Ras and EF-hand domain-containing protein

Overview
NameRas and EF-hand domain-containing protein
Smed IDSMED30018493
Length (bp)1995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras and EF-hand domain-containing protein (SMED30018493) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras and EF-hand domain-containing protein (SMED30018493) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras and EF-hand domain-containing protein (SMED30018493) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras and EF-hand domain-containing protein (SMED30018493) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018493

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30018493SMESG000028852.1 dd_Smed_v4_12567_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RASEF (RAS and EF-hand domain containing [Source:HGNC Symbol;Acc:HGNC:26464])

HSP 1 Score: 189.119 bits (479), Expect = 1.482e-50
Identity = 92/201 (45.77%), Postives = 131/201 (65.17%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSK-----IHLNEQDIKTAKKCC 1962
            ++ +KI+LAGD++VGK+SF+++ CKN F   + +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLN+R W+D+I  +  +E  PIML+ NK D R++ +TE  KCV    GE LA  Y  +F E S K+  NI  A++ L+R +K R D + S+        N +     K CC
Sbjct:  539 QKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDA-AHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCC 738          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: CRACR2A (calcium release activated channel regulator 2A [Source:HGNC Symbol;Acc:HGNC:28657])

HSP 1 Score: 167.933 bits (424), Expect = 2.763e-43
Identity = 79/176 (44.89%), Postives = 120/176 (68.18%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED 1902
            P+R+FKI+  G+S+VGKTSF+ +FC++ F+P + +TVGIDY  KTL VD   +ALQLWDTAGQE++R I   +FR+ADG+++MYD+ +  SFL+VR W+  + ++ + +  P++LL NK+D    N  E + V +  GE LA   +L+F E S     N   +++ L+R LK +ED
Sbjct:  542 PDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEA-VGDRVPVLLLGNKLD----NEKERE-VPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQED 711          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RAB8A (RAB8A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:7007])

HSP 1 Score: 144.05 bits (362), Expect = 6.304e-39
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N+R WI  I +   +D+ +    M+L NK D       + + V K+ GE LA +Y + F E S K  IN+  A   L+R +KA+ D +L
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEK----MILGNKCDV-----NDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL 177          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RAB37 (RAB37, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30268])

HSP 1 Score: 142.51 bits (358), Expect = 2.884e-38
Identity = 76/203 (37.44%), Postives = 117/203 (57.64%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNP-ILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTP----IMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKK----CCS 1965
            + K IL GDS VGKTS ++QF +  F P    +TVGI +  K + VDG  + LQ+WDTAGQE+FRS+   Y+R A  +L++YD+ N SSF N+R W+     ++I+E+      IMLL NK D      +  + ++ ++GE LA+ Y + F E S K  +N+  A + +++ LK R   +  +     +D   ++K    CCS
Sbjct:   22 LHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWL-----TEIHEYAQRDVVIMLLGNKADM-----SSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCS 214          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RAB26 (RAB26, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:14259])

HSP 1 Score: 143.665 bits (361), Expect = 4.297e-38
Identity = 74/175 (42.29%), Postives = 108/175 (61.71%), Query Frame = 1
Query: 1387 FKIILAGDSSVGKTSFMLQFCKNIF-NPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFT----PIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            FK++L GDS VGKT  +++F    F      STVGID+  K L VDG  + LQ+WDTAGQE+FRS+   Y+R A  +L++YDV N +SF N++ W+     ++I+E+      +MLL NK+D     S   + VK+++GE LAK Y L F E S K  +N++ A   +++ LK R
Sbjct:   64 FKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWL-----TEIHEYAQHDVALMLLGNKVD-----SAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQR 228          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rsef-1 (Ras and EF-hand domain-containing protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22908])

HSP 1 Score: 169.859 bits (429), Expect = 1.081e-44
Identity = 82/178 (46.07%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            ER F+I++ GD++VGK+SF+++  +  F   LPST+G+D++ KT+ VDGR +ALQLWDTAGQE+FRS+  +YFRRADG +++YDV    SFL VR WI+ I++S      PI+L+ NK+D R S       V K +G  +A    ++F E S  +  NI+ A++ L+R L A ED+E+
Sbjct:  459 ERTFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRSLCKSYFRRADGAILVYDVCAEQSFLRVRDWIETIKES-TERSIPIILVGNKVDMRISTPG---SVAKTDGASMAAAMGVLFMETSALDGSNIDNAMLALTRELMAVEDVEI 632          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17482329:-1 gene:WBGene00007067.1 transcript:4R79.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 158.303 bits (399), Expect = 3.906e-43
Identity = 81/201 (40.30%), Postives = 125/201 (62.19%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDG-RLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELS---KIHLNEQDIKTAKKCC 1962
            +P+R+FK++  GDS+VGKT F+ +FC N F P+  +T+G+D+  KT+ +   R IA+QLWDTAGQE+FRSI   YFR+ADG+++M+DV +  SFLNVR WID +R + +++ T + L+ NK+D   S+       +    E LA  + + F E S      I+T + +++  L+ RED  L    K+ +N  + K    CC
Sbjct:  114 QPDRIFKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVR-AGVDDATVMCLVGNKMDLFGSDIARSAVYRA--AEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDIN-SNYKKRSWCC 310          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17483332:-1 gene:WBGene00007067.1 transcript:4R79.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 158.688 bits (400), Expect = 1.900e-42
Identity = 81/201 (40.30%), Postives = 126/201 (62.69%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDG-RLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELS---KIHLNEQDIKTAKKCC 1962
            +P+R+FK++  GDS+VGKT F+ +FC N F P+  +T+G+D+  KT+ +   R IA+QLWDTAGQE+FRSI   YFR+ADG+++M+DV +  SFLNVR WID +R + +++ T + L+ NK+D   S+    +    +  E LA  + + F E S      I+T + +++  L+ RED  L    K+ +N  + K    CC
Sbjct:  198 QPDRIFKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVR-AGVDDATVMCLVGNKMDLFGSDIA--RSAVYRAAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDIN-SNYKKRSWCC 394          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 133.65 bits (335), Expect = 1.511e-35
Identity = 71/174 (40.80%), Postives = 106/174 (60.92%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            +FK++L GDS VGKT  + +F  + FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +   SD+      M++ NK D       E + V +  GE LA  Y   F E S K  +NI+ A   L+R +K++
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVER----MIIGNKCDIE-----ERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 133.65 bits (335), Expect = 1.511e-35
Identity = 71/174 (40.80%), Postives = 106/174 (60.92%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            +FK++L GDS VGKT  + +F  + FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +   SD+      M++ NK D       E + V +  GE LA  Y   F E S K  +NI+ A   L+R +K++
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVER----MIIGNKCDIE-----ERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 134.806 bits (338), Expect = 7.131e-36
Identity = 70/176 (39.77%), Postives = 109/176 (61.93%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED 1902
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +D + I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+    SF N++ WI  I +   +D+ +    MLL NK +      T+ + V K+ GE LA  Y + F E S K  IN+  A + L+  +KA+ +
Sbjct:    8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEK----MLLGNKCEL-----TDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 134.806 bits (338), Expect = 7.131e-36
Identity = 70/176 (39.77%), Postives = 109/176 (61.93%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED 1902
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +D + I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+    SF N++ WI  I +   +D+ +    MLL NK +      T+ + V K+ GE LA  Y + F E S K  IN+  A + L+  +KA+ +
Sbjct:    8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEK----MLLGNKCEL-----TDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab26 (gene:FBgn0086913 transcript:FBtr0331794)

HSP 1 Score: 139.813 bits (351), Expect = 1.342e-35
Identity = 69/172 (40.12%), Postives = 108/172 (62.79%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNP-ILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            M K+I+ GDS VGKTS +++F    + P    STVGID+  K + VDG  + LQ+WDTAGQE+FRS+   Y+R A  +L++YDV N +++ N+R W+  IR+    E   I+L+ NK D   S     + VK+++GE L + +++ F E S K  +N+  +   ++R+LK+R
Sbjct:  212 MGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREY-AQEDVVIVLIGNKADCSGSE----RQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab26 (gene:FBgn0086913 transcript:FBtr0112678)

HSP 1 Score: 139.813 bits (351), Expect = 1.342e-35
Identity = 69/172 (40.12%), Postives = 108/172 (62.79%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNP-ILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            M K+I+ GDS VGKTS +++F    + P    STVGID+  K + VDG  + LQ+WDTAGQE+FRS+   Y+R A  +L++YDV N +++ N+R W+  IR+    E   I+L+ NK D   S     + VK+++GE L + +++ F E S K  +N+  +   ++R+LK+R
Sbjct:  212 MGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREY-AQEDVVIVLIGNKADCSGSE----RQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab26 (gene:FBgn0086913 transcript:FBtr0301529)

HSP 1 Score: 139.813 bits (351), Expect = 1.342e-35
Identity = 69/172 (40.12%), Postives = 108/172 (62.79%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNP-ILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            M K+I+ GDS VGKTS +++F    + P    STVGID+  K + VDG  + LQ+WDTAGQE+FRS+   Y+R A  +L++YDV N +++ N+R W+  IR+    E   I+L+ NK D   S     + VK+++GE L + +++ F E S K  +N+  +   ++R+LK+R
Sbjct:  212 MGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREY-AQEDVVIVLIGNKADCSGSE----RQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: rasef (RAS and EF-hand domain containing [Source:ZFIN;Acc:ZDB-GENE-081105-157])

HSP 1 Score: 177.178 bits (448), Expect = 1.047e-46
Identity = 88/201 (43.78%), Postives = 125/201 (62.19%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEH-KCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKA-----REDLELSKIHLNEQDIKTAKKCC 1962
            E+ ++I+LAGD++VGK+SF+L+ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR W+DII     ++  PIML+ NK D R     +   C+    GE LA  Y  +F E S K+  NI  A++ L+R +       +E + ++K+  N     ++  CC
Sbjct:  505 EKAYRIVLAGDAAVGKSSFLLRLCKNEFKGNTSATLGVDFQMKTLVVDGVPTVLQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWVDIIEDVSQDDI-PIMLVGNKTDLRKEALQDGVTCIPTSYGEKLAMTYSALFCETSAKDGSNIIEAVLHLAREVTKHADDYKEPVSVAKLSGNHTKKMSSPNCC 704          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 170.244 bits (430), Expect = 1.092e-45
Identity = 84/197 (42.64%), Postives = 130/197 (65.99%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED-LELSKIHLNEQDIKTAKKCC 1962
            P+R+FK+IL G+SSVGKT+ + +FC   F+    +TVGIDY+ +TL +    +ALQLWDTAGQE++RSI   +FR+ADG++++YD+    SF +VR W+  I+++ + +  P+MLL NK D  N      + V+ KE +LLA+  +LMF E S     N+  A+I L+R L+ +ED + ++ + L +Q +K  K CC
Sbjct:  281 PQRLFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRSITKQFFRKADGVVVIYDITMEDSFSSVRPWLSSIQEA-VGDPIPVMLLGNKSDKEN-----EREVQTKEADLLAEEANLMFYECSAYTGANVLEAMIHLARVLREQEDRVWVNTVRLGDQPLK-KKTCC 470          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 170.244 bits (430), Expect = 4.211e-44
Identity = 84/197 (42.64%), Postives = 129/197 (65.48%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED-LELSKIHLNEQDIKTAKKCC 1962
            P+R+FK+IL G+SSVGKT+ + +FC   F+    +TVGIDY+ +TL +    +ALQLWDTAGQE++RSI   +FR+ADG++++YD+    SF +VR W+  I+++ + +  P+MLL NK D  N        V+ KE +LLA+  +LMF E S     N+  A+I L+R L+ +ED + ++ + L +Q +K  K CC
Sbjct:  583 PQRLFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRSITKQFFRKADGVVVIYDITMEDSFSSVRPWLSSIQEA-VGDPIPVMLLGNKSDKENERE-----VQTKEADLLAEEANLMFYECSAYTGANVLEAMIHLARVLREQEDRVWVNTVRLGDQPLK-KKTCC 772          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01062083.1 (calcium release activated channel regulator 2Aa [Source:NCBI gene;Acc:100330395])

HSP 1 Score: 167.548 bits (423), Expect = 2.130e-43
Identity = 85/196 (43.37%), Postives = 125/196 (63.78%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCC 1962
            P+R+FK++L G+SSVGKTS + +FC + F+    +TVGIDY+ KTL VD   IALQ+WDTAGQE++RSI   +FR+ADG++++YD+ N  +F  VR W+  +++    E  PIMLL NK D  +      + +    GE LAK++ LMF E S     N+  ++I ++R LK +ED E  K  ++  D  + KK C
Sbjct:  529 PDRLFKVVLVGNSSVGKTSLLRRFCDDCFHSGTCATVGIDYSVKTLSVDNSQIALQMWDTAGQERYRSITKQFFRKADGVVVVYDITNEQTFTAVRQWLASVQEG-AGEDIPIMLLGNKTDLDS-----QRVIPLGLGEKLAKDFQLMFYECSAFSNHNVTDSMIHMARILKEQEDREKEKT-VSLVDSPSKKKSC 717          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162879 (zgc:162879 [Source:NCBI gene;Acc:572256])

HSP 1 Score: 166.777 bits (421), Expect = 2.950e-43
Identity = 81/203 (39.90%), Postives = 126/203 (62.07%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI*FKLHSR 1992
            +++++LAGD+  GK+SF+L+   N F   + +T+G+D+  K + VDG    LQ+WDTAGQE+FRSI  +YFR+A G+L++YDV + SSFLNVR W++ IR+S  +E  P+ ++ NK+D R +   E  CV    GE LA NY+ +F E S KE  N+  A++ L+R +K              + +K  ++  S++   LH R
Sbjct:  467 VYRLVLAGDAGSGKSSFLLRLSLNEFRGDIQTTLGVDFQIKKMLVDGEKTNLQIWDTAGQERFRSIARSYFRKAHGVLLLYDVTSESSFLNVREWVEQIRES-TDEDIPMCIIGNKVDLRAAR-PEGSCVSSIHGEKLAMNYNALFCEASAKEGTNVIEAVLHLAREVK--------------KHVKLGRRSESQVKLSLHKR 653          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 182.57 bits (462), Expect = 1.125e-49
Identity = 88/178 (49.44%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE 1908
            E+ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WID+I  +  +E  PIM++ NK D R   + + H CV    GE L++ Y  +F E S KE  NI  A++ L+R ++ R D E
Sbjct:  305 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDA-TSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCDNE 481          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 182.57 bits (462), Expect = 2.011e-48
Identity = 88/178 (49.44%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE 1908
            E+ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WID+I  +  +E  PIM++ NK D R   + + H CV    GE L++ Y  +F E S KE  NI  A++ L+R ++ R D E
Sbjct:  496 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDA-TSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCDNE 672          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 182.57 bits (462), Expect = 2.436e-48
Identity = 88/178 (49.44%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE 1908
            E+ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WID+I  +  +E  PIM++ NK D R   + + H CV    GE L++ Y  +F E S KE  NI  A++ L+R ++ R D E
Sbjct:  520 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDA-TSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCDNE 696          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 179.489 bits (454), Expect = 1.669e-47
Identity = 85/169 (50.30%), Postives = 116/169 (68.64%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSR 1881
            E+ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WID+I  +  +E  PIM++ NK D R   + + H CV    GE L++ Y  +F E S KE  NI  A++ L+R
Sbjct:  495 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDA-TSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAR 662          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: erich3 (glutamate rich 3 [Source:Xenbase;Acc:XB-GENE-5880720])

HSP 1 Score: 168.318 bits (425), Expect = 8.679e-44
Identity = 81/175 (46.29%), Postives = 116/175 (66.29%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE 1908
            +++++LAGD+  GK+SF+L+ C N F   +P+T+G+D+  K L VDG    LQ+WDTAGQE+FRSI  +YFR+A G+L+MYDV +  SFLNVR WID I+ S  ++  P+ML+ NK D R    TE   ++   GE LA  Y  +F E S K+  N+  A++ L+R +K   DLE
Sbjct:  439 IYRLVLAGDAGSGKSSFLLRLCLNEFRGDIPTTLGVDFQIKKLLVDGDHTTLQIWDTAGQERFRSIAKSYFRKAHGVLLMYDVTSERSFLNVRQWIDEIKNSS-DKPIPMMLIGNKTDIR----TELDGIQTSMGEKLAMAYSSLFCETSAKDGTNVVEAVLHLAREVKKCTDLE 608          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rasef (RAS and EF hand domain containing [Source:MGI Symbol;Acc:MGI:2448565])

HSP 1 Score: 182.185 bits (461), Expect = 2.265e-49
Identity = 83/178 (46.63%), Postives = 120/178 (67.42%), Query Frame = 1
Query: 1366 KMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            K+  ++ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLNVR W+D++     +   PIML+ NK D R+ ++ E  KC+    GE LA  Y  +F E S K+  N+  A++ L+R +K R
Sbjct:  350 KVTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLIVDGEQTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVDMVEDG-THRTIPIMLVGNKADLRDVDNAENQKCISAYLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKR 526          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rasef (RAS and EF hand domain containing [Source:MGI Symbol;Acc:MGI:2448565])

HSP 1 Score: 181.8 bits (460), Expect = 1.078e-48
Identity = 83/178 (46.63%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1366 KMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            K+  ++ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLNVR W+D++ +   +   PIML+ NK D R+ ++ E  KC+    GE LA  Y  +F E S K+  N+  A++ L+R +K R
Sbjct:  422 KVTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLIVDGEQTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVDMV-EDGTHRTIPIMLVGNKADLRDVDNAENQKCISAYLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKR 598          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rasef (RAS and EF hand domain containing [Source:MGI Symbol;Acc:MGI:2448565])

HSP 1 Score: 181.415 bits (459), Expect = 3.882e-48
Identity = 83/178 (46.63%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1366 KMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            K+  ++ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLNVR W+D++ +   +   PIML+ NK D R+ ++ E  KC+    GE LA  Y  +F E S K+  N+  A++ L+R +K R
Sbjct:  503 KVTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLIVDGEQTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVDMV-EDGTHRTIPIMLVGNKADLRDVDNAENQKCISAYLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKR 679          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Cracr2a (calcium release activated channel regulator 2A [Source:MGI Symbol;Acc:MGI:2685919])

HSP 1 Score: 165.622 bits (418), Expect = 1.061e-42
Identity = 79/182 (43.41%), Postives = 119/182 (65.38%), Query Frame = 1
Query: 1357 EIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED 1902
            E +   P+R+FKI+  GDS+VGKTSF+ + C+  F+P + +TVGIDY  KT+ VD   +ALQLWDTAGQE++R I   +FR+ADG+ +MYD+    SFL++R W+  + ++ + +  P++LL NK+D    N  E + V +  GE LAK  +L+F E S     N   +++ L+R LK +ED
Sbjct:  531 ERVPSTPDRLFKIVFVGDSAVGKTSFLRRLCEARFSPGMAATVGIDYRVKTVTVDNAQVALQLWDTAGQERYRCISQQFFRKADGVAVMYDLTAKQSFLSIRQWLSSVEEA-VGDRIPVLLLGNKLD----NEKERE-VPRGLGEQLAKENNLIFYECSACSGHNAQESLLHLARLLKEQED 706          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rab8a (RAB8A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:96960])

HSP 1 Score: 144.436 bits (363), Expect = 4.243e-39
Identity = 75/179 (41.90%), Postives = 113/179 (63.13%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N+R WI  I +   +D+ +    M+L NK D       + + V K+ GE LA +Y + F E S K  IN+  A   L+R +KA+ D +L
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEK----MILGNKCDV-----NDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKL 177          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IZ41|RASEF_HUMAN (Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 7.116e-50
Identity = 92/201 (45.77%), Postives = 131/201 (65.17%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSK-----IHLNEQDIKTAKKCC 1962
            ++ +KI+LAGD++VGK+SF+++ CKN F   + +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLN+R W+D+I  +  +E  PIML+ NK D R++ +TE  KCV    GE LA  Y  +F E S K+  NI  A++ L+R +K R D + S+        N +     K CC
Sbjct:  539 QKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDA-AHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCC 738          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RI75|RASEF_MOUSE (Ras and EF-hand domain-containing protein homolog OS=Mus musculus OX=10090 GN=Rasef PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 7.542e-48
Identity = 83/178 (46.63%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1366 KMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            K+  ++ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFR+ADG+L++YDV    SFLNVR W+D++ +   +   PIML+ NK D R+ ++ E  KC+    GE LA  Y  +F E S K+  N+  A++ L+R +K R
Sbjct:  422 KVTSQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLIVDGEQTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVDMV-EDGTHRTIPIMLVGNKADLRDVDNAENQKCISAYLGEKLAMTYGALFCETSAKDGSNVVEAVLHLAREVKKR 598          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q08CX1|RASEF_XENTR (Ras and EF-hand domain-containing protein OS=Xenopus tropicalis OX=8364 GN=rasef PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.291e-47
Identity = 88/178 (49.44%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE 1908
            E+ +KI+LAGD++VGK+SF+++ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WID+I  +  +E  PIM++ NK D R   + + H CV    GE L++ Y  +F E S KE  NI  A++ L+R ++ R D E
Sbjct:  520 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDA-TSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCDNE 696          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q22908|RASEF_CAEEL (Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans OX=6239 GN=rsef-1 PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.375e-43
Identity = 82/178 (46.07%), Postives = 121/178 (67.98%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            ER F+I++ GD++VGK+SF+++  +  F   LPST+G+D++ KT+ VDGR +ALQLWDTAGQE+FRS+  +YFRRADG +++YDV    SFL VR WI+ I++S      PI+L+ NK+D R S       V K +G  +A    ++F E S  +  NI+ A++ L+R L A ED+E+
Sbjct:  459 ERTFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRSLCKSYFRRADGAILVYDVCAEQSFLRVRDWIETIKES-TERSIPIILVGNKVDMRISTPG---SVAKTDGASMAAAMGVLFMETSALDGSNIDNAMLALTRELMAVEDVEI 632          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q619T5|RASEF_CAEBR (Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae OX=6238 GN=rsef-1 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.491e-43
Identity = 84/195 (43.08%), Postives = 124/195 (63.59%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCC 1962
            ER F+I++ GD++VGK+SF+++  +  F   LPST+G+D++ KT+ VDGR +ALQLWDTAGQE+FRS+  +YFRRADG +++YDV    SFL VR WI+ I++S      PI+L+ NK+D R         V K +G  +A    ++F E S  +  NI+ A++ L+R L A ED+E+    +      T K  C
Sbjct:  437 ERTFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRSLCKSYFRRADGAILVYDVCAEHSFLRVRDWIETIKES-TERSIPIILVGNKVDMRLQTPG---AVAKTDGASMAAAMGVLFMETSALDGSNIDNAMLALTRELMAVEDVEIRSTGVVLNPAATKKGGC 627          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: T1FYQ5 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20213953 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 7.613e-55
Identity = 94/168 (55.95%), Postives = 124/168 (73.81%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSR 1881
            +R+FKI+LAGD++VGK+SF+++ CKN F   L STVG+D+ TKTL VDG++IALQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR WI+II K    ++ P+M++ NK D R     +  C+K ++G  LA N D +F E S K   NIN AIIEL+R
Sbjct:    1 DRVFKIVLAGDAAVGKSSFIMRLCKNKFVTNLNSTVGVDFQTKTLKVDGKIIALQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTYEKSFLNVRDWIEII-KDGTQKYIPVMIVGNKCDLREDRRIKDVCLKYEDGHNLASNVDCLFVETSAKSGSNINEAIIELTR 167          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: A0A0L8G9T1 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22037299mg PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.517e-53
Identity = 127/333 (38.14%), Postives = 193/333 (57.96%), Query Frame = 1
Query: 1021 EQAEMLEAEDSGLSTQIEFGD--TDNEYLSIN----KIRRIHSFISNQNKMNNL-------SNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVXXXXXXXXEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNS-NSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKI-----HLNEQDIKTAKKCC 1962
            E+  + E  DSG ST  + GD  T++EY S      K RR   F   Q+  + +       ++  D+D  ++  H   R   ++ S+  N++ R      +S+ L   N+ +         L++ + +K EPERM+K++LAGD++VGKTSF+++ CK  F   L ST+G+D+ TKTL VDG  IALQLWDTAGQE+FRSI  +YFRRADG+L++YD     SF+NVR W+  I ++   +  PIML ANK D R    + + + VK ++G+ LA+ ++ +F E S K+  NIN A++EL+R L+  EDLE+  +      +  +  K    CC
Sbjct:  117 EEDSIAEDVDSGHSTIRDAGDMDTESEYTSTGDDFLKGRRHKRFRPEQDSHDEIETETEVPTDDQDADLFKATAH---RCPASVGSRGSNRSLRDSGNDLNSNQLP--NRISRRGPSIQQELANQKAMK-EPERMYKVVLAGDAAVGKTSFIMRLCKGKFVTNLSSTLGVDFQTKTLCVDGHTIALQLWDTAGQERFRSIAKSYFRRADGVLLLYDCTYERSFINVRDWLQTI-ENGAQKRLPIMLCANKTDLRAEMEAHDRRTVKFEDGQRLARTFEGLFIETSAKDGNNINEAVLELTRLLRTNEDLEVRSVGMRLFEMRNEPTKKPGICC 442          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: R7TMM0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_160577 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.365e-53
Identity = 97/203 (47.78%), Postives = 134/203 (66.01%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFT----PIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDI-KTAKK---CCS 1965
            M+KI+LAGD++VGK+SF+++ CKN F   L ST+G+D+ TK + VDGR+IALQLWDTAGQE+FRSI  +YFRRADG+L++YD     SF+N+R W++ +      E T    P+M+  NK D R     E  +CV+  EG  LA+ YD +F E S KE   I  A+ EL+R L+  EDLE+  + +  QD  K ++K   CCS
Sbjct:    1 MYKIVLAGDAAVGKSSFIMRLCKNKFVNNLNSTLGVDFQTKVIEVDGRVIALQLWDTAGQERFRSIAKSYFRRADGVLLLYDCSYERSFINLRDWVEAVEPYTFKEGTASKIPLMIAGNKTDLRREFEAEGRRCVRTDEGHRLAREYDALFIETSAKEGDYILEAVTELARLLRTTEDLEVRNVGMQLQDYGKESRKSVSCCS 203          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: W4Y466 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.950e-53
Identity = 102/202 (50.50%), Postives = 144/202 (71.29%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEH-KCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSK--IHLNEQDIKTAKK---CC 1962
            PERM+KI+LAGD++VGK+SF+++ CK IF+  L ST+G+D+  KT+ VD R+ +LQLWDTAGQE+FRSI  +YFRRADG+L++YD     SF+NVR WI+ I +S  ++  P+M+ ANK+DAR     E  +CV+ ++G+ LA +++ +F E S KE  N+  A+IEL+R+L  REDLE+S   I LN  D    KK   CC
Sbjct:  716 PERMYKIVLAGDAAVGKSSFIMRLCKGIFHSNLNSTLGVDFQMKTIDVDDRVTSLQLWDTAGQERFRSIAKSYFRRADGVLLLYDCTCERSFINVRDWIEAIEESS-HKPVPVMICANKLDARPLAIAEGVRCVRTEDGQRLATSFNALFIETSAKEGSNVEDAVIELTRQLHKREDLEVSSSGITLNT-DTPAKKKETGCC 915          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: K1Q866 (RAS and EF-hand domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10009132 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.265e-51
Identity = 100/204 (49.02%), Postives = 139/204 (68.14%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL--SKIHLNEQDIKTAKK--CCSK 1968
            +PERM+KI+LAGD++VGK+SF+++ CK  F P L ST+G+D+ TK L VDGR IALQLWDTAGQE+FRSI  +YFRRADG+L++YD     SF++VR W+D I +    +  PIML  NK D R     +  K V  +EG+ LA+ ++ +F E S KE  NI  A+ ELSR L + EDLE+  S + L++ +   +K+  CC +
Sbjct:  522 DPERMYKIVLAGDAAVGKSSFIMRLCKGKFVPNLSSTLGVDFQTKVLEVDGRTIALQLWDTAGQERFRSIAKSYFRRADGVLLLYDCSYERSFMSVREWVDSIEEG-AQKKVPIMLCGNKSDLREEAEKQGRKVVNFEEGQRLAREFEGLFIETSAKEGSNIVDAVTELSRLLASNEDLEVEASGLQLHDPNYDPSKRINCCGR 724          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: rasef (RAS and EF-hand domain containing [Source:NCBI gene;Acc:103039240])

HSP 1 Score: 177.563 bits (449), Expect = 7.895e-47
Identity = 90/201 (44.78%), Postives = 125/201 (62.19%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEH-KCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRL-----KAREDLELSKIHLNEQDIKTAKKCC 1962
            ++ +KI+LAGD++VGK+SF+L+ CKN F     +T+G+D+  KTL VDG    LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLNVR W+DII     ++  PIML+ NK D R     E   C+    GE LA  Y  +F E S KE  NI  A++ L+R +     + +E   ++K+  +     T+  CC
Sbjct:  523 DKTYKIVLAGDAAVGKSSFLLRLCKNEFKGTTSATLGVDFQMKTLVVDGVPTVLQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWVDIIEDVSQDD-VPIMLVGNKTDLREQALQEGITCIPTSYGEKLAMTYSSLFCETSAKEGSNIVEAVLHLAREVIKHAHEHKEPASVAKLSGSPSKKITSLNCC 722          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: zgc:162879 (ras and EF-hand domain-containing protein-like [Source:NCBI gene;Acc:103037315])

HSP 1 Score: 163.696 bits (413), Expect = 2.761e-42
Identity = 77/170 (45.29%), Postives = 115/170 (67.65%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKS-DINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLK 1890
            M++++LAGD+  GK+SF+L+   N F   + +T+G+D+  K + VDG    LQ+WDTAGQE+FRSI  +YFR+A G+L++YDV + SSFLNVR W++ I++S D N   P+ ++ NK+D R +   E  CV   +GE LA  Y+ +F E S KE  NI  A++ L+R +K
Sbjct:  474 MYRLVLAGDAGSGKSSFLLRLSLNEFRGDMQTTLGVDFQMKKMLVDGEKTNLQIWDTAGQERFRSIARSYFRKAHGVLLLYDVTSESSFLNVREWMEQIQESTDGN--VPMCVIGNKVDMR-AERPEGSCVSPAQGEKLAMTYNALFCETSAKEGTNIVEAVLHLAREVK 640          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: rab8a (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:103043778])

HSP 1 Score: 142.895 bits (359), Expect = 9.203e-39
Identity = 74/179 (41.34%), Postives = 113/179 (63.13%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +   +D+ +    M+L NK D       + + V K+ GE LA  Y + F E S K  IN+  A + L+R +KA+ D +L
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEK----MILGNKCDI-----NDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKL 177          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 145.591 bits (366), Expect = 1.792e-37
Identity = 83/197 (42.13%), Postives = 125/197 (63.45%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED-LELSKIHLNEQDIKTAKKCC 1962
            PER+FK+IL G+SSVGKT+F+ +FC   F+    +TV IDY+ +TL +    +ALQLWDTAGQE +RSI   +FR+ADG++++YDV   SSF +V  W+  I+++ + +  PIMLL NK D  +      + V  KE + LA+  +LMF E S     N+  A++ L+  L+ +ED +  + + L +Q +K  K CC
Sbjct:  244 PERLFKVILVGNSSVGKTAFLRRFCDGHFHATTTATV-IDYSVRTLNLGNSHVALQLWDTAGQE-YRSITKQFFRKADGVVVLYDVTMQSSFRSVHPWLVSIQEA-VGDPIPIMLLGNKSDMESI-----RQVPTKEAKRLAEETNLMFYECSAYTGYNVLEAMLHLA-VLREQEDRVWENTVRLVDQPVK-KKSCC 430          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: rab8b (ras-related protein Rab-8B [Source:NCBI gene;Acc:103040614])

HSP 1 Score: 137.117 bits (344), Expect = 1.291e-36
Identity = 72/174 (41.38%), Postives = 106/174 (60.92%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +   SD+      M+L NK D       + + V K+ GE LA +Y + F E S K   N+  A   LSR +  R
Sbjct:    8 LFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVER----MILGNKCDM-----NDKRQVSKERGEKLAIDYSIKFLETSAKSSTNVEEAFFTLSRDIMTR 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rasef (RAS and EF-hand domain containing [Source:ZFIN;Acc:ZDB-GENE-081105-157])

HSP 1 Score: 177.178 bits (448), Expect = 2.155e-47
Identity = 84/169 (49.70%), Postives = 116/169 (68.64%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARN-SNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSR 1881
            +R++K++LAGD++VGK+SF+L+ C+N F     +T+G+D+  KTL VDG  + LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    +FLNVR WIDII  S      P+ML+ NK D RN S   + K V    GE LA NY+ +F E S K+  N+   ++ L+R
Sbjct:  568 DRVYKLVLAGDAAVGKSSFLLRLCRNEFRKDTIATLGVDFQMKTLIVDGEHMTLQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKTFLNVRDWIDIIEDSAPKSI-PVMLVGNKSDMRNMSPGADQKYVAHTFGEKLAMNYNALFCETSAKDGSNVVETVLHLAR 735          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 142.895 bits (359), Expect = 2.189e-39
Identity = 74/179 (41.34%), Postives = 112/179 (62.57%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRK---SDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +   +D+ +    M+L NK D       E + V ++ GE LA  Y + F E S K  IN+  A   L+R +KA+ D +L
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEK----MILGNKCDM-----NERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKL 177          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 129.028 bits (323), Expect = 1.926e-34
Identity = 62/173 (35.84%), Postives = 101/173 (58.38%), Query Frame = 1
Query: 1369 MEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRL 1887
            M    +FK I+ GD+ VGK+  +LQF    F P+   T+G+++  + + +DG+ + LQ+WDTAGQE FRSI  +Y+R A G L++YD+    +F ++  W++  R+   N    IML+ NK D  +      + VK++EGE  A+ + L+F E S K   N+  A I  ++ +
Sbjct:    1 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHS-NSNMVIMLIGNKSDLES-----RREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEI 167          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 127.872 bits (320), Expect = 2.706e-34
Identity = 62/177 (35.03%), Postives = 103/177 (58.19%), Query Frame = 1
Query: 1366 KMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAR 1896
            +M    +FK I+ GD+ VGK+  +LQF    F P+   T+G+++  + + +DG+ + LQ+WDTAGQE FRSI  +Y+R A G L++YD+    +F ++  W++  R+   +    IML+ NK D  +      + VK++EGE  A+ + L+F E S K   N+  A I  ++ +  R
Sbjct:    5 EMSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMI-IMLIGNKSDLES-----RRDVKREEGEAFAREHGLVFMETSAKTAANVEEAFINTAKEIYQR 175          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 125.946 bits (315), Expect = 2.826e-33
Identity = 62/173 (35.84%), Postives = 98/173 (56.65%), Query Frame = 1
Query: 1369 MEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRL 1887
            M    +FK I+ GD+ VGK+  +LQF    F P+   T+G+++  + + + G+ + LQ+WDTAGQE FRSI  +Y+R A G L++YD+    +F ++  W++  R+   N    IML+ NK D  +        VK +EGE  A+ + L+F E S K   N+  A I  +R +
Sbjct:    6 MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHS-NSNMVIMLIGNKSDLESRRE-----VKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREI 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 128.257 bits (321), Expect = 3.041e-34
Identity = 64/175 (36.57%), Postives = 107/175 (61.14%), Query Frame = 1
Query: 1378 ERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARED 1902
            + + KI+L GDS VGK+  +++F ++ FNP   +T+GID+  KT+ ++G+ + LQLWDTAGQE+FR+I + Y+R A GI+++YDV +  +F N++ W   + +   N+   ++L+ NK D       E + V   +GE LAK   + F E S K   N+N     L++ ++ + D
Sbjct:   18 DSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEH-ANDEAQLLLVGNKSDM------ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID 185          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 121.709 bits (304), Expect = 6.390e-32
Identity = 63/164 (38.41%), Postives = 99/164 (60.37%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIEL 1875
            +FKI+L GDS VGK++ + +F KN FN    ST+G+++ T+TL +DG+ I  Q+WDTAGQE++R+I S Y+R A G LI+YD+   SS+ N   W+  +R+ + ++   + L+ NK D         + V  +E +  A+   L+F E S     N++ A  EL
Sbjct:   13 LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRE-NADDNVAVGLIGNKSDL-----AHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEEL 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 120.939 bits (302), Expect = 7.915e-32
Identity = 63/187 (33.69%), Postives = 110/187 (58.82%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNE 1932
            E + +FK++L G+S VGK+  +L+F  + +     ST+G+D+  KT+ +DG+ + LQ+WDTAGQE+FR+I S+Y+R + GI+I+YDV +  SF  V+ W+  I +   +     +L+ NK D ++    E+   K+      A    + F E S  +  N+  A + ++R++K      +S+ +LNE
Sbjct:    4 EYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-LLVGNKCDLKDKRVVEYDVAKE-----FADANKMPFLETSALDSTNVEDAFLTMARQIKE----SMSQQNLNE 180          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 119.783 bits (299), Expect = 1.874e-31
Identity = 68/171 (39.77%), Postives = 107/171 (62.57%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIA-LQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWID-IIRKSDIN--EFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNY-DLMFKEISVKEKININTAIIELSR 1881
            + K+I+ GDS VGKTS M ++  + ++    +T+G D+ TK + VDG  +A +Q+WDTAGQE+F+S+   ++R AD  +++YDV N SSF N++ W D  +  +++N  E  P ++L NKIDA  S     K V +K  + LAK+  D+     S K  IN++TA  E++R
Sbjct:    8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEES----KKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIAR 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 107.842 bits (268), Expect = 2.972e-27
Identity = 54/166 (32.53%), Postives = 92/166 (55.42%), Query Frame = 1
Query: 1390 KIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRL 1887
            K++L G+++VGK+S +L+F  N F      T+G  + T+ + ++   +  ++WDTAGQE+F S+   Y+R A   L++YDV  P SF+  R W+  + +    +   I L+ NKID         + V ++EGE LA+   L+F E S K   N+N   + +  ++
Sbjct:    9 KLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDII-IALVGNKIDMLQEGG--ERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKI 171          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO40857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S613])

HSP 1 Score: 183.726 bits (465), Expect = 1.203e-54
Identity = 91/167 (54.49%), Postives = 121/167 (72.46%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKE-GELLAKNYDLMFKEISVKEKININTAIIELSR 1881
            MFKI+LAGD++VGK+SF+L+ C+N F+  L ST+G+D+  KTL VDG+  ALQLWDTAGQE+FRSI  +YFR+ADG+L++YDV   +SFL+VR W++ I +S  ++  PIML  NKID R S + E+K V   E G  LAK +  +F E S KE  NI  A IEL+R
Sbjct:    1 MFKIVLAGDAAVGKSSFILRLCRNRFHSALNSTLGVDFQMKTLVVDGKTYALQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCETSFLDVRDWVEAIEES-CSKPVPIMLCGNKIDIRQSAAAENKTVITAESGSRLAKEHGALFIETSSKENKNIAEACIELAR 166          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO28399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 149.828 bits (377), Expect = 3.641e-42
Identity = 73/165 (44.24%), Postives = 106/165 (64.24%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELS 1878
            +FK++  GDS VGK+SF+ +FC + + P   +T+G+D+  KT+ V+G+ IA+QLWDTAGQE+FRSI   YFR+ADGILI YDV   SSF N++ W+  + +    E    M+L NK D   +   E + VK  +G+ LA  YD ++ E S K   NI  A+ +L+
Sbjct:    1 VFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEG-AEEGVAKMVLGNKTDL--AEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLA 162          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO47822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 149.828 bits (377), Expect = 3.641e-42
Identity = 73/165 (44.24%), Postives = 106/165 (64.24%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELS 1878
            +FK++  GDS VGK+SF+ +FC + + P   +T+G+D+  KT+ V+G+ IA+QLWDTAGQE+FRSI   YFR+ADGILI YDV   SSF N++ W+  + +    E    M+L NK D   +   E + VK  +G+ LA  YD ++ E S K   NI  A+ +L+
Sbjct:    1 VFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEG-AEEGVAKMVLGNKTDL--AEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLA 162          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 140.584 bits (353), Expect = 2.458e-38
Identity = 72/176 (40.91%), Postives = 108/176 (61.36%), Query Frame = 1
Query: 1384 MFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL 1911
            +FK++L GDS VGKT  + +F ++ FN    ST+GID+  +T+ +DG+ I LQ+WDTAGQE+FR+I + Y+R A GI+++YD+ N  SF N++ WI  I +    +    M+L NK D  +      + V K+ GE LA  Y + F E S K  IN+  A   L+R +K + D +L
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEK-MVLGNKCDMED-----RRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKL 177          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO47990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI3])

HSP 1 Score: 140.584 bits (353), Expect = 3.571e-38
Identity = 74/175 (42.29%), Postives = 110/175 (62.86%), Query Frame = 1
Query: 1390 KIILAGDSSVGKTSFMLQFCKNIF-NPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTP----IMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKARE 1899
            K++L GDS VGKT  +++F    F +    STVGIDY  K + VDG  + LQ+WDTAGQE+FRSI   Y+R +  +L++YDV N +SF N+R W+     ++I E+      IMLLANK D      T+ + V + +GE LAK++++ F E S K  +N++ A + ++R +K RE
Sbjct:   24 KVMLLGDSGVGKTCLLVRFKDGAFLSGSFISTVGIDYKNKVVEVDGSKVKLQIWDTAGQERFRSITHAYYRDSHALLLLYDVTNHASFENIRAWL-----AEIYEYARQDVIIMLLANKADL-----TKQRVVSRDQGEKLAKDHNVAFMETSAKTGLNVDLAFMAIARDIKHRE 188          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: zgc:162879 (ras and EF-hand domain-containing protein [Source:NCBI gene;Acc:101159669])

HSP 1 Score: 178.718 bits (452), Expect = 1.027e-47
Identity = 89/203 (43.84%), Postives = 127/203 (62.56%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL---SKIHLNE-QDIKTAKKCCSK 1968
            EP  M++++LAGD+  GK+SF+L+   N F   L ST+G+D+  K + VDG + +LQ+WDTAGQE+FRSI  +YFR+A G+L++YDV +  SFLNVR W+D I+ S  +E  PI ++ NK+D R        CV+  +GE LAK Y  +F E S KE  NI  A++ L+R +K    L     S++ L E    KT   CC +
Sbjct:  420 EPAPMYRLVLAGDAGAGKSSFLLRLTLNEFREDLQSTLGVDFQLKKMLVDGEMTSLQIWDTAGQERFRSIARSYFRKAHGVLLLYDVTSERSFLNVRAWVDQIQDS-TDEKLPICIIGNKVDLRE-QCENRSCVRSLDGEKLAKAYGALFCETSAKEGSNIVEAVLHLAREVKLNVKLRKTPESEVRLGETHSKKTVNSCCGR 620          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: zgc:162879 (ras and EF-hand domain-containing protein [Source:NCBI gene;Acc:101159669])

HSP 1 Score: 178.718 bits (452), Expect = 1.301e-47
Identity = 89/203 (43.84%), Postives = 127/203 (62.56%), Query Frame = 1
Query: 1372 EPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLEL---SKIHLNE-QDIKTAKKCCSK 1968
            EP  M++++LAGD+  GK+SF+L+   N F   L ST+G+D+  K + VDG + +LQ+WDTAGQE+FRSI  +YFR+A G+L++YDV +  SFLNVR W+D I+ S  +E  PI ++ NK+D R        CV+  +GE LAK Y  +F E S KE  NI  A++ L+R +K    L     S++ L E    KT   CC +
Sbjct:  452 EPAPMYRLVLAGDAGAGKSSFLLRLTLNEFREDLQSTLGVDFQLKKMLVDGEMTSLQIWDTAGQERFRSIARSYFRKAHGVLLLYDVTSERSFLNVRAWVDQIQDS-TDEKLPICIIGNKVDLRE-QCENRSCVRSLDGEKLAKAYGALFCETSAKEGSNIVEAVLHLAREVKLNVKLRKTPESEVRLGETHSKKTVNSCCGR 652          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: rasef (RAS and EF-hand domain containing [Source:NCBI gene;Acc:101171009])

HSP 1 Score: 178.718 bits (452), Expect = 5.704e-47
Identity = 93/205 (45.37%), Postives = 128/205 (62.44%), Query Frame = 1
Query: 1369 MEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDI-NEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE-----LSKIHLNEQDIKTAKKCCS 1965
            M  E+ ++I+LAGD++VGK+SF+L+ CKN F     +T+G+D++ KTL VDG  + LQLWDTAGQE+FRSI  +YFRRADG+L++YDV    SFLN+R W+D+I   D+ +E  PIML+ NK D R     E  CV    GE LA  Y+ +F E S K+  NI  A++ L+R +K     E      S   L+    K    CC+
Sbjct:  623 MTSEKAYRIVLAGDAAVGKSSFLLRLCKNEFQLNSSATLGVDFHMKTLIVDGEPVLLQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNIREWVDMI--EDVSHEDIPIMLVGNKCDMRKE---EFNCVPISYGEKLAMTYNTLFCETSAKDGSNILEAVLHLARLVKKHATFEEKRRGQSLPSLDAPRTKPKHLCCT 822          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027276.1 (calcium release activated channel regulator 2A [Source:NCBI gene;Acc:101161971])

HSP 1 Score: 172.94 bits (437), Expect = 2.718e-45
Identity = 90/196 (45.92%), Postives = 124/196 (63.27%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCC 1962
            P+R+FK++L G+SSVGKT F+ +FC + F+P   +TVG+DY+ KTL VD   +ALQLWDTAGQE++RSI   +FR+ADG+++MYD+    SF  VR W+  +++S  NE  PIMLL NK D       E K V+KK GE LAK+  L   E S     N+  +++ L+R LK +ED E  K  L        K+ C
Sbjct:  519 PDRLFKVVLVGNSSVGKTCFLRRFCDDCFHPGTCATVGVDYSVKTLTVDNSQVALQLWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLSSVKES-ANEEIPIMLLGNKTD----KEMERK-VEKKMGERLAKDCQLSVFECSAYSGENVLESMVHLARILKKQEDQEKEKTVLLVGGPSARKRSC 708          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035474.1 (calcium release activated channel regulator 2A [Source:NCBI gene;Acc:101161971])

HSP 1 Score: 172.94 bits (437), Expect = 2.718e-45
Identity = 90/196 (45.92%), Postives = 124/196 (63.27%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCC 1962
            P+R+FK++L G+SSVGKT F+ +FC + F+P   +TVG+DY+ KTL VD   +ALQLWDTAGQE++RSI   +FR+ADG+++MYD+    SF  VR W+  +++S  NE  PIMLL NK D       E K V+KK GE LAK+  L   E S     N+  +++ L+R LK +ED E  K  L        K+ C
Sbjct:  519 PDRLFKVVLVGNSSVGKTCFLRRFCDDCFHPGTCATVGVDYSVKTLTVDNSQVALQLWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLSSVKES-ANEEIPIMLLGNKTD----KEMERK-VEKKMGERLAKDCQLSVFECSAYSGENVLESMVHLARILKKQEDQEKEKTVLLVGGPSARKRSC 708          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000028852.1 (SMESG000028852.1)

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 635/635 (100.00%), Postives = 635/635 (100.00%), Query Frame = 1
Query:   67 MNQTHLINELKNAIGNETEIFSKTEWIDICLRFKFVADIQSAVELFEKFDTNQDGFINIFDIGLYCDRSKESKEFIQEEYLSTNINQLIRENLRSEERILTFFKTIQSQYPSLQKYFXXXXXXXXXXXXXXXXXXXXXXNSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASXXXXXXXXXXXXXXXXXNVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQXXXXXXXXXXXXXXXXFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVXXXXXXXXEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI 1971
            MNQTHLINELKNAIGNETEIFSKTEWIDICLRFKFVADIQSAVELFEKFDTNQDGFINIFDIGLYCDRSKESKEFIQEEYLSTNINQLIRENLRSEERILTFFKTIQSQYPSLQKYFEDLLIDIISEISEIKKEYEKLENSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASKLKLLENELVKKDDELENVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQLRSTLISLSNTNSNKSFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVSLSSLSSSEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI
Sbjct:    1 MNQTHLINELKNAIGNETEIFSKTEWIDICLRFKFVADIQSAVELFEKFDTNQDGFINIFDIGLYCDRSKESKEFIQEEYLSTNINQLIRENLRSEERILTFFKTIQSQYPSLQKYFEDLLIDIISEISEIKKEYEKLENSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASKLKLLENELVKKDDELENVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQLRSTLISLSNTNSNKSFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVSLSSLSSSEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI 635          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000028852.1 (SMESG000028852.1)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 541/543 (99.63%), Postives = 541/543 (99.63%), Query Frame = 1
Query:  343 LRSEERILTFFKTIQSQYPSLQKYFXXXXXXXXXXXXXXXXXXXXXXNSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASXXXXXXXXXXXXXXXXXNVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQXXXXXXXXXXXXXXXXFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVXXXXXXXXEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI 1971
            L  EERILTFFKTIQSQYPSLQKYFEDLLIDIISEISEIKKEYEKLENSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASKLKLLENELVKKDDELENVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQLRSTLISLSNTNSNKSFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVSLSSLSSSEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI
Sbjct:   35 LSCEERILTFFKTIQSQYPSLQKYFEDLLIDIISEISEIKKEYEKLENSYNKEKNVSKEKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYKNLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASKLKLLENELVKKDDELENVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQLRSTLISLSNTNSNKSFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKIRRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRRKVGQRHSSDLSAGNQSTIDEKVSLSSLSSSEIIKMEPERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI 577          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000076099.1 (SMESG000076099.1)

HSP 1 Score: 176.792 bits (447), Expect = 1.870e-46
Identity = 92/205 (44.88%), Postives = 134/205 (65.37%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE-------LSKIHLNEQ-DIKTAKKCC 1962
            PER++KI+ AGD+SVGK++F+ + C + F     +T+GID+  KT+ VDG+ I LQLWDTAGQE+FRS+ +NYFR+ADG+L++YD     SF++VR W++ IRK+  NE  PI+L +NK D R+  + E  K V ++ GE LA  + L+F E S K   NI   + EL+R L   EDL+       L+K  +  Q + K + +CC
Sbjct:  600 PERLYKIVFAGDASVGKSTFITRLCTDSFVSDCMATIGIDFRNKTIEVDGKYIGLQLWDTAGQERFRSMTANYFRKADGVLLLYDCTYIESFIHVRDWVETIRKAAGNEI-PIVLASNKSDLRDRYAEEGRKTVSRELGENLASEHQLIFVETSAKSGENILQTMEELARVLAKNEDLQVMNPIIDLTKEAITSQKNSKASPQCC 803          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000076099.1 (SMESG000076099.1)

HSP 1 Score: 176.792 bits (447), Expect = 1.909e-46
Identity = 92/205 (44.88%), Postives = 134/205 (65.37%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTE-HKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLE-------LSKIHLNEQ-DIKTAKKCC 1962
            PER++KI+ AGD+SVGK++F+ + C + F     +T+GID+  KT+ VDG+ I LQLWDTAGQE+FRS+ +NYFR+ADG+L++YD     SF++VR W++ IRK+  NE  PI+L +NK D R+  + E  K V ++ GE LA  + L+F E S K   NI   + EL+R L   EDL+       L+K  +  Q + K + +CC
Sbjct:  616 PERLYKIVFAGDASVGKSTFITRLCTDSFVSDCMATIGIDFRNKTIEVDGKYIGLQLWDTAGQERFRSMTANYFRKADGVLLLYDCTYIESFIHVRDWVETIRKAAGNEI-PIVLASNKSDLRDRYAEEGRKTVSRELGENLASEHQLIFVETSAKSGENILQTMEELARVLAKNEDLQVMNPIIDLTKEAITSQKNSKASPQCC 819          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000039353.1 (SMESG000039353.1)

HSP 1 Score: 142.895 bits (359), Expect = 8.040e-39
Identity = 70/198 (35.35%), Postives = 121/198 (61.11%), Query Frame = 1
Query: 1375 PERMFKIILAGDSSVGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQEKFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIMLLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAIIELSRRLKAREDLELSKIHLNEQDIKTAKKCCSK 1968
            PE +FK++L GDS+VGK++ + +FC   F     +T+G+D+  K++ V+  +IALQLWDTAGQE++ SI   ++R+ DG++++YD++   SF+N+R WID + K+  +E   +M+L NK+D   S   + K +  K    L++ Y  +  E+S     NIN +   L++ LK R+D++++      +    +  CC K
Sbjct:    2 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVM-LMMLGNKLDLAKS---QPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKK 195          
The following BLAST results are available for this feature:
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASEF1.482e-5045.77RAS and EF-hand domain containing [Source:HGNC Sym... [more]
CRACR2A2.763e-4344.89calcium release activated channel regulator 2A [So... [more]
RAB8A6.304e-3941.90RAB8A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB372.884e-3837.44RAB37, member RAS oncogene family [Source:HGNC Sym... [more]
RAB264.297e-3842.29RAB26, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsef-11.081e-4446.07Ras and EF-hand domain-containing protein homolog ... [more]
4R79.23.906e-4340.30pep chromosome:WBcel235:IV:17480396:17482329:-1 ge... [more]
4R79.21.900e-4240.30pep chromosome:WBcel235:IV:17480396:17483332:-1 ge... [more]
rab-81.511e-3540.80RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-81.511e-3540.80RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab87.131e-3639.77gene:FBgn0262518 transcript:FBtr0308833[more]
Rab87.131e-3639.77gene:FBgn0262518 transcript:FBtr0074921[more]
Rab261.342e-3540.12gene:FBgn0086913 transcript:FBtr0331794[more]
Rab261.342e-3540.12gene:FBgn0086913 transcript:FBtr0112678[more]
Rab261.342e-3540.12gene:FBgn0086913 transcript:FBtr0301529[more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasef1.047e-4643.78RAS and EF-hand domain containing [Source:ZFIN;Acc... [more]
cracr2ab1.092e-4542.64calcium release activated channel regulator 2Ab [S... [more]
cracr2ab4.211e-4442.64calcium release activated channel regulator 2Ab [S... [more]
CABZ01062083.12.130e-4343.37calcium release activated channel regulator 2Aa [S... [more]
zgc:1628792.950e-4339.90zgc:162879 [Source:NCBI gene;Acc:572256][more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irf61.125e-4949.44interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
irf62.011e-4849.44interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
irf62.436e-4849.44interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
irf61.669e-4750.30interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
erich38.679e-4446.29glutamate rich 3 [Source:Xenbase;Acc:XB-GENE-58807... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasef2.265e-4946.63RAS and EF hand domain containing [Source:MGI Symb... [more]
Rasef1.078e-4846.63RAS and EF hand domain containing [Source:MGI Symb... [more]
Rasef3.882e-4846.63RAS and EF hand domain containing [Source:MGI Symb... [more]
Cracr2a1.061e-4243.41calcium release activated channel regulator 2A [So... [more]
Rab8a4.243e-3941.90RAB8A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZ41|RASEF_HUMAN7.116e-5045.77Ras and EF-hand domain-containing protein OS=Homo ... [more]
sp|Q5RI75|RASEF_MOUSE7.542e-4846.63Ras and EF-hand domain-containing protein homolog ... [more]
sp|Q08CX1|RASEF_XENTR1.291e-4749.44Ras and EF-hand domain-containing protein OS=Xenop... [more]
sp|Q22908|RASEF_CAEEL1.375e-4346.07Ras and EF-hand domain-containing protein homolog ... [more]
sp|Q619T5|RASEF_CAEBR1.491e-4343.08Ras and EF-hand domain-containing protein homolog ... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FYQ57.613e-5555.95Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A0L8G9T11.517e-5338.14Uncharacterized protein (Fragment) OS=Octopus bima... [more]
R7TMM02.365e-5347.78Uncharacterized protein OS=Capitella teleta OX=283... [more]
W4Y4665.950e-5350.50Uncharacterized protein OS=Strongylocentrotus purp... [more]
K1Q8661.265e-5149.02RAS and EF-hand domain-containing protein OS=Crass... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasef7.895e-4744.78RAS and EF-hand domain containing [Source:NCBI gen... [more]
zgc:1628792.761e-4245.29ras and EF-hand domain-containing protein-like [So... [more]
rab8a9.203e-3941.34RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
cracr2ab1.792e-3742.13calcium release activated channel regulator 2Ab [S... [more]
rab8b1.291e-3641.38ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasef2.155e-4749.70RAS and EF-hand domain containing [Source:ZFIN;Acc... [more]
rab8a2.189e-3941.34RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab2a1.926e-3435.84RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B2.706e-3435.03RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2B2.826e-3335.84RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC43.041e-3436.57Rab family GTPase; essential for vesicle-mediated ... [more]
YPT316.390e-3238.41Rab family GTPase; involved in the exocytic pathwa... [more]
YPT17.915e-3233.69Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT71.874e-3139.77Rab family GTPase; GTP-binding protein of the rab ... [more]
VPS212.972e-2732.53Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408571.203e-5454.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283993.641e-4244.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478223.641e-4244.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410182.458e-3840.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479903.571e-3842.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1628791.027e-4743.84ras and EF-hand domain-containing protein [Source:... [more]
zgc:1628791.301e-4743.84ras and EF-hand domain-containing protein [Source:... [more]
rasef5.704e-4745.37RAS and EF-hand domain containing [Source:NCBI gen... [more]
ENSORLT00000027276.12.718e-4545.92calcium release activated channel regulator 2A [So... [more]
ENSORLT00000035474.12.718e-4545.92calcium release activated channel regulator 2A [So... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028852.10.000e+0100.00SMESG000028852.1[more]
SMESG000028852.10.000e+099.63SMESG000028852.1[more]
SMESG000076099.11.870e-4644.88SMESG000076099.1[more]
SMESG000076099.11.909e-4644.88SMESG000076099.1[more]
SMESG000039353.18.040e-3935.35SMESG000039353.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018493 ID=SMED30018493|Name=Ras and EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1995bp
GTCTACTTAGTAAACTCTACTATTATTGATTAATCAGTTATTCTGTGATT
CTGTGATTCTGCCATTATGAATCAAACTCACTTGATAAATGAATTGAAAA
ATGCAATTGGCAATGAAACAGAGATTTTCTCTAAAACAGAATGGATTGAT
ATTTGTCTTAGATTTAAATTCGTAGCCGATATTCAATCTGCTGTGGAACT
CTTTGAAAAATTCGACACCAATCAAGACGGTTTCATTAATATTTTCGATA
TCGGATTGTATTGTGACAGATCAAAGGAAAGCAAAGAATTTATCCAAGAG
GAATATTTAAGCACAAATATTAACCAATTAATCCGTGAAAATCTTAGGAG
CGAAGAACGGATTTTGACATTTTTCAAAACGATTCAGTCTCAGTATCCTT
CACTGCAGAAATATTTCGAAGATCTCCTCATAGACATTATTAGTGAAATT
AGTGAAATCAAAAAAGAATATGAAAAATTGGAGAATTCATATAATAAAGA
AAAAAATGTTTCAAAAGAAAAGCTGAAAGAACTTCAAGATGATTTAGAGT
CTTGGTTTACAAAATATGAAAATGATATGAAACATAAACTTTCTCAATAT
GAACATCAGATTAAATCTATCAAGTCAGAAAGAGATTGTCTAATAGATGA
AATAGAATATTACAAGAATTTACAAAATAAAAACAAAATATTGGAAGATT
CATGCACTGAAACAGTTGCTCTTGATTATGACGTAACAGAATTACAAACA
AGTCTTAGAGAATCTGAATCTGTCAAAGCATACTATGCCTCAAAATTAAA
GTTATTAGAAAATGAATTGGTGAAGAAAGATGACGAATTGGAAAATGTAA
GAATGAAATTCCAAAACGCCTGTGACAACTGCCAAACTCTCGATGTCAAT
CTCCAGAATTTAGTATATGCCAACCGGAAGCTAAATGATGACAATGACCA
ATTGAGGTCCACCTTAATATCTTTATCTAATACAAATTCCAATAAATCCT
TCAATATTTCACAAAATATCGAGCAGGCAGAAATGTTAGAAGCTGAGGAC
AGCGGACTATCTACCCAAATAGAGTTCGGGGACACAGACAATGAATATCT
GTCAATTAATAAAATAAGAAGAATACATAGTTTTATTTCCAATCAGAACA
AAATGAACAATTTATCGAATTCTTGCGATAGTGATAACATTGAGTCCCCA
GTCCATGGGCCATTTCGTAATACAGTTGCGTTAAAATCTCAACTCCAGAA
CAAGAACAACCGACGAAAGGTAGGGCAAAGACATTCATCTGATCTAAGTG
CTGGAAATCAGTCAACCATAGATGAAAAAGTATCCCTAAGCTCATTGTCA
TCGAGTGAAATTATTAAAATGGAACCAGAAAGAATGTTTAAGATAATTTT
GGCTGGAGATTCCTCTGTGGGAAAAACCAGTTTTATGCTACAATTTTGTA
AAAATATTTTTAATCCCATATTGCCATCAACTGTTGGTATAGACTATAAT
ACTAAGACATTATTTGTTGATGGAAGACTTATTGCATTACAGCTTTGGGA
TACTGCAGGTCAAGAAAAATTTCGTAGTATAGTTTCGAATTATTTTAGAA
GAGCTGATGGAATTTTAATAATGTATGATGTATTAAATCCGTCATCCTTT
TTGAATGTGAGATGCTGGATTGATATAATACGAAAATCTGACATTAACGA
ATTTACCCCAATAATGCTTTTGGCAAATAAAATAGACGCAAGAAATTCCA
ATTCGACCGAACATAAATGTGTAAAGAAAAAAGAGGGTGAATTGCTAGCA
AAAAATTATGACCTCATGTTCAAAGAAATTAGTGTGAAAGAAAAAATAAA
TATCAACACTGCTATAATTGAACTGTCAAGAAGGCTTAAAGCTCGAGAAG
ATTTAGAATTATCGAAAATTCATTTGAATGAGCAGGATATAAAAACTGCA
AAAAAATGTTGTTCAAAAATCTGATTCAAATTGCATTCCAGATCG
back to top

protein sequence of SMED30018493-orf-1

>SMED30018493-orf-1 ID=SMED30018493-orf-1|Name=SMED30018493-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=636bp
MNQTHLINELKNAIGNETEIFSKTEWIDICLRFKFVADIQSAVELFEKFD
TNQDGFINIFDIGLYCDRSKESKEFIQEEYLSTNINQLIRENLRSEERIL
TFFKTIQSQYPSLQKYFEDLLIDIISEISEIKKEYEKLENSYNKEKNVSK
EKLKELQDDLESWFTKYENDMKHKLSQYEHQIKSIKSERDCLIDEIEYYK
NLQNKNKILEDSCTETVALDYDVTELQTSLRESESVKAYYASKLKLLENE
LVKKDDELENVRMKFQNACDNCQTLDVNLQNLVYANRKLNDDNDQLRSTL
ISLSNTNSNKSFNISQNIEQAEMLEAEDSGLSTQIEFGDTDNEYLSINKI
RRIHSFISNQNKMNNLSNSCDSDNIESPVHGPFRNTVALKSQLQNKNNRR
KVGQRHSSDLSAGNQSTIDEKVSLSSLSSSEIIKMEPERMFKIILAGDSS
VGKTSFMLQFCKNIFNPILPSTVGIDYNTKTLFVDGRLIALQLWDTAGQE
KFRSIVSNYFRRADGILIMYDVLNPSSFLNVRCWIDIIRKSDINEFTPIM
LLANKIDARNSNSTEHKCVKKKEGELLAKNYDLMFKEISVKEKININTAI
IELSRRLKAREDLELSKIHLNEQDIKTAKKCCSKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
IPR018247EF_Hand_1_Ca_BS
IPR002048EF_hand_dom
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 286..306
NoneNo IPR availableCOILSCoilCoilcoord: 121..159
NoneNo IPR availableCOILSCoilCoilcoord: 244..264
NoneNo IPR availableCOILSCoilCoilcoord: 168..195
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 585..607
score: 27.73
coord: 441..462
score: 41.62
coord: 464..480
score: 26.66
coord: 545..558
score: 37.81
coord: 482..504
score: 49.52
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 441..610
e-value: 2.3E-57
score: 206.6
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 443..631
e-value: 2.1E-8
score: -11.0
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 446..635
e-value: 1.2E-4
score: 17.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 438..610
e-value: 4.8E-17
score: 72.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 429..634
e-value: 1.1E-50
score: 173.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 395..414
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 231..634
NoneNo IPR availablePANTHERPTHR24073:SF919RAS AND EF-HAND DOMAIN-CONTAINING PROTEINcoord: 231..634
NoneNo IPR availablePROSITEPS51419RABcoord: 436..635
score: 28.08
NoneNo IPR availableCDDcd00154Rabcoord: 441..605
e-value: 1.20813E-58
score: 191.9
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 440..600
e-value: 4.4E-23
score: 79.8
IPR001806Small GTPasePFAMPF00071Rascoord: 442..607
e-value: 8.3E-45
score: 152.3
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 50..62
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 37..72
score: 9.297
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 435..610