bits (252), Expect = 2.620e-20
Identity = 98/402 (24.38%), Postives = 190/402 (47.26%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQE 1690
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            K LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+
Sbjct:  132 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ 507          
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Match: sp|A0A1D5P556|DAAM2_CHICK (Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 1.749e-33
Identity = 110/380 (28.95%), Postives = 187/380 (49.21%), Query Frame = 2
Query: 1919 PHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV---NIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            P  T   S   ++L  K++P   S  LK FNW+K+   +++ +IW+ ID+   +  +DLE  +  FS              +          L L+T  V   ++I+ +R+QN  + L + ++S  + +  +L+      D +  L   + E LLK  P   + +LLE+    H I  +  A+ F++E SR   YQ+RL  L F  K PE +     ++E +  + K +I S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH++++  EK  P+I ++  +L+++    KVN   + +++N I   LK+++  +D  K+   +   D F+ V             +L++L    +D
Sbjct:  590 PPSTTTFSSAGTSLKKKSIPQ-PSHPLKSFNWAKLSEERIHGTIWNEIDDLKAFKVLDLEDFEKMFSAYQ-----------RHQKEMGSTEDLYLSTRKVKELSVIDGRRAQNCVILLSKLKLSNEEIRQAILKM-----DEQEDLAKDMLEQLLKFVPEKSDTDLLEE--HKHEIERMARADRFLFEMSRIDHYQQRLQALFFKKKFPERLAEAKPKVEAILLASKELIRSKRLRQLLEVVLAFGNYMNKGQRGSAYGFKVSSLN---KIADTKSSIDRNITLLHYLIMIFEKNYPDILDIQTELQHLPEAAKVNLVELEKEVNNIKTGLKAVEAELDYQKRR-IRESGDRFVPVMSDFITVASFSFSELEDLLNDARD 946          

HSP 2 Score: 95.5153 bits (236), Expect = 1.926e-18
Identity = 92/368 (25.00%), Postives = 174/368 (47.28%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENG-YLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K+ + L  ALRT+ +++V  F++ DGL  +  +++        S+  +  I CI++L N+  G +++LA  E+        + +I + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L + ++ F +   +DD+E  +  D                 +D          I K L  T++  YL S+L H L +P +R  G +   Q++D ++QQI +Q   G    DP ++ L+  N+ +++  L  +NE+K  + + +    D   L  K++  + +C
Sbjct:  128 KIVEDLKTALRTQPMRFVMRFIELDGLSCLLNFLKSMDYETSESRIHTSVIGCIKALMNNSQGRAHVLAHPES--------INIISQSLRTENIKTKIAVLEILGAVCLVPDGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSMGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLREHENATLDRHLDFFEMVRNEDDLELAKRFDL--------------IHIDTKSASQMFELIKKRLKHTDAYPYLLSILQHCLQMPYKRNGGNFQQWQLLDRILQQIVLQDERG---DDPDIAPLENFNVKNIIKMLVNENEVKQWRDQAEKFRKDHAELMSKLEKKEREC 469          
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Match: sp|Q86T65|DAAM2_HUMAN (Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3)

HSP 1 Score: 136.346 bits (342), Expect = 4.128e-31
Identity = 99/357 (27.73%), Postives = 183/357 (51.26%), Query Frame = 2
Query: 1919 PHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV---DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            P+P+    L K  +P  + P      LK FNW K+   ++  ++W+ ID+   +  +DLE  +  FS       +LG    I L   +S +V          +++I+ +R+QN  + L + ++S  + +  +L+      D +  L   + E LLK  P   +I+LLE+    H I  +  A+ F+YE SR   YQ+RL  L F  K  E +     ++E +  + + ++ S  L ++ E++LA+GN MN+ +RG  YGF+V SLN   K+  T  SI    +LLH++++  EK  P+I  +P +L+++    KVN   + +++  +   L++++  ++  ++   +  +D F+ V 
Sbjct:  585 PYPSSDVPLRKKRVPQPSHP------LKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDIYL---ASRKVKE--------LSVIDGRRAQNCIILLSKLKLSNEEIRQAILKM-----DEQEDLAKDMLEQLLKFIPEKSDIDLLEE--HKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLN---KIADTKSSIDRNISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQ-VREPSDKFVPVM 913          

HSP 2 Score: 99.3673 bits (246), Expect = 1.291e-19
Identity = 104/413 (25.18%), Postives = 193/413 (46.73%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL 1723
            ++ + L  ALRT+ +++V  F++ +GL  +  ++R        S+  +  I CI++L N+  G +++LA  E         +  I + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L K ++ F +   +DD+E  R  D                 +D          I K L +TE+   L S+LHH L +P +R  GY    Q++D ++QQI +Q   G    DP L+ L+  N+ +++  L  +NE+K  + + +    +   L  +++  + +C   E+  +  EE  +      D   + +++L+Q    +A  VA+L
Sbjct:  128 QVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEA--------ISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDM--------------VHIDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGV---DPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKEREC---ETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELVAQL 511          
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Match: A0A3P8SF98 (Uncharacterized protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 4.991e-58
Identity = 250/1025 (24.39%), Postives = 458/1025 (44.68%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDK-VALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVN-----HIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLP--------TKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLK-CTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADRE---KRAQME---ERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAF------------KKHRLFNVMREK 3364
            +F  ++LK+M      L + G +  D +     K+ + L  ALRT+ +++V  F++ DGL  I  +++        S   +  I C+++L N+  G +++L  NE+        + +I + L + N  T   I E+ GA+C    G  +V++A+ Y  + +    RF  L+         ++D +D+K +I+S INA+         L   R+HLRY+ L  G+   +    + ++  L + ++ F   + +D   +     +   +      M+               I KNL  TE+  +  S L H + +P ++ +  L Y  ++D +VQQ+ V Q +  +NPD  L +   N+  ++  LA +NE+K  +++ D +  +   L Q+ +  + +C     +K   +E  +KI+  +++ E+K +   KQ    +A   A+L   SQ    H+      H  S+    P                                    +  N + P P    S    + P         KN+P  +S  LK FNWSK+P SK  ++IW  ID+ + +  +DLE  Q  FS              KP    + +   +     +++I+ +R+QN  + L + +++  + +  +L     + D +  L   + E LLK  P   +IELLED    H +  +  A+ F+Y+ SR   YQERL  L F  K  E V  +  +++ L  + K ++ S  L +L E+VLA GN MN+ +R   YGFKV SLN++   K  T+K+I     LLH+++   E+  P++    ++L++V    KVN   + +D+N +   LKS++  +   +   ++   D F+ V  +                + +++S++E      + L     +S    D    + N   T  ++  +   +I   +E   +RA ME   +R   A+I  + ++  G+  + D+ +S L SG+ F            ++H L +  RE+
Sbjct:  103 EFYTDQLKSMAARKTLLTLEGEEGQDRH-----KIINDLKTALRTQPMRFVTRFIEVDGLSCILNFLKSMDYETAESHVHTSLIGCLKALMNNSQGRAHVLGHNES--------ITIIAQSLATENIKTKVSILEILGAVCLVPGGHKKVLEAMLYFQKFSSERTRFQNLLSSLDRSTGHYRDEVDLKTAIMSFINAVLSQGPGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHANVTLDRHLDFFEMLRNEDEALMSKRFDVGHIETKSASQMFEL-------------IKKNLNHTEAYPHFLSALQHCVTMPYKQNSTTLQYWVILDRIVQQL-VLQTDKGENPDVALLE-DFNVKRIVHMLAKENEIKQWKEQADKMRKEHQNLQQRFEKKERECDTRNKEKDDMMETMHKIK-DKLEQESKNH---KQAKLVVAELSAQL--HSQNHNKHLYLHLSIHKTSIVPGGPP----------------------------------VTSRNLVPPGPIPSTSAPSISPPRASLGAAQKKNIPKPSSP-LKSFNWSKLPESKTEETIWMEIDDLNVFKVLDLEEFQRMFSAYQ-----------KPQKDTEDDHAFAKKVNELSVIDGRRAQNCNILLSRLKLTNDEIRHAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIELLED--HKHELDRMARADRFLYDMSRINHYQERLQSLYFKKKFAERVAEVKPKIKALCLASKEVVQSGTLRQLLEVVLAFGNYMNKGQRANAYGFKVSSLNKIADTKSSTDKNI----TLLHYIVSLLEEKYPKVAAFSEELQSVPEASKVNMAELEKDINILRSGLKSVEAELQYQQAQSSQGPVDKFVPVLSQFITVASFSF-------SDIEESLSEAKELFAKALRHFAEDSYMLPDQFFGIFNNFLTAFSEAKLDNYNIARRKEEEDRRALMEAQLKRDREARIRKTKASVKGEDSEFDDLVSALRSGELFDEDLSKMHHRKRRRHNLVDSSRER 1028          
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Match: A0A3Q3MI70 (Uncharacterized protein OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 6.164e-58
Identity = 254/993 (25.58%), Postives = 446/993 (44.91%), Query Frame = 2
Query:  488 DSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQFI-----FQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGY-LYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLK-CTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVA------WNSILADREKRAQME-----ERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKH------------RLFNVMREK 3364
            D  + E  K+ D L  ALRT+ +++V  F D DGL  I  +++        SQ  +  I CI++L N+  G +++L   E+        + +I + L S N  T   + E+ GA+C    G  +V++A L Y        RF  LV         ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  +  L + ++ F +   +D++   +                    V+          I K L  TE+  +L S+L H L++P ++ N    Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ ++L  L  +NE+K  +++ D +  D   L Q+ +  + +C     +K  + E       +++ ET  +++ K +   L+ ++ KL       CS    I ++    P   A  S   +P+P  P PP PPPP      P    +      P    + S  K N+P  + P      +K FNWSK+P SKL  +IW  ID+   +  +DLE  Q  FS              KP    +  +  +     +++I+ +R+QN  + L + +++  + +  +L     + D +  L   + E LLK  P   +IELLE+    H +  + +A+ F+Y+ SR   YQ+RL  L F  K  E V  +  +++ L  + + ++ S  L +L E+VLA GN +N+ +RG  YGFKV  LN++   K  T+K++     LLH+++   E+  P++     +L+NV    KVN   + +D+  +   LKS++  +   +   ++A  D F+       P I + +       + V++S+ E     G            S+    +      TF T    A           A+ E+RA  E     +R+  A++  +N     + G+ D+ +S L SG+ F K+            +LFN  RE+
Sbjct:  123 DEEEQERHKIIDSLKTALRTQPMRFVTRFTDLDGLSCILNFLKSMDYETTESQIHTSLIGCIKALMNNSQGRAHVLGHCES--------INIITQSLASENIKTKVAVLEILGAVCLVSGGHKKVLEAMLHYQKFASERTRFQTLVTDLSRSTGRYRDEVNLKTAIMSFINAVLSQGAGESSLEF-RIHLRYEFLMLGIQPVIDKLRSHENATLDRHLDFFEILRNEDELVMSKRFGV--------------VHVETKSASQMFELIKKALNHTEAYPHLLSILQHCLMMPYKQSNTIPQYWVLLDRIVQQLVLQTSKGE---DPDVAPLEDFNVKNILHMLVKENEVKQWKEQADKMKKDYNNLQQRFEKKERECESKNKEKEDIMEMVNKMKDKLERETNDHKQAKLQVAQLSAQLQKL----SSVCSIHLSISNVPGGPPVISA-GSLSPSPVPSIPCPPLPPPPLPPGDLPAIGMAPFAPPPPPGAPLGSAPKKNIPEPSSP------MKSFNWSKLPESKLEGTIWKEIDDLKVFKVLDLEEFQRTFSAYQ-----------KPQKGAEDEQTYAKKVKELSVIDGRRAQNCNILLSRLKLTNEEIRHAIL-----TMDEQEDLSKDMLEQLLKFVPAKTDIELLEE--HKHELDRMAKADHFLYDMSRINHYQQRLQALYFKKKFAERVAEVKPKIKALCLASREVVQSGSLRQLLEVVLAFGNYLNKGQRGNAYGFKVSGLNKIADTKSSTDKNV----TLLHYMITVLEQKYPKVAAFSAELQNVPEAAKVNMTELEKDIGNLRSGLKSVEAELQYQQVQSSQASVDKFV-------PVISQFITMASFSFSEVEESLTEAKELFG--KALRHFGEDSSKLQPDEFFGIFDTFFTAFSEAKQDNENMARHKAEEERRAVKEAQLKRDREQKARMSKANEE---EGGEFDDLVSALRSGEVFDKNLSKINRKKQGRPKLFNSSRER 1044          
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Match: A0A5G3KN53 (TatD DNase domain containing 1 OS=Xenopus tropicalis OX=8364 GN=tatdn1 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.023e-57
Identity = 225/846 (26.60%), Postives = 399/846 (47.16%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALAN---EVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E     N   +VA+L  + Q+    +N +  L        A    + T L     P      P  PP PP   +      P   +  ++ + N+P    P      LK FNW K+  +KL  ++W  +D+   +  +DLE ++  FS      D  + N I  K            +    +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  120 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKETTEYKNVKQQVAELTAQIQE----LNSVSIL--------AYVFIVWTTLGSSALPDSHSGGPPPPPGPPLLGTAP----PGAPMGPAMKRKNIPQPKNP------LKSFNWVKLADNKLEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQDFFMNNGIKQKETDCTDDTLSSKMKVKELSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 896          
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Match: G3SMZ6 (Dishevelled associated activator of morphogenesis 1 OS=Loxodonta africana OX=9785 GN=DAAM1 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.364e-57
Identity = 215/858 (25.06%), Postives = 396/858 (46.15%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKL-KIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLS--LATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            K  + L  ALRT+ +++V  F+D DGL  I  +++        S+  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V+ A L Y        RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  +                 +D            K LT +E+  +  S+LHH L +P +R  N   Y  ++D ++QQI +Q   G    DP  + L+  NI +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  + +       +++ ET  ++++KQ+   +A+  A+L ++  +  C+ V    S         +                                 +   + P P     L    L  KN+P   + L K FNWSK+P +KL+ ++W+ ID++  +N +DLE L+  FS              K   +  ++  LS       +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E + S  + +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   EK  P++  L ++L ++    KVN   + ++++ +   LK+++  ++  K  P +   D F+ V  +           +++L    KD
Sbjct:  142 KTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFEL--------------VHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ---DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQ---VADLTAQLHELSRRAICASVPGGPSPGAPGGPFPSS------------------------------LPVGGGIMPPPGAPLGLA---LKKKNIPQPTNAL-KSFNWSKLPENKLDGTVWTEIDDSKVFNILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKFKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSSALRQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITIVEKKYPKVLSLNEELRDIPEAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQP-GDKFVSVVSQFITVASFSFSDVEDLLAEAKD 925          
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Match: A0A5G3KN48 (TatD DNase domain containing 1 OS=Xenopus tropicalis OX=8364 GN=tatdn1 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.691e-57
Identity = 220/843 (26.10%), Postives = 396/843 (46.98%), Query Frame = 2
Query:  482 IDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +D  ++ E  K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++LA +E+        + VI + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF  L++        ++D + +K +I+S INA+       + L   R+HLRY+ L  G+   +       ++ L + ++ F +   +D++EF +  D                 +D          I K LT TES  + +S++HH L +P +R  N   +  ++D +VQQI +Q   G    DP +S L+  N+ +++  L  +NE+K  +++ + +  +   L QK++  + +C     +K  +          + +  K+ EKL++E      E   +K +  +  + +  ++S+    P       + +T         P       PPPP PP        P   +  ++ + N+P    P      LK FNW K+  +KL  ++W  +D+   +  +DLE ++  FS      D  + N I               +    +++I+ +R+QN  + L + +++  + K  +L     + D +  L   + E LLK  P   +I+LLE+    H +  + +A+ F++E SR   YQ+RL  L F  K  E V  +  ++E +  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P+I  L ++L+ +    KVN   + +++  +   LKS++N ++  K  PT    D F+ V
Sbjct:  120 MDKEDEDERNKTIESLKTALRTKPMRFVTRFIDLDGLTCILNFLKCMDYEIAESQIHTSLIGCIKALMNNSQGRAHVLAHSES--------INVIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRYASERTRFQTLINDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF-RLHLRYEFLMLGIQPVMDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFDL--------------VHIDTKSATQMFELIRKRLTHTESYPHFTSIMHHCLQMPYKRSGNTVHHWLLLDRIVQQIVIQNEKGQ---DPDISPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEM----------MQTLNKMKEKLEKE----TTEYKNVKQQVAELTAQIQELNSVTFPSP---LSIKYYITGTTLGSSALPDSHSGGPPPPPGPPLLGT--APPGAPMGPAMKRKNIPQPKNP------LKSFNWVKLADNKLEGTLWIDLDDAKVFKILDLEDIERTFSAYQRQQDFFMNNGIKQVKTDCTDDTLSSKMKVKELSVIDGRRAQNCNILLSRLKLTNEEIKRAIL-----TMDEQEDLPKDMLEQLLKFVPEKSDIDLLEE--HKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRDASKEVLQSKCLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITVVEKKYPKIVNLHEELQAISVAAKVNMTELEKEIGTLRNGLKSVENELEYQKTQPT-LPGDKFVSV 900          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 152.91 bits (385), Expect = 3.958e-37
Identity = 106/348 (30.46%), Postives = 182/348 (52.30%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV--DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +L K N+P  + P      LK FNW+K+  +KL  ++W+ +D++  +  +DL  ++  FS      D  + N    K      ++   S     +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E +LK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P++ +  + L+NV    KVN   + +++N +   LKS+++ +D  KK P +   D F+ V
Sbjct:  601 ALKKKNIPQPSNP------LKSFNWAKLSENKLEGTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQDFFMVNNSKQKEAEDDALS---SKKVKELSVIDGRRAQNCNILLSRLKLSNEEMKRAIL-----TMDEQEDLPKDMLEQMLKFIPEKSDVDLLEE--HKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEV-GDKFVSV 928          

HSP 2 Score: 99.7525 bits (247), Expect = 1.057e-20
Identity = 92/367 (25.07%), Postives = 176/367 (47.96%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+  E+        + +I + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF +L++        ++D + +K +I+S INA+         L   RVHLRY+ L  G+   +    +  ++ L + ++ F   + DD             +  +     +  +D          I K +T T++  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  D   L QK++  + +C
Sbjct:  132 KTIESLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHPES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGETSLEF-RVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDD-------------ELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDVTPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKDHHELQQKMEKKEREC 473          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Match: daam1b (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:103042845])

HSP 1 Score: 152.525 bits (384), Expect = 4.551e-37
Identity = 106/346 (30.64%), Postives = 180/346 (52.02%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            +L K N+P  + P      LK FNW+K+  +KL  ++W+ +D++  +  +DL  ++  FS             L   SS +V          +++I+ +R+QN  + L + ++S  + K  +L     + D +  L   + E +LK  P   +++LLE+    H +  + +A+ F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++ S  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P++ +  + L+NV    KVN   + +++N +   LKS+++ +D  KK P +   D F+ V
Sbjct:  601 ALKKKNIPQPSNP------LKSFNWAKLSENKLEGTVWAEMDDSRVFKILDLTDIEKTFSAYQRQQKEAEDDAL---SSKKVKE--------LSVIDGRRAQNCNILLSRLKLSNEEMKRAIL-----TMDEQEDLPKDMLEQMLKFIPEKSDVDLLEE--HKHELDRMAKADRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKVEALTRASKEMLQSRNLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITILEKKYPKVMQFSEDLQNVPEAAKVNMTELEKEINNLRSGLKSVESELDFQKKRPQEV-GDKFVSV 918          

HSP 2 Score: 100.138 bits (248), Expect = 8.707e-21
Identity = 92/367 (25.07%), Postives = 176/367 (47.96%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+  E+        + +I + L + N  T   + E+ GA+C    G  +V++A+ +  R      RF +L++        ++D + +K +I+S INA+         L   RVHLRY+ L  G+   +    +  ++ L + ++ F   + DD             +  +     +  +D          I K +T T++  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  D   L QK++  + +C
Sbjct:  132 KTIESLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYETTESQIHTSLIGCIKALMNNSQGRAHVLSHPES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKVLEAMLHYQRFASERTRFQMLLNDLDRSTGRYRDEVSLKTAIMSFINAVLSQGAGETSLEF-RVHLRYEFLMLGIQPIIDKLRSHENSTLDRHLDYFEMLRNDD-------------ELTVSRRFESVHIDTKSASQVFDLIRKKMTHTDAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDVTPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKDHHELQQKMEKKEREC 473          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 140.969 bits (354), Expect = 2.019e-33
Identity = 133/479 (27.77%), Postives = 222/479 (46.35%), Query Frame = 2
Query: 1952 SNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV---NIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELE-ILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSI------LADREKRAQME-------ERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKK 3334
            ++L TK++P   S  LK FNW+K+  +K+  +IW  ID+   +  +DL+ ++  FS       L      K   +  ++  L L +  V   ++I+ +R+QN  + L + ++S  + K  +LE      D    L   + E LLK  P   +I+LLE+    H +  +  A+ F++E SR   YQ+RL  L F  K  E +     ++E ILH+S + ++ S  L ++ E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     +LH++++  EK  P+   +P+ L +V    KVN   + +++  I   LK L+  +   ++   +   D F+ V             +L++L    K+   +     G           +      +      TFL     A   +        + EKRA+ME       ER+  AK  A   +   + G+ D+ +S L SG+ F K
Sbjct:  602 TSLRTKSIPQ-PSHPLKSFNWAKLGENKITGTIWHDIDDLRAFKVLDLKEIEKMFSAYQRQQELLTNQSFKQKETGSMDD-LYLTSRKVKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEM-----DEREELAKDMLEQLLKFVPEKSDIDLLEE--HKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFAERLAETKPKVEAILHAS-RELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLN---KIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFG---------EEQGRMQPDEFFGIFDTFLQSFSEARQDLENMQRRKEEEEKRARMEAMLKDQRERERRAKKSAGGVSE--EVGEFDDLVSALRSGEVFDK 1055          

HSP 2 Score: 86.6557 bits (213), Expect = 1.157e-16
Identity = 91/376 (24.20%), Postives = 174/376 (46.28%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDV-NFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDM--------LLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K+ + L  ALRT+ +++V  F++ DGL  +  +++        S+  +  I CI++L N+  G +++LA  ++        +  I + L   N  T   + E+ GA+C    G  +V+ A+ +  +      RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L + ++ F +   +DD E  +  D               T VD          I K L+ +++  +L S+L H L +P +R  G +   Q++D ++QQI +Q   G    DP +S L   N+ ++        L RL  +NE+K  + + +    D   L  +++  + +C
Sbjct:  128 KVVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLKSMDFETSESRIHTSIIGCIKALMNNSQGRAHVLAHPQS--------INTISQSLRQDNIKTKVAVLEILGAVCLVPDGHKKVLQAMAHYQKYAAERTRFQTLLNELDRSTGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRGHENATLDRHLDFFEMVRNEDDSELAKRFDM--------------THVDTKSAGQMFELIKKKLSHSDAYPHLLSILQHCLQMPYKRGAGGIQQWQLLDRILQQIVLQDDKGE---DPDVSPLDNFNVKNIIRIYGKQCLSRLVNENEVKQWRDQAEKFRKDHAELMARLERKEREC 477          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 140.584 bits (353), Expect = 2.456e-33
Identity = 133/479 (27.77%), Postives = 222/479 (46.35%), Query Frame = 2
Query: 1952 SNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPV---NIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELE-ILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSI------LADREKRAQME-------ERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKK 3334
            ++L TK++P   S  LK FNW+K+  +K+  +IW  ID+   +  +DL+ ++  FS       L      K   +  ++  L L +  V   ++I+ +R+QN  + L + ++S  + K  +LE      D    L   + E LLK  P   +I+LLE+    H +  +  A+ F++E SR   YQ+RL  L F  K  E +     ++E ILH+S + ++ S  L ++ E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     +LH++++  EK  P+   +P+ L +V    KVN   + +++  I   LK L+  +   ++   +   D F+ V             +L++L    K+   +     G           +      +      TFL     A   +        + EKRA+ME       ER+  AK  A   +   + G+ D+ +S L SG+ F K
Sbjct:  594 TSLRTKSIPQ-PSHPLKSFNWAKLGENKITGTIWHDIDDLRAFKVLDLKEIEKMFSAYQRQQELLTNQSFKQKETGSMDD-LYLTSRKVKELSVIDGRRAQNCVILLSKLKMSNEEIKRAILEM-----DEREELAKDMLEQLLKFVPEKSDIDLLEE--HKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFAERLAETKPKVEAILHAS-RELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLN---KIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFG---------EEQGRMQPDEFFGIFDTFLQSFSEARQDLENMQRRKEEEEKRARMEAMLKDQRERERRAKKSAGGVSE--EVGEFDDLVSALRSGEVFDK 1047          

HSP 2 Score: 90.1225 bits (222), Expect = 8.474e-18
Identity = 89/368 (24.18%), Postives = 173/368 (47.01%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDV-NFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K+ + L  ALRT+ +++V  F++ DGL  +  +++        S+  +  I CI++L N+  G +++LA  ++        +  I + L   N  T   + E+ GA+C    G  +V+ A+ +  +      RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L + ++ F +   +DD E  +  D               T VD          I K L+ +++  +L S+L H L +P +R  G +   Q++D ++QQI +Q   G    DP +S L   N+ +++  L  +NE+K  + + +    D   L  +++  + +C
Sbjct:  128 KVVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLKSMDFETSESRIHTSIIGCIKALMNNSQGRAHVLAHPQS--------INTISQSLRQDNIKTKVAVLEILGAVCLVPDGHKKVLQAMAHYQKYAAERTRFQTLLNELDRSTGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRGHENATLDRHLDFFEMVRNEDDSELAKRFDM--------------THVDTKSAGQMFELIKKKLSHSDAYPHLLSILQHCLQMPYKRGAGGIQQWQLLDRILQQIVLQDDKGE---DPDVSPLDNFNVKNIIRMLVNENEVKQWRDQAEKFRKDHAELMARLERKEREC 469          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Match: daam2 (dishevelled associated activator of morphogenesis 2 [Source:NCBI gene;Acc:103039904])

HSP 1 Score: 138.658 bits (348), Expect = 9.487e-33
Identity = 132/479 (27.56%), Postives = 223/479 (46.56%), Query Frame = 2
Query: 1952 SNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPV---DLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELE-ILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSI------LADREKRAQME-------ERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKK 3334
            ++L TK++P   S  LK FNW+K+  +K+  +IW  ID+   +  +DL+ ++  FS       + G  + + L   +S +V          +++I+ +R+QN  + L + ++S  + K  +LE      D    L   + E LLK  P   +I+LLE+    H +  +  A+ F++E SR   YQ+RL  L F  K  E +     ++E ILH+S + ++ S  L ++ E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     +LH++++  EK  P+   +P+ L +V    KVN   + +++  I   LK L+  +   ++   +   D F+ V             +L++L    K+   +     G           +      +      TFL     A   +        + EKRA+ME       ER+  AK  A   +   + G+ D+ +S L SG+ F K
Sbjct:  594 TSLRTKSIPQ-PSHPLKSFNWAKLGENKITGTIWHDIDDLRAFKVLDLKEIEKMFSAYQRQQKETGSMDDLYL---TSRKVKE--------LSVIDGRRAQNCVILLSKLKMSNEEIKRAILEM-----DEREELAKDMLEQLLKFVPEKSDIDLLEE--HKHELERMARADRFLFEMSRIDHYQQRLQSLFFKKKFAERLAETKPKVEAILHAS-RELVRSKRLTQILEVVLAFGNFMNKGQRGNAYGFKVSSLN---KIADTKSSIDRSITMLHYLIMIFEKNYPDTLNIPQDLLSVPDAAKVNLAELEKEVYSIKSGLKGLEAELQ-YQQARVRDRGDKFVPVVSDFITVASFSFSELEDLLNEAKEKFMKALKHFG---------EEQGRMQPDEFFGIFDTFLQSFSEARQDLENMQRRKEEEEKRARMEAMLKDQRERERRAKKSAGGVSE--EVGEFDDLVSALRSGEVFDK 1037          

HSP 2 Score: 90.5077 bits (223), Expect = 7.358e-18
Identity = 89/368 (24.18%), Postives = 173/368 (47.01%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDV-NFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K+ + L  ALRT+ +++V  F++ DGL  +  +++        S+  +  I CI++L N+  G +++LA  ++        +  I + L   N  T   + E+ GA+C    G  +V+ A+ +  +      RF  L+++       ++D +++K +I+S INA+       +D L  R+HLRY+ L  G+   +       +  L + ++ F +   +DD E  +  D               T VD          I K L+ +++  +L S+L H L +P +R  G +   Q++D ++QQI +Q   G    DP +S L   N+ +++  L  +NE+K  + + +    D   L  +++  + +C
Sbjct:  128 KVVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLKSMDFETSESRIHTSIIGCIKALMNNSQGRAHVLAHPQS--------INTISQSLRQDNIKTKVAVLEILGAVCLVPDGHKKVLQAMAHYQKYAAERTRFQTLLNELDRSTGRYRDEVNLKTAIMSFINAVLN-AGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRGHENATLDRHLDFFEMVRNEDDSELAKRFDM--------------THVDTKSAGQMFELIKKKLSHSDAYPHLLSILQHCLQMPYKRGAGGIQQWQLLDRILQQIVLQDDKGE---DPDVSPLDNFNVKNIIRMLVNENEVKQWRDQAEKFRKDHAELMARLERKEREC 469          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 147.132 bits (370), Expect = 4.442e-36
Identity = 113/415 (27.23%), Postives = 198/415 (47.71%), Query Frame = 2
Query: 1943 LTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFST--------------------VPVDLGLKNPIPLKPHSSPQVNRRLS-----LA----------------TIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLK-CTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNE 3058
            L K N+P    P      LK FNW+K+P +K++ +IWS +D+   +  +DL+ ++  FS                        D+G K   P        +++R S     LA                   +++I+ +R+QN  + L + ++S  + K  L+       D +  L   + E LLK  P   ++++LE+    H I  +  A+ F+++ SR P YQ+RL  L F  K  E +     ++E +  + + +  S  L +L ELVLA+GN MN+ +RG  YGFK+ SLN++   K  T+K+I    NLLH+++I  EK  P++  +   L++V    KVN   + +++N I I LK+++  ++  ++    A  D F+ V             +L++L +  K+  N+
Sbjct:  440 LKKKNIPQPANP------LKSFNWAKLPENKIDGTIWSELDDQRAFRVLDLQDIERVFSAYQRQQLACVKKNQIILQEKQCSFDVGDKYR-PFNGTRRKTLSKRASQLEANLAHKELGSTEDLHHGNKRAKELSVIDGRRAQNCVILLSKLKMSNEEIKRALMRM-----DEQEELPKDMLEQLLKFVPEKSDVDVLEE--HRHEIERMARADRFLFDMSRIPHYQQRLQALFFKKKFAERLGECKPKVEAILLASREVSRSRRLRQLLELVLALGNYMNKGQRGNAYGFKISSLNKIADTKSSTDKNI----NLLHYLIIVVEKKFPDVLGISDDLQHVPEAAKVNLTEMEKEINNIKIGLKAVEAELEF-QRTHASAIGDRFISVMSDFITVASFSFSELEDLLSEAKEKFNK 835          

HSP 2 Score: 81.2629 bits (199), Expect = 9.917e-16
Identity = 83/353 (23.51%), Postives = 169/353 (47.88%), Query Frame = 2
Query:  557 KYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            ++V  F++ DGL  +  +++        SQ  +  I CI++L N+  G +++LA  E+        + VI + L S N   V+++ E+ GA+C    G  +V+ A L+Y            L+ +       ++D + +K +I+S INA+       ++L   RVHLRY+ L  G+   V    +  +  L + ++ F +   +D+ E  +  D                 +D          I + L FTE+  +L S+L+H L +P ++ +  + + Q++D ++QQI +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  + + L  +++  + +C
Sbjct:    1 RFVTRFIELDGLSCLLNFLKKMDYETAESQIHTSVIGCIKALMNNSQGRAHVLAHPES--------INVISQSLSSENATKVAVL-EILGAVCLVPGGHRKVLQAMLRYQQHAAERTLLQTLITELDRNTGKYRDEVSLKTAIMSFINAILNAGTGQENLEF-RVHLRYEFLMLGIQSLVDKLRSHENATLDRHLDFFEMIRNEDEAELAKRFDM--------------MHIDTKSAGQMFDVIKRKLKFTEAYPHLMSILYHCLHMPYKKSSVMVQHWQLLDRILQQIVLQSERG---DDPDVAPLENFNVKNIVRMLVNENEVKQWKEQAEKMRKEHSELLGRLEKKEREC 326          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005288.1 (pep scaffold:Pmarinus_7.0:GL501244:1260:30258:-1 gene:ENSPMAG00000004723.1 transcript:ENSPMAT00000005288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 3.250e-30
Identity = 99/370 (26.76%), Postives = 180/370 (48.65%), Query Frame = 2
Query: 1949 KSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPL---KPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKD 3046
            K  +P  + P      LK FNWSK+P +K++ ++WS ID+   +  +DL  ++  FS       +   I     +  S+ ++    S     +++I+ +R+QN  + L + +I+    + ++++ +    + E   H      LLK  P   +++LLE+    H    +  A+ F+Y+ SR P YQ+R   L F  K  E V     ++E +  + K +  S  L +L E+VLA GN MN+ +RG  YGFK+ SLN   K+  T  SI     LLH+++   EK  P++  +   L++V    +VN   + +++N +   LK ++  +D  +  P +  +D F+ V             ++D++    K+
Sbjct:  536 KKKIPQPSNP------LKSFNWSKLPENKISSTVWSEIDDLRAFKVLDLADIERMFSAYQRQQTVFRWIRCVQKEMGSNEELLDCGSRKAKELSVIDGRRAQNCVILLSRIKIT----RFEVVQKSEERCERETLAHDTAVSQLLKFVPEKSDVDLLEE--HKHETERMARADRFLYDMSRIPHYQQR-QALYFKKKFAERVAECKPKVEAILLASKELHQSRRLRQLLEVVLAFGNYMNKGQRGNAYGFKISSLN---KIADTKSSIDKNITLLHYLITILEKKYPDVVNIQDDLQHVPEAARVNMLELEKEINLVRGGLKDVEKELDFQRAQPGRP-DDKFVSVMSDFITVASFSFSEVDDILCEAKE 888          

HSP 2 Score: 64.6994 bits (156), Expect = 9.774e-11
Identity = 87/373 (23.32%), Postives = 166/373 (44.50%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKY---VKHFMDCDGLHLIFTYMRDKGVH-AINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINAL--AEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K+ + L  ALRT+ ++        + C     I   ++   ++ + N + FS  +     L N + G +++LA   +        +E I + L + N  T   + E+ GA+C    G  RV+ A L Y        RF  LV++       ++D + +K +I+S INA+  A   +D+ +    RVHLRY+ L  G+   +       +  L K ++ F +   +D+ E  +  D               T VD   +      I K L  TE+  +LS L H L +   +        Q++D ++QQ+ +Q   G    DP ++ L+  ++ +++  L  +NE+K  +++ +    + + L Q+++  + +C
Sbjct:   72 KVVEDLKTALRTQPMRRFSACSELLPCASTPFIMNCLKTSQLNNSHNIRHFSLSLFTKGGLSNHQ-GRAHVLAHPAS--------IETIAQSLRTENVRTKVAVLEILGAVCLVPGGHKRVLQAMLHYQKYAAERTRFQTLVNELDRSTGRYRDEVSLKTAIMSFINAVLNAGAGKDNMEF---RVHLRYEFLMLGIQPVIDKLRGHDNATLDKHLDFFEMIRNEDEAELAKRFDM--------------THVDTKSVGQMFDVIRKKLAHTEAYPHLSILQHCLEMPYKRNGTMVQQWQLLDRILQQVVLQSDRGE---DPDVAPLENFSVKNIVRMLVNENEVKQWKEQAEKTRKEHSELMQRLEKKEREC 415          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010834.1 (pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1 gene:ENSPMAG00000009817.1 transcript:ENSPMAT00000010834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 4.381e-21
Identity = 77/340 (22.65%), Postives = 160/340 (47.06%), Query Frame = 2
Query: 1976 PVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFST----VPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLED-AVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVF 2977
            P+     +  FNW  +  +++N ++++ +D+     ++D++  +  F T      VDL L + I +   +  +V            ++   R++NLA+ L++  ++  +       C  +       L     E L +  P+  E++LL         +  L + + FM + S+     +R++ +IF     E+V+ L  +L  + ++  SI +S  + ++ E++LA GN MN  +RG VYGFK+ SL+ L + K T++ +     LLH++    +   P++     +L  +     V+  ++ +D+ E       LQ  +DL K++ +  E++  L+ F
Sbjct:  622 PIKTKFRMPVFNWVALKPNQINGTVFNELDDEKILEELDMDEFEEMFKTRAQGATVDLCL-SKIKMVHKTQNKVT-----------LLETNRAKNLAITLRKGGLTTEEI------CRAIQMFDLQTLRLDFVECLTRFLPSEAEVKLLRQYERERKPLDELADEDRFMLQFSKIERLTQRMTIMIFIGNFTENVQMLTPQLNAIIAASMSIKSSHKIKKILEIILAFGNYMNSSKRGAVYGFKLQSLDLLIETKSTDRKL----TLLHYISNIVQHKYPDLVTFYNELRYIEKAAAVSMENVLQDVRE-------LQRGMDLTKREFSMHESNTLLREF 932          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000125.1 (pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 gene:ENSPMAG00000000108.1 transcript:ENSPMAT00000000125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 8.916e-17
Identity = 105/483 (21.74%), Postives = 199/483 (41.20%), Query Frame = 2
Query: 1991 ILLKCFNWSKV-PHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKD-----PTKAENDNFL-KVFDKLYPTICEDVDKL----DNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKL-LNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNP-------------------VGKKGDMDNNISRLLSGDAFKKHR 3340
            I  K  NW+K+ P     +S W++  E  F N   L  L   F+     +  +          P   +++      + +++ +  QNL++ L   ++ +++ K  +LE N      E  +   + + L+K  P  +++E L  A       +L EAE F          + RL+ + F  +  E V  +  ++  + ++ + +  S    RL E+VL  GN MN   R    +GF +  L +L+  K  ++       LLHF+    E   PE+ +  + L +V    +V+  ++ ++       LK ++N ++ ++KD      T+ +ND F+ K+         E   +L    DN+QT   D + E+ +F                 +T+K+ + E    LT+    +   + D  +R + EE+   A++    +                       + G MD+ +  L SG AFK+ R
Sbjct:  747 ISTKRANWAKIRPEEFKENSFWTKAKEERFENPDVLSKLAQTFAAQAAKVRAQKEQEGVEKDKPPSKKKIK----ELKVLDQKSGQNLSIFLGTLKMPYTEIKKIILEVN------EEKITESMIQNLIKQLPEADQLEAL--AGFKDEYDDLAEAEQFSVVIGSVTRLRSRLTAIQFMLQFEEQVSSVKPDVVAVTAACEEVQQSDAFSRLLEIVLLFGNYMNAGSRNAQTFGFNISYLCKLRDTKSADQK----QTLLHFLAEVCEAEYPEVLKFTEDLSHVEKASRVSAENLQKN-------LKQMENQIEQLEKDIQSFPSTEDKNDKFVEKMTISFMRKAREQYGRLALMFDNMQTLF-DGLGEYFVF-----------------NTKKVSVEEFFGDLTNFRSMFMQAVKDNVRRREAEEKIQKAQLAKERAEKERLEKQNKKRLLLLKMHTDGDETGVMDSLMEALQSGAAFKRKR 1188          

HSP 2 Score: 51.9878 bits (123), Expect = 9.574e-7
Identity = 56/235 (23.83%), Postives = 106/235 (45.11%), Query Frame = 2
Query:  488 DSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRD----KGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCF-------SHKGWLRVMDALKYLSRNDVNFRFAILVHQFIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIE 1159
            DS+Q       + L  +L +  + +V+ F D +GL ++   ++D    +  +  + +   + +RC+R+  N++ G   +LA +        G+L ++ + +  R+   +     L  AL           K   RV+DAL   +      RF  +V     + +L +K +   LINAL E  +D    L  R+HLR + +R+GLG  +       +  L  Q+ VF + ++ D +
Sbjct:  120 DSDQERLLSCLESLRVSLTSNPVSWVELFGD-EGLKILLDILQDLQEKQSPNHFDWKIQLEIVRCLRAFMNNKVGLRAMLATHN-------GVL-LLARAVEPRHPSMMVEAVRLLSALSILDEDHFDGAKPSSRVLDALAECAEICEQERFQPIVEGLDVKQSLSLKIACFILINALVETPED----LEFRIHLRNEFMRNGLGKALTHLREIQNEQLEVQLRVFDEGREGDFQ 341          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000679.1 (pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 gene:ENSPMAG00000000612.1 transcript:ENSPMAT00000000679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 1.395e-14
Identity = 49/163 (30.06%), Postives = 88/163 (53.99%), Query Frame = 2
Query: 2441 NLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVM---NQRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEK---TIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQ 2911
             L + E F+YE S+ P + ER+ C++F     EH++ +   LE++H + K +  S  + ++  L+L  GN M   N+ RG   GF ++ L +L+ +K  +  I  ++ ++ + L   ++   T   IF LP+  E + A  +V F  I RD+ E+   LK+L+
Sbjct:  385 QLDKPEQFLYELSQIPCFFERVFCIVFQSTFTEHIKSIHCRLELVHRNSKLLKTSAGVHKVLSLILTFGNYMNGGNRTRGQADGFALEILPKLRDVKSNDNRISLVNYIVAYYLQNFDEDAGTERSIFPLPEPQELLQAA-QVKFEDIQRDMRELRKDLKALK 546          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 137.117 bits (344), Expect = 1.240e-32
Identity = 104/351 (29.63%), Postives = 172/351 (49.00%), Query Frame = 2
Query: 1925 PTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            P+     TK   P +  P  ++ L K FNWSK+P SK+  ++W+ ID+   YN++DLE     FS      G +N        S    + LSL       I+ +R+QN  + L + ++S      + +   +++ D E  L   + E LLK  PT  E  LL +  +N    N   A+ F+Y+ SR   Y++RL  L F  K PE +  L  +++ +  + K +  S  +  L E++LA GN MN+  RG   GFK+ SLN++   K +  S +    LL++++   EK+ P++ +L + L NV    KVN   +  ++  +   LK ++  +D   +   K   D F+ V
Sbjct:  666 PSSFFGFTKQ--PNRKTPKPSNPL-KSFNWSKLPDSKIKGTVWTDIDDTKVYNEMDLEDFDRMFSAYQ---GKENQGIKDFTDSAAKPKELSL-------IDSRRAQNCGILLTKLKLS-----DEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLNE--NNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNATGFKLASLNRIVDTKSSANSRI---TLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKELKEVEKELDFQTRKREKIPGDKFVDV 993          

HSP 2 Score: 83.9593 bits (206), Expect = 2.902e-16
Identity = 61/259 (23.55%), Postives = 127/259 (49.03%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSR-NDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLR 1168
            +F  ++LK++  +  +LC+   D +   +     L D L  ALRT+ L++V  F++ +GL  +  ++++       S+  +  I C ++L NS +G +++LA            +++I + L + N  T   + E+ GA+C    G  + +DA+ +  +  +   RF  LV+       ++++  ++K +I+S INA  ++    + L   RVHLR++ L  G+   ++      +  L + +  F +   +D+ E  R
Sbjct:  116 EFYIDQLKSL--NSQKLCLMKSDEETEMR---STLLDGLKTALRTQPLRFVHRFVELEGLSCLLNFLQNMDYETSQSKIHTAVIGCFKALMNSSHGRAHVLAHPT--------CIDIIAQSLLTENIKTKIQVLEILGAVCLVPGGHKKALDAMTHFQKFAEERTRFQTLVNDLDRSTGVYKEEFNLKIAIMSFINAALKYGAGAEYLEF-RVHLRFEFLMLGIQPVIEKLRTMDNATLTRHLNFFDMVRNEDEKELAR 360          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 96.6709 bits (239), Expect = 2.930e-20
Identity = 91/363 (25.07%), Postives = 161/363 (44.35%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLNDS-IWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN--QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAE-KTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKL----DNLQTAVKDSVNEF 3061
            +K  NW+K+ +  + D+  W +++E     +  L  L   F+       L NP         +           + +++ + +QNL++ L   + S  + K+ +L C+      +  L     E LLK  P+PE++E L +      I  L E E F    S     ++RL+CL+F  + PE +      +    ++ + +  SP   +L EL+L +GN MN   R     GF++  L +L     + KS+    NLLHF+    E K   EI     +L +V A  KV+   + + ++ +S +L+ ++  ++  K+  T  E D F     + Y +  + VD L     N+ T  KD +  F
Sbjct:  506 MKRANWTKINNRNITDNCFWKKVNEEKLEREDMLAELTRTFAAKSAPKKLDNP------DGEEKKSVAKKKAKELKVLDPKSAQNLSIFLGSLKSSHEEIKSHILHCD------QEKLSESAIESLLKYLPSPEQMEQLSNMKDQ--ISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEEMSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKL----SSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKELE-AKQQNTNPE-DRFHDAMKEFYSSAKDQVDVLVEMHKNMVTMFKDVLEFF 848          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Match: EDO48258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJG3])

HSP 1 Score: 76.2554 bits (186), Expect = 4.131e-14
Identity = 81/314 (25.80%), Postives = 144/314 (45.86%), Query Frame = 2
Query: 2006 FNWSKVPHSKLN-DSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELL--EDAVSNHGIGNLPEAESFMYECSR-FPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKK 2935
             +W  V HS LN ++IW R+      +  +LE+     +TVP           KP    ++  R +       I+  ++  N+++ L  +++S    K  LL        G + L   + E LL+  P+P EI+ L  ++ V       L  AE F  E ++  P Y+ER+  ++   ++ + +  +   L  +  + K I NS  L    ++VL VGN MN  +    GF+V  L +L  +K T     N+S  L ++     +  PE+  L  +L +V    KV+F ++  D+ E+   ++ L++ +D I K
Sbjct:  257 LSWEIVSHSSLNKETIWKRLSVEEVVDPYELEMYFGAQATVP-----------KPRHFKKITHRKT-------ILEHKKILNISITLAHSKLSADDVKKCLL-------SGTSDLPSDVLEQLLRFVPSPNEIKALKRQEEVDPSA---LEGAEVFCLEVAKTVPAYEERIRTMLLKAQLQDRINHIKPYLTTVIEANKEIRNSTKLSDYLQMVLTVGNFMNGSQ--TAGFRVAFLTKLVFIKSTPDK--NVS-FLDYITRQIIRKNPELALLTDELLHVEKASKVSFRTLDLDIEELREEVEILEDDLDKIAK 537          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Match: EDO27387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9E0])

HSP 1 Score: 60.8474 bits (146), Expect = 1.692e-10
Identity = 50/188 (26.60%), Postives = 95/188 (50.53%), Query Frame = 2
Query: 2216 VNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ--RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVL 2773
            + +++ +RS NL + LKQ    + K   +++   +V  D + F    + +G +KL P   E+E+L+    N     L  AE F+ E      Y+ R++ ++   ++  +++ L   +E +  +I+ I+NS  LP + +L+L +GN MN     G    FK+ SL +L   +     +    NL+HF++
Sbjct:    1 ITLLDPKRSLNLNIFLKQ----FKKSNEEIIST-IVKGDSKVF-DVDVLKGFIKLLPDNSEVEMLKGF--NGDTKMLGSAEKFLIELIAVKSYELRINAMLQKAELDINLQTLKPNIECMKKAIEEILNSETLPEVLQLILIIGNFMNSGGYAGNAIAFKISSLVKLVDTRANKPRM----NLMHFLV 176          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Match: EDO45866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ1])

HSP 1 Score: 58.5362 bits (140), Expect = 9.411e-9
Identity = 59/243 (24.28%), Postives = 109/243 (44.86%), Query Frame = 2
Query: 2375 KLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ---RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLL-----HFVLI--TAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFL 3073
            K+  T EE+  +E  + ++    L   E F+ + S+   Y+ERL+CLI    + + +  +   L       + +     +  +  L+LA GN MN     RG   GF ++ + +LK +K  N    N SNLL      +V+I      T+   F LP+   ++ +  +V+F+ +  DL  I   ++S    V  + ++        F K+ +K    + E+ ++L     A++D    F + L
Sbjct:   94 KVRGTKEELSTIEQYLEDNPDAILDRPEQFLLDVSKIVCYEERLACLIARTTVRDGLEEIGQMLTNFRLVCEELQKGKNVHNIMGLILAFGNFMNGGNIARGQADGFDLEIIPKLKDVKSRN----NTSNLLCYLVQEYVMIFDKDAGTLSAKFPLPEP-ADLQSASQVSFDDVQADLRNIEKKIESCDVMVTRVLRESDANLVQPFKKIMNKF---LVENRNELKEQIQALEDCQKRFSVLL 328          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Match: daam1b (dishevelled associated activator of morphogenesis 1 [Source:NCBI gene;Acc:101174553])

HSP 1 Score: 155.221 bits (391), Expect = 7.998e-38
Identity = 106/346 (30.64%), Postives = 176/346 (50.87%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            SL + NLP  + P      LK FNWSK+  +KL  ++W  +D+   +  +DLE ++  FS              +     + +   S     +++I+ +R+QN  + L + R+S  + K  +L     + D    L   + E LLK  P   +++LLE+    H +  + + + F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++NS  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P++ +  + L++V    KVN   + +D+  +   LKS+++ ++  KK P +   D F+ V
Sbjct:  604 SLKRKNLPQPSNP------LKSFNWSKLAENKLEGTVWMEVDDAKVFKILDLEDIEKTFSAYQ-----------RQQKEAEEDTLGSKKVKELSVIDGRRAQNCNILLSRLRLSNEEIKRAIL-----TMDEHEDLPKDMLEQLLKFIPEKSDVDLLEE--HKHELDRMAKPDRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKIEALTKASKQMLNSKSLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITILEKKYPKVLQFQEDLKSVPEAAKVNMTELEKDIGNLRSGLKSVESELEYQKKLPQQQLEDKFVSV 922          

HSP 2 Score: 90.5077 bits (223), Expect = 6.911e-18
Identity = 88/368 (23.91%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  +++++ L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              +  +D          I K L   E+  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  +   L QK +  + +C
Sbjct:  137 KTIENLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYDTTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILESMLHYQHFACERTRFQTLINDLDRKTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALSKRFE--------------SVHIDTKSATQVFELIRKKLNHHEAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDVAPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHQELQQKFEKKEREC 478          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Match: daam1b (dishevelled associated activator of morphogenesis 1 [Source:NCBI gene;Acc:101174553])

HSP 1 Score: 154.066 bits (388), Expect = 1.872e-37
Identity = 107/346 (30.92%), Postives = 176/346 (50.87%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            SL + NLP  + P      LK FNWSK+  +KL  ++W  +D+   +  +DLE ++  FS           I        + +   S     +++I+ +R+QN  + L + R+S  + K  +L     + D    L   + E LLK  P   +++LLE+    H +  + + + F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++NS  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P++ +  + L++V    KVN   + +D+  +   LKS+++ ++  KK P +   D F+ V
Sbjct:  604 SLKRKNLPQPSNP------LKSFNWSKLAENKLEGTVWMEVDDAKVFKILDLEDIEKTFSAYQRQQDFL-VISSSKQKEAEEDTLGSKKVKELSVIDGRRAQNCNILLSRLRLSNEEIKRAIL-----TMDEHEDLPKDMLEQLLKFIPEKSDVDLLEE--HKHELDRMAKPDRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKIEALTKASKQMLNSKSLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITILEKKYPKVLQFQEDLKSVPEAAKVNMTELEKDIGNLRSGLKSVESELEYQKKLPQQQLEDKFVSV 932          

HSP 2 Score: 90.5077 bits (223), Expect = 7.825e-18
Identity = 88/368 (23.91%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  +++++ L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              +  +D          I K L   E+  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  +   L QK +  + +C
Sbjct:  137 KTIENLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYDTTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILESMLHYQHFACERTRFQTLINDLDRKTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALSKRFE--------------SVHIDTKSATQVFELIRKKLNHHEAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDVAPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHQELQQKFEKKEREC 478          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Match: daam1b (dishevelled associated activator of morphogenesis 1 [Source:NCBI gene;Acc:101174553])

HSP 1 Score: 154.066 bits (388), Expect = 1.872e-37
Identity = 107/346 (30.92%), Postives = 176/346 (50.87%), Query Frame = 2
Query: 1940 SLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            SL + NLP  + P      LK FNWSK+  +KL  ++W  +D+   +  +DLE ++  FS           I        + +   S     +++I+ +R+QN  + L + R+S  + K  +L     + D    L   + E LLK  P   +++LLE+    H +  + + + F+YE SR   YQ+RL  L F  K  E +  +  ++E L  + K ++NS  L +L E+VLA GN MN+ +RG  YGFKV SLN   K+  T  SI     LLH+++   EK  P++ +  + L++V    KVN   + +D+  +   LKS+++ ++  KK P +   D F+ V
Sbjct:  604 SLKRKNLPQPSNP------LKSFNWSKLAENKLEGTVWMEVDDAKVFKILDLEDIEKTFSAYQRQQDFL-VISSSKQKEAEEDTLGSKKVKELSVIDGRRAQNCNILLSRLRLSNEEIKRAIL-----TMDEHEDLPKDMLEQLLKFIPEKSDVDLLEE--HKHELDRMAKPDRFLYEMSRINHYQQRLQSLYFKKKFAERIAEIKPKIEALTKASKQMLNSKSLKQLLEVVLAFGNYMNKGQRGNAYGFKVSSLN---KIADTKSSIDKNITLLHYLITILEKKYPKVLQFQEDLKSVPEAAKVNMTELEKDIGNLRSGLKSVESELEYQKKLPQQQLEDKFVSV 932          

HSP 2 Score: 90.5077 bits (223), Expect = 7.825e-18
Identity = 88/368 (23.91%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  512 KLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDA-LKYLSRNDVNFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVF-VQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRE-NGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKC 1588
            K  + L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I CI++L N+  G +++L+ +E+        + +I + L + N  T   + E+ GA+C    G  +++++ L Y        RF  L++        ++D +++K +I+S INA+         L   R+HLRY+ L  G+   +    +  ++ L + ++ F +   +D++   +  +              +  +D          I K L   E+  +  S+LHH LL+P +R  N   Y  ++D +VQQ+ +Q   G    DP ++ L+  N+ +++  L  +NE+K  +++ + +  +   L QK +  + +C
Sbjct:  137 KTIENLKTALRTQPMRFVTRFIDLDGLTCILNFLKSMDYDTTESQIHTSLIGCIKALMNNSQGRAHVLSHSES--------INIIAQSLATENIKTKVAVLEIMGAVCLVPGGHKKILESMLHYQHFACERTRFQTLINDLDRKTGRYRDEVNLKTAIMSFINAVLSQGAGETSLEF-RIHLRYEFLMLGIQPVIDKLRSHENSTLDRHLDFFEMLRNEDELALSKRFE--------------SVHIDTKSATQVFELIRKKLNHHEAYPHFMSVLHHCLLMPHKRSGNTVQYWLLLDRIVQQMVLQNDKGH---DPDVAPLENFNVKNVVRMLVNENEVKQWKEQAEKMRKEHQELQQKFEKKEREC 478          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Match: ENSORLT00000010950.2 (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:101155891])

HSP 1 Score: 139.043 bits (349), Expect = 7.261e-33
Identity = 105/345 (30.43%), Postives = 176/345 (51.01%), Query Frame = 2
Query: 1949 KSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPL--KPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            + N+P  + P      LK FNWSK+P +K+  +IW +ID+ + +  +DLE L+  FS        + P     + H+S +  + LS       +I+ +R+QN  + L + ++S  +    L     V+ D +  L     E LLK  P   +IELLE+    H +  +  A+ FM + S F  YQ+RL  L+F  K P+ +  +   ++ L  + + ++ S  L +L E+VLA GN MN+ +RG   GFKV SLN   K+  T  SI    +LLH+++   EK  P +    ++L NV    +VN   + +D++ +   LKS++   +L  ++  +   D F+ V
Sbjct:  589 RKNIPRPSNP------LKSFNWSKLPENKIEGTIWKKIDDRNVFKVLDLEELEKTFS------AYQRPAKEIEEDHTSVRKVKELS-------VIDGRRAQNCNILLSRLKLSNDEICQAL-----VTMDEQEDLPTDTLEQLLKFVPEKSDIELLEE--HKHEVDRMARADRFMLDMSSFDHYQQRLQTLLFKKKFPDRLADVKPRIKALGLASQEVVQSGKLCQLLEVVLAFGNYMNKGQRGNALGFKVSSLN---KIADTKSSIDKNVSLLHYMVSVLEKKFPAVAAFSEELRNVPEASRVNMVELEKDISALRSGLKSIE--AELKYQESCQRAADAFVPV 902          

HSP 2 Score: 93.9745 bits (232), Expect = 5.341e-19
Identity = 108/453 (23.84%), Postives = 203/453 (44.81%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDV-NFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDD-IEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQP 1744
            DF  ++++ M      + +  G  D       + + D L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I C ++L NS  G +++L   E+        + +I + L + N  T   + E+ GA+C    G  +V++A+ +  +      RF  L+         +++ + +K +I+S INA+     + + L   R+HLRY+ L  G+   +    +  +  L   ++ F   + DD +   + L+                 +D          I K L+ TE+  +L S L H LL+P Q+    L +  ++D +VQQ+ +Q   GA   DP ++ LQ  N+  ++  L  +N+++  Q+E   +      L Q ++  K +C     +K  L E       +++ ETK +++ KQ+   L   + +L   S  P
Sbjct:  103 DFYIDQIRVMAARRTLVSLEEGQNDGR-----QAVVDGLKTALRTQPIRFVTRFLDLDGLSCILNFLKSMDYETAESQVHTSVIGCFKALMNSSQGRTHVLGHAES--------INIITQSLSAENIKTKVAVLEILGAVCLVPGGHKKVLEAMVHYQKFAAERTRFQNLLSDLDRSTGRYREEVGLKTAIMSFINAVLSQGAEEKSLEF-RIHLRYEFLMLGIQPVIDKLRSHENATLDTHLDYFEMLRNDDELRLSKRLNV--------------GHIDTKSGSQMFELIKKRLSHTEAYPHLLSALQHCLLMPYQQSRTMLQHWVLLDRMVQQLVLQTNKGA---DPDVAPLQDFNVRTIVQNLVQENDVQQWQEEAAEMRKCNQNLQQSLEKKKRECEAKTKEKEELMELLNKMKEKLERETKEHKQAKQQVEELLARLKQLSSASSVP 524          
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Match: ENSORLT00000039506.1 (disheveled-associated activator of morphogenesis 1 [Source:NCBI gene;Acc:101155891])

HSP 1 Score: 139.043 bits (349), Expect = 7.261e-33
Identity = 105/345 (30.43%), Postives = 176/345 (51.01%), Query Frame = 2
Query: 1949 KSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPL--KPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ-RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKV 2974
            + N+P  + P      LK FNWSK+P +K+  +IW +ID+ + +  +DLE L+  FS        + P     + H+S +  + LS       +I+ +R+QN  + L + ++S  +    L     V+ D +  L     E LLK  P   +IELLE+    H +  +  A+ FM + S F  YQ+RL  L+F  K P+ +  +   ++ L  + + ++ S  L +L E+VLA GN MN+ +RG   GFKV SLN   K+  T  SI    +LLH+++   EK  P +    ++L NV    +VN   + +D++ +   LKS++   +L  ++  +   D F+ V
Sbjct:  589 RKNIPRPSNP------LKSFNWSKLPENKIEGTIWKKIDDRNVFKVLDLEELEKTFS------AYQRPAKEIEEDHTSVRKVKELS-------VIDGRRAQNCNILLSRLKLSNDEICQAL-----VTMDEQEDLPTDTLEQLLKFVPEKSDIELLEE--HKHEVDRMARADRFMLDMSSFDHYQQRLQTLLFKKKFPDRLADVKPRIKALGLASQEVVQSGKLCQLLEVVLAFGNYMNKGQRGNALGFKVSSLN---KIADTKSSIDKNVSLLHYMVSVLEKKFPAVAAFSEELRNVPEASRVNMVELEKDISALRSGLKSIE--AELKYQESCQRAADAFVPV 902          

HSP 2 Score: 93.9745 bits (232), Expect = 5.341e-19
Identity = 108/453 (23.84%), Postives = 203/453 (44.81%), Query Frame = 2
Query:  413 DFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDV-NFRFAILVHQF-----IFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDD-IEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYL-YLQMIDLLVQQISVQQVNGAQNPDPGLSDLQ-MNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQP 1744
            DF  ++++ M      + +  G  D       + + D L  ALRT+ +++V  F+D DGL  I  +++        SQ  +  I C ++L NS  G +++L   E+        + +I + L + N  T   + E+ GA+C    G  +V++A+ +  +      RF  L+         +++ + +K +I+S INA+     + + L   R+HLRY+ L  G+   +    +  +  L   ++ F   + DD +   + L+                 +D          I K L+ TE+  +L S L H LL+P Q+    L +  ++D +VQQ+ +Q   GA   DP ++ LQ  N+  ++  L  +N+++  Q+E   +      L Q ++  K +C     +K  L E       +++ ETK +++ KQ+   L   + +L   S  P
Sbjct:  103 DFYIDQIRVMAARRTLVSLEEGQNDGR-----QAVVDGLKTALRTQPIRFVTRFLDLDGLSCILNFLKSMDYETAESQVHTSVIGCFKALMNSSQGRTHVLGHAES--------INIITQSLSAENIKTKVAVLEILGAVCLVPGGHKKVLEAMVHYQKFAAERTRFQNLLSDLDRSTGRYREEVGLKTAIMSFINAVLSQGAEEKSLEF-RIHLRYEFLMLGIQPVIDKLRSHENATLDTHLDYFEMLRNDDELRLSKRLNV--------------GHIDTKSGSQMFELIKKRLSHTEAYPHLLSALQHCLLMPYQQSRTMLQHWVLLDRMVQQLVLQTNKGA---DPDVAPLQDFNVRTIVQNLVQENDVQQWQEEAAEMRKCNQNLQQSLEKKKRECEAKTKEKEELMELLNKMKEKLERETKEHKQAKQQVEELLARLKQLSSASSVP 524          
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Match: SMESG000017208.1 (SMESG000017208.1)

HSP 1 Score: 1984.92 bits (5141), Expect = 0.000e+0
Identity = 1066/1071 (99.53%), Postives = 1068/1071 (99.72%), Query Frame = 2
Query:  158 MSNLQKTRWSTRVFRRDSKAKKKDINNPQVELMEQIDTYDQSQLDALXXXXXXXXXXXXXXXXXLLKMDINQKRMLVKSQKLGRSDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDVNFRFAILVHQFIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLXXXXXXXXXXXXXXYNTQVDWVELMNFMTEISKNLTFTESQXXXXXXXXXXXXXXXQRENGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELKTKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADASFIMTXXXXXXXXXXXXXXXXXXXXXXXXXSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKHRLFNVMREKKY 3370
            MSNLQKTRWSTRVFRRDSKAKKKDINNPQVELMEQIDTYDQSQLDALISEFSDEIFFDEESKEKLLKMDINQKRMLVKSQKLGRSDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDVNFRFAILVHQFIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLDRISIDDNIMDDSMYNTQVDWVELMNFMTEISKNLTFTESQLYLSSLLHHLLLLPLQRENGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELK KQQE+DSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQE DASFIMTPLPP PPPPPPPPPPLLPPPPPPPPSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGENLPSNLSESSESEDSTQKLLNE+STFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKHRLFNVMREKKY
Sbjct:    1 MSNLQKTRWSTRVFRRDSKAKKKDINNPQVELMEQIDTYDQSQLDALISEFSDEIFFDEESKEKLLKMDINQKRMLVKSQKLGRSDFCFEELKNMLEHLNQLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFTYMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLLEVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDVNFRFAILVHQFIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALRHGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLDRISIDDNIMDDSMYNTQVDWVELMNFMTEISKNLTFTESQLYLSSLLHHLLLLPLQRENGYLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELKAKQQEVDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDSETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEVDASFIMTPLPPPPPPPPPPPPPLLPPPPPPPPSLNNFLHPHPTLINSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGENLPSNLSESSESEDSTQKLLNELSTFLTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISRLLSGDAFKKHRLFNVMREKKY 1071          
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Match: SMESG000057806.1 (SMESG000057806.1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.505e-15
Identity = 106/456 (23.25%), Postives = 198/456 (43.42%), Query Frame = 2
Query: 1997 LKCFNWSKVPHSKLND-SIWSRIDENSFYNKIDLELLQNEFSTVPVDL--GLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMNQ--RRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICEDVDKLDNLQTAVKDSVNEFHIFLGXXXXXXXXXXXXXXXXTQKLLNEISTFLTDMDVAW-----NSILADREKRAQME-ERKSNAKIFASNSNPVGKK--GDMDNNISRLLSGDA 3325
            +K  NW+K+    L++ S+W  I E                 T+P D+   L+N    K     +   + ++   P  I++ + +QN+++ L   R+ + K K  +LE +       + L   + E LLK  P  E+++ +  A       +L E E F Y+ S     + RL  ++F  K  + +  +  +     +++  I+ S  + ++ E+VL++GN MN   R     GF+   LN L KL  T K   N  +L+HF+     ++     EL K L  +    ++  ++ +  L EI   LK+++N +   K     AEND F +       T+ E +   +  QT + ++      +            + S    ++L N+++ F T+   A        +L +R  +A+++ ER+   K     S    ++  G +DN ++ L SGD 
Sbjct:  630 MKKANWNKINEKILSENSVWLSIKE----------------ETIPTDILKELENNFSTKVVVVKEKTVKTTVVKEP-KILDGKTAQNISILLGSLRMEYEKLKQAILEIDT------SILTQSMIEQLLKNLPETEQMQKI--AELGDVYKDLIECEQFCYQLSNIKKLKPRLESILFQLKFDDKINEVKVQYHEAEAALSEILKSEKVKKILEIVLSLGNYMNSGSRNQQSIGFE---LNFLCKLSST-KDKTNNRSLIHFLAEIINRSAFNPAELGKDLSYIDKANRLALDATASTLTEIKTGLKAIENQLKSFK---GSAENDRFSEKMTPFVTTVKEQIVIAETFQTKMNEAFQSVSTYF---------TFNSSTYKIEELFNDMAKFKTEFIEAHKFNEEKKLLEERALKAKLDKERREKEKQMPVMSKTTSEEDSGVIDNLLAVLKSGDG 1044          
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.254e-14
Identity = 72/340 (21.18%), Postives = 156/340 (45.88%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLE--DAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN-QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTK 2947
            N+ T+S  P    P+     L  FNWS + + +L  +++  +++   Y+K++ E  +N F   PV   + N +     S     R+    T    +++  + + L V LK   +   K  + +L C  ++   +  +  ++A+ +L   PT ++I+     +      I  L + +  +    +    Q++L  +++    PE  + L  ++  +  +  ++ +S  L ++ E++LA GN+MN  RRGI+YGF++ SL+ L   K  +KS      L+ F +   E     + +   ++  V    K+   +I+ D+  +   +K +++ ++     P +
Sbjct:  535 NTQTQSIRP----PIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKT----LLDGSKHRCLGVLLK--FLDQEKLHSDIL-CKSIN---QLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSW----TLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPR 856          
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.179e-14
Identity = 72/340 (21.18%), Postives = 156/340 (45.88%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLE--DAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN-QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTK 2947
            N+ T+S  P    P+     L  FNWS + + +L  +++  +++   Y+K++ E  +N F   PV   + N +     S     R+    T    +++  + + L V LK   +   K  + +L C  ++   +  +  ++A+ +L   PT ++I+     +      I  L + +  +    +    Q++L  +++    PE  + L  ++  +  +  ++ +S  L ++ E++LA GN+MN  RRGI+YGF++ SL+ L   K  +KS      L+ F +   E     + +   ++  V    K+   +I+ D+  +   +K +++ ++     P +
Sbjct:  535 NTQTQSIRP----PIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKT----LLDGSKHRCLGVLLK--FLDQEKLHSDIL-CKSIN---QLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSW----TLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPR 856          
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.515e-14
Identity = 72/340 (21.18%), Postives = 156/340 (45.88%), Query Frame = 2
Query: 1937 NSLTKSNLPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQNEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAVKLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIELLE--DAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLFGELEILHSSIKSIINSPILPRLFELVLAVGNVMN-QRRGIVYGFKVDSLNQLKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNFNSISRDLNEISISLKSLQNTVDLIKKDPTK 2947
            N+ T+S  P    P+     L  FNWS + + +L  +++  +++   Y+K++ E  +N F   PV   + N +     S     R+    T    +++  + + L V LK   +   K  + +L C  ++   +  +  ++A+ +L   PT ++I+     +      I  L + +  +    +    Q++L  +++    PE  + L  ++  +  +  ++ +S  L ++ E++LA GN+MN  RRGI+YGF++ SL+ L   K  +KS      L+ F +   E     + +   ++  V    K+   +I+ D+  +   +K +++ ++     P +
Sbjct:  521 NTQTQSIRP----PIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKT----LLDGSKHRCLGVLLK--FLDQEKLHSDIL-CKSIN---QLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSW----TLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPR 842          
The following BLAST results are available for this feature:
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAAM11.778e-3528.96dishevelled associated activator of morphogenesis ... [more]
DAAM13.517e-3528.85dishevelled associated activator of morphogenesis ... [more]
DAAM21.295e-3227.89dishevelled associated activator of morphogenesis ... [more]
DAAM28.596e-3227.73dishevelled associated activator of morphogenesis ... [more]
DAAM28.596e-3227.73dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam-18.896e-2624.73DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-18.896e-2624.73DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-11.417e-2524.73DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-11.417e-2524.73DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-16.376e-1924.86DAAM (Disheveled-Associated Activator of Morphogen... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAAM1.602e-3328.17gene:FBgn0025641 transcript:FBtr0070241[more]
DAAM2.628e-3328.17gene:FBgn0025641 transcript:FBtr0342731[more]
DAAM2.628e-3328.17gene:FBgn0025641 transcript:FBtr0310282[more]
DAAM2.628e-3328.17gene:FBgn0025641 transcript:FBtr0310283[more]
DAAM2.628e-3328.17gene:FBgn0025641 transcript:FBtr0070239[more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam1a2.250e-3529.39dishevelled associated activator of morphogenesis ... [more]
daam1a2.250e-3529.39dishevelled associated activator of morphogenesis ... [more]
daam1b3.316e-3529.97dishevelled associated activator of morphogenesis ... [more]
daam1b3.316e-3529.97dishevelled associated activator of morphogenesis ... [more]
daam1a3.515e-3529.39dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tatdn16.513e-6126.60TatD DNase domain containing 1 [Source:Xenbase;Acc... [more]
tatdn12.351e-6026.10TatD DNase domain containing 1 [Source:Xenbase;Acc... [more]
tatdn16.197e-5926.27TatD DNase domain containing 1 [Source:Xenbase;Acc... [more]
tatdn17.989e-5825.36TatD DNase domain containing 1 [Source:Xenbase;Acc... [more]
tatdn18.956e-5525.41TatD DNase domain containing 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Daam13.272e-3630.43dishevelled associated activator of morphogenesis ... [more]
Daam13.272e-3630.43dishevelled associated activator of morphogenesis ... [more]
Daam13.674e-3630.21dishevelled associated activator of morphogenesis ... [more]
Daam26.397e-2925.91dishevelled associated activator of morphogenesis ... [more]
Daam22.080e-2124.82dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0DOB5|DAA1A_XENLA6.674e-3630.46Disheveled-associated activator of morphogenesis 1... [more]
sp|Q8BPM0|DAAM1_MOUSE2.289e-3530.43Disheveled-associated activator of morphogenesis 1... [more]
sp|Q9Y4D1|DAAM1_HUMAN8.539e-3528.96Disheveled-associated activator of morphogenesis 1... [more]
sp|A0A1D5P556|DAAM2_CHICK1.749e-3328.95Disheveled-associated activator of morphogenesis 2... [more]
sp|Q86T65|DAAM2_HUMAN4.128e-3127.73Disheveled-associated activator of morphogenesis 2... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8SF984.991e-5824.39Uncharacterized protein OS=Amphiprion percula OX=1... [more]
A0A3Q3MI706.164e-5825.58Uncharacterized protein OS=Mastacembelus armatus O... [more]
A0A5G3KN531.023e-5726.60TatD DNase domain containing 1 OS=Xenopus tropical... [more]
G3SMZ63.364e-5725.06Dishevelled associated activator of morphogenesis ... [more]
A0A5G3KN483.691e-5726.10TatD DNase domain containing 1 OS=Xenopus tropical... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam1b3.958e-3730.46disheveled-associated activator of morphogenesis 1... [more]
daam1b4.551e-3730.64disheveled-associated activator of morphogenesis 1... [more]
daam22.019e-3327.77dishevelled associated activator of morphogenesis ... [more]
daam22.456e-3327.77dishevelled associated activator of morphogenesis ... [more]
daam29.487e-3327.56dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam1a4.442e-3627.23dishevelled associated activator of morphogenesis ... [more]
ENSPMAT00000005288.13.250e-3026.76pep scaffold:Pmarinus_7.0:GL501244:1260:30258:-1 g... [more]
ENSPMAT00000010834.14.381e-2122.65pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1... [more]
ENSPMAT00000000125.18.916e-1721.74pep scaffold:Pmarinus_7.0:GL476709:11284:97599:-1 ... [more]
ENSPMAT00000000679.11.395e-1430.06pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 ge... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328681.240e-3229.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353352.930e-2025.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482584.131e-1425.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273871.692e-1026.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458669.411e-924.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daam1b7.998e-3830.64dishevelled associated activator of morphogenesis ... [more]
daam1b1.872e-3730.92dishevelled associated activator of morphogenesis ... [more]
daam1b1.872e-3730.92dishevelled associated activator of morphogenesis ... [more]
ENSORLT00000010950.27.261e-3330.43disheveled-associated activator of morphogenesis 1... [more]
ENSORLT00000039506.17.261e-3330.43disheveled-associated activator of morphogenesis 1... [more]
back to top
BLAST of Disheveled-associated activator of morphogenesis vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017208.10.000e+099.53SMESG000017208.1[more]
SMESG000057806.15.505e-1523.25SMESG000057806.1[more]
SMESG000040024.18.254e-1421.18SMESG000040024.1[more]
SMESG000040024.19.179e-1421.18SMESG000040024.1[more]
SMESG000040024.19.515e-1421.18SMESG000040024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018494 ID=SMED30018494|Name=Disheveled-associated activator of morphogenesis|organism=Schmidtea mediterranea sexual|type=transcript|length=3443bp
TTGAAATTTGACATTGACATACATTAATAAAATTTTCAATTAATATTAAA
TGTTTCTATTAAATTTAAATTCCTGTTAATTTATGATTTAACCAATTAGA
TATCTTATACTGGCCATTATAACCTTATTATACTCCAGATTGTAGTATTA
GTTTATTATGTCTAATTTACAAAAAACAAGATGGTCAACGAGAGTTTTCA
GAAGAGACTCCAAAGCCAAAAAGAAAGATATTAATAATCCCCAGGTAGAA
TTAATGGAACAAATTGATACATATGACCAATCACAACTTGATGCATTAAT
AAGCGAATTTTCGGATGAGATATTCTTCGATGAAGAATCCAAAGAGAAAT
TATTAAAAATGGACATAAATCAGAAACGTATGCTTGTAAAGTCTCAAAAA
CTCGGAAGATCTGATTTTTGTTTTGAAGAATTGAAAAATATGCTGGAACA
TCTCAACCAGTTGTGTATTAATGGAGGGGATATTGATGATAGCAATCAAT
TTGAAGGGGAAAAACTTTTCGATCAACTGTCTGCTGCCCTAAGAACTGAA
TCACTGAAATATGTGAAGCATTTCATGGATTGTGACGGTTTGCATCTCAT
TTTTACTTACATGCGTGACAAAGGAGTCCATGCGATAAATAGTCAAACAT
TTTCCCAATGTATTCGTTGCATTAGATCTTTGGGAAACAGTGAGAATGGC
TACAGCTATTTACTTGCATTCAATGAAAATAAGGACGAGTCTGAGCTTGG
TTTATTAGAAGTAATTGGAAAAGGGCTGTGGTCAAGAAATGGTTTAACTG
TGTCTATGATTGCTGAATTATTTGGTGCGTTGTGCTTTTCTCACAAAGGT
TGGCTTCGAGTTATGGATGCTTTGAAATATTTATCACGTAACGATGTGAA
CTTTCGATTTGCTATATTGGTTCACCAATTTATATTCCAAGACAATTTAG
ATGTCAAATGCTCTATCTTATCTTTAATTAACGCTTTGGCTGAATTCGTT
CAAGATCACCAGGATCTTCTTATCAATCGAGTACACTTGCGTTACCAGGC
TCTGAGACATGGATTAGGGCATTATGTTAAATGTTATGCGAATTCTTCTC
ACACTGCTTTATGCAAACAGATAGAAGTGTTTGTTCAACATCAACAGGAT
GATATAGAATTCCTACGAACATTAGACCGGATCAGCATTGATGATAATAT
AATGGACGATTCTATGTATAATACTCAAGTAGATTGGGTGGAACTCATGA
ATTTTATGACGGAAATTTCAAAGAATCTTACTTTCACAGAATCACAACTC
TATCTCAGTTCACTATTGCATCATTTGTTATTATTACCTCTTCAACGAGA
AAACGGCTATTTATATTTACAAATGATTGACTTACTTGTTCAGCAAATTT
CCGTACAGCAAGTTAATGGTGCTCAGAATCCCGATCCGGGTTTATCAGAT
TTGCAAATGAATATTGACGACATGTTGCTCAGATTGGCAACTGACAACGA
ACTGAAAACTAAACAGCAAGAAATTGACAGTTTAACCGTTGATTGTACAG
CATTAAATCAAAAGATTCAGGCTTACAAAGATAAATGTCTCAAAATTGAA
TCAGATAAGGTTGCTTTGGAAGAACAATACAAAATCCGTGTTGCTGAAAT
TGATTCTGAAACCAAATTAAATGAGAAGCTCAAACAGGAAAACTTTGCCT
TAGCAAATGAAGTAGCTAAATTGAAAATAGAATCTCAGCAACCATGTTCT
CATGTTAATCATATAGATTCTTTAAAAAAGAGTCATCCTGATCAAGAAGC
TGATGCTTCTTTTATTATGACTCCTCTTCCGCCGCATCCACCGCCTCCGC
CACCTCCGCCGCCACCTTTACTTCCTCCTCCACCTCCACCTCCACCATCT
TTAAACAATTTTCTTCATCCACATCCTACGTTGATCAATTCATTGACAAA
ATCTAATTTACCAACAAAAAATGTCCCAGTGATAAATTCAATTCTTTTGA
AATGTTTCAATTGGTCGAAAGTTCCTCATTCAAAGCTCAATGATTCCATT
TGGAGTCGAATCGATGAAAATTCTTTCTATAATAAAATTGACCTAGAACT
ACTTCAAAATGAGTTCTCGACAGTTCCAGTTGATTTAGGTTTAAAAAATC
CGATTCCCCTCAAACCACATTCGTCTCCACAAGTTAACCGTCGATTATCT
CTGGCAACAATTCCAGTAAACATTATCAATATTCAGCGCAGCCAAAATCT
CGCGGTAAAATTAAAACAAGCCAGAATATCTTGGTCGAAATGGAAAACTC
AATTGTTGGAGTGTAATGTAGTCTCAAGTGATGGGGAAAACTTCTTGCAT
TATCAATTGGCAGAAGGTCTATTAAAACTTTATCCAACTCCAGAAGAAAT
TGAACTTCTTGAAGATGCAGTTTCAAATCATGGCATCGGAAATTTACCAG
AAGCAGAATCATTTATGTATGAATGTTCGAGATTTCCTCTCTATCAGGAG
CGACTTTCATGCTTGATATTTTTCTGTAAAATTCCAGAACATGTTAGACG
TCTATTTGGAGAATTAGAAATTCTTCATTCTTCAATCAAATCTATTATCA
ACAGTCCAATTCTTCCTAGGCTGTTTGAACTCGTCCTAGCAGTGGGAAAC
GTAATGAACCAGAGGCGCGGTATTGTGTATGGATTCAAAGTTGACAGTTT
AAATCAGTTGAAAAAACTCAAATGTACAAATAAGAGCATTTTGAATATTA
GTAACCTTCTGCACTTTGTTTTGATAACTGCAGAGAAAACGATTCCAGAA
ATTTTCGAATTGCCGAAAAAACTTGAAAATGTTCATGCAACTCGTAAAGT
TAACTTCAATAGCATCTCCAGAGATTTGAATGAAATTTCAATCAGTTTAA
AGAGTCTTCAAAATACTGTTGATTTAATCAAAAAAGATCCAACAAAGGCT
GAAAATGATAATTTCCTAAAGGTCTTTGACAAGTTGTATCCAACTATTTG
TGAAGATGTTGATAAACTAGATAATTTGCAAACAGCTGTTAAAGACTCTG
TTAATGAATTTCATATTTTTCTTGGTGAAAATCTTCCGTCAAATTTATCA
GAAAGTTCTGAAAGTGAGGATAGTACTCAGAAATTACTGAATGAAATTTC
AACATTTTTGACGGACATGGACGTTGCTTGGAACTCGATTCTCGCCGATC
GAGAGAAACGAGCTCAAATGGAGGAAAGAAAAAGCAATGCAAAAATCTTT
GCTTCTAATTCTAATCCTGTTGGCAAAAAAGGAGACATGGATAATAATAT
CTCTCGGCTCTTGTCCGGGGATGCGTTCAAAAAACATCGGCTATTCAATG
TAATGCGAGAAAAGAAGTACTGACACCAATTCGTAATAGTTATCATCATA
ATCCCAGTGATTTATTTGTAATAATAATAATAATAATTATTAT
back to top

protein sequence of SMED30018494-orf-1

>SMED30018494-orf-1 ID=SMED30018494-orf-1|Name=SMED30018494-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1072bp
MSNLQKTRWSTRVFRRDSKAKKKDINNPQVELMEQIDTYDQSQLDALISE
FSDEIFFDEESKEKLLKMDINQKRMLVKSQKLGRSDFCFEELKNMLEHLN
QLCINGGDIDDSNQFEGEKLFDQLSAALRTESLKYVKHFMDCDGLHLIFT
YMRDKGVHAINSQTFSQCIRCIRSLGNSENGYSYLLAFNENKDESELGLL
EVIGKGLWSRNGLTVSMIAELFGALCFSHKGWLRVMDALKYLSRNDVNFR
FAILVHQFIFQDNLDVKCSILSLINALAEFVQDHQDLLINRVHLRYQALR
HGLGHYVKCYANSSHTALCKQIEVFVQHQQDDIEFLRTLDRISIDDNIMD
DSMYNTQVDWVELMNFMTEISKNLTFTESQLYLSSLLHHLLLLPLQRENG
YLYLQMIDLLVQQISVQQVNGAQNPDPGLSDLQMNIDDMLLRLATDNELK
TKQQEIDSLTVDCTALNQKIQAYKDKCLKIESDKVALEEQYKIRVAEIDS
ETKLNEKLKQENFALANEVAKLKIESQQPCSHVNHIDSLKKSHPDQEADA
SFIMTPLPPHPPPPPPPPPPLLPPPPPPPPSLNNFLHPHPTLINSLTKSN
LPTKNVPVINSILLKCFNWSKVPHSKLNDSIWSRIDENSFYNKIDLELLQ
NEFSTVPVDLGLKNPIPLKPHSSPQVNRRLSLATIPVNIINIQRSQNLAV
KLKQARISWSKWKTQLLECNVVSSDGENFLHYQLAEGLLKLYPTPEEIEL
LEDAVSNHGIGNLPEAESFMYECSRFPLYQERLSCLIFFCKIPEHVRRLF
GELEILHSSIKSIINSPILPRLFELVLAVGNVMNQRRGIVYGFKVDSLNQ
LKKLKCTNKSILNISNLLHFVLITAEKTIPEIFELPKKLENVHATRKVNF
NSISRDLNEISISLKSLQNTVDLIKKDPTKAENDNFLKVFDKLYPTICED
VDKLDNLQTAVKDSVNEFHIFLGENLPSNLSESSESEDSTQKLLNEISTF
LTDMDVAWNSILADREKRAQMEERKSNAKIFASNSNPVGKKGDMDNNISR
LLSGDAFKKHRLFNVMREKKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042201FH2_Formin_sf
IPR011989ARM-like
IPR010472FH3_dom
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
IPR015425FH2_Formin
IPR010473GTPase-bd
Vocabulary: molecular function
TermDefinition
GO:0017048Rho GTPase binding
GO:0003779actin binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
GO:0016043cellular component organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 449..490
NoneNo IPR availableCOILSCoilCoilcoord: 505..525
NoneNo IPR availableGENE3DG3DSA:1.10.238.150coord: 359..458
e-value: 7.1E-9
score: 37.5
NoneNo IPR availablePANTHERPTHR45725:SF7DISHEVELED-ASSOCIATED ACTIVATOR OF MORPHOGENESIS 2coord: 59..1067
NoneNo IPR availablePANTHERPTHR45725FAMILY NOT NAMEDcoord: 59..1067
NoneNo IPR availableSUPERFAMILYSSF101447Formin homology 2 domain (FH2 domain)coord: 568..1024
IPR010473Formin, GTPase-binding domainSMARTSM01140Drf_GBD_2coord: 36..227
e-value: 5.3E-11
score: 52.5
IPR010473Formin, GTPase-binding domainPFAMPF06371Drf_GBDcoord: 40..227
e-value: 1.6E-13
score: 50.6
IPR015425Formin, FH2 domainSMARTSM00498it6_sourcecoord: 604..1059
e-value: 2.2E-18
score: 77.0
IPR015425Formin, FH2 domainPFAMPF02181FH2coord: 614..975
e-value: 1.7E-54
score: 185.4
IPR015425Formin, FH2 domainPROSITEPS51444FH2coord: 604..1030
score: 44.568
IPR010472Formin, FH3 domainSMARTSM01139Drf_FH3_2coord: 230..435
e-value: 3.2E-10
score: 50.0
IPR010472Formin, FH3 domainPFAMPF06367Drf_FH3coord: 231..422
e-value: 2.6E-19
score: 69.6
IPR042201Formin, FH2 domain superfamilyGENE3DG3DSA:1.20.58.2220coord: 622..1036
e-value: 1.2E-67
score: 230.5
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 109..337
e-value: 4.7E-31
score: 109.9
IPR014768Rho GTPase-binding/formin homology 3 (GBD/FH3) domainPROSITEPS51232GBD_FH3coord: 36..422
score: 14.42
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 45..417