Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat

Overview
NameDpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat
Smed IDSMED30018476
Length (bp)2214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat (SMED30018476) t-SNE clustered cells

Violin plots show distribution of expression levels for Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat (SMED30018476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat (SMED30018476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat (SMED30018476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018476SMESG000078142.1 SmedASXL_004920SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018476SMESG000078142.1 dd_Smed_v4_29956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018476SMESG000078142.1 dd_Smed_v4_29956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018476SMESG000078142.1 dd_Smed_v6_29956_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018476SMESG000060264.1 SMESG000078142.1 OX_Smed_1.0.15566ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30018476SMESG000078142.1 Contig1281newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018476SMESG000078142.1 Contig1281uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018476SMESG000034563.1 Contig1281newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018476SMESG000034563.1 Contig1281uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Fly
Match: CG42284 (gene:FBgn0259179 transcript:FBtr0343179)

HSP 1 Score: 65.0846 bits (157), Expect = 1.047e-10
Identity = 60/241 (24.90%), Postives = 118/241 (48.96%), Query Frame = 3
Query:  339 RDNHGNSLLHLA-IQANCDVDIFKLILKVS-NLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLE----MAIDKLMDQLNDNFIG-FLSSIDSLIELFKTLIDKIVVDNFE---EFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDL-GNSPEYY 1028
            RD HG S+LH A  +++    ++ LI +   ++++R++ ++  +D+ + ++      EI  Y++ +    + E    L +QG++    +E     +I  ++    +  +G FL+++ +L E  + L   I  +N E   E  NV  +       +I  +N  G T LH+A++ E  ++V+ ++++  E   K TD+L RT+LHY  G         ++++   N       DL G  P YY
Sbjct:  156 RDEHGQSMLHFACARSHRRGALYTLIEESGIDITYRDELYRTARDVSLQANQPNNAAEIDRYVMAQAVIGDVEPFEQLALQGYDHILDIEDENGQSITDVVQSRQNAALGEFLANLKALEESREELHQMIRENNMERVVELTNVANAKW-----LIRTKNYYGRTALHIAVLKESEEMVQHMVKICPEG-LKITDNLERTVLHYAMGTNALESVSRILIQ---NGAKRTAKDLKGRQPSYY 387          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Fly
Match: CG42284 (gene:FBgn0259179 transcript:FBtr0343178)

HSP 1 Score: 64.6994 bits (156), Expect = 2.381e-10
Identity = 60/241 (24.90%), Postives = 118/241 (48.96%), Query Frame = 3
Query:  339 RDNHGNSLLHLA-IQANCDVDIFKLILKVS-NLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLE----MAIDKLMDQLNDNFIG-FLSSIDSLIELFKTLIDKIVVDNFE---EFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDL-GNSPEYY 1028
            RD HG S+LH A  +++    ++ LI +   ++++R++ ++  +D+ + ++      EI  Y++ +    + E    L +QG++    +E     +I  ++    +  +G FL+++ +L E  + L   I  +N E   E  NV  +       +I  +N  G T LH+A++ E  ++V+ ++++  E   K TD+L RT+LHY  G         ++++   N       DL G  P YY
Sbjct:  408 RDEHGQSMLHFACARSHRRGALYTLIEESGIDITYRDELYRTARDVSLQANQPNNAAEIDRYVMAQAVIGDVEPFEQLALQGYDHILDIEDENGQSITDVVQSRQNAALGEFLANLKALEESREELHQMIRENNMERVVELTNVANAKW-----LIRTKNYYGRTALHIAVLKESEEMVQHMVKICPEG-LKITDNLERTVLHYAMGTNALESVSRILIQ---NGAKRTAKDLKGRQPSYY 639          

HSP 2 Score: 59.3066 bits (142), Expect = 1.084e-8
Identity = 48/172 (27.91%), Postives = 85/172 (49.42%), Query Frame = 3
Query:  795 GLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEI---------FPELFNLDYCIEFIKSDLMN----LQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFY 1271
            G T LHVA++F   D+V+ L     E  +  TD+ GRT LHY    K +     ++++L  N     +D LG+S E+Y           + EL N+ +  E +++ L+N     Q ++ + N +   +       +YL  ++   L+KA   +  KRP DP+ +L ++L+ +
Sbjct:  166 GSTPLHVAVLFGHTDIVRYLASRFPETMT-ITDNDGRTPLHYAATIKDNGHFYNMLLQLGANP--KSLDKLGHSAEFYLDKEKAKNILNYTELLNI-FGAEELENQLLNDQGQAQPVSFQANPIFKTEQG-----KYLADSLADPLIKALTEIANKRPRDPVAYLTNYLQHF 328          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Match: B4MQ96 (GK21459 OS=Drosophila willistoni OX=7260 GN=Dwil\GK21459 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.468e-11
Identity = 63/238 (26.47%), Postives = 116/238 (48.74%), Query Frame = 3
Query:  339 RDNHGNSLLHLA-IQANCDVDIFKLILKVS-NLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLE-----MAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDL-GNSPEYY 1028
            RD HG S+LH A  +++    +F LI +   ++++R++ ++  +D+ + ++      EI  Y+V +      E    L +QG++    LE       +D  + + ND+ + FL  + +L E  + L   I  +N E+   + + +    +  I  +N  G T LH+A++ E  ++V+ L++L  E   K TD+L RT+LHY  G         ++++   N       DL G  P YY
Sbjct:  128 RDEHGQSMLHFACARSHRRGQLFTLIEESRIDITYRDELYRTARDVALQANQPNNAAEIDRYVVAQAIIGNVETFEQLALQGYDHILDLEDDKGKSIVDVALSRHNDDLVSFLGKLRTLEETREELHQMIRDNNMEKVKELTSITNAKWF--IKTKNYYGRTALHIAVLKESEEMVQHLVKLCPE-ALKITDNLERTVLHYAMGTNSLESVSRILIQ---NGAKRTAKDLKGRQPSYY 359          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Match: A0A0C9RYC7 (Slc24a1 protein OS=Fopius arisanus OX=64838 GN=Slc24a1 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.822e-11
Identity = 101/437 (23.11%), Postives = 174/437 (39.82%), Query Frame = 3
Query:  795 GLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYY-EIFPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNF--------------DTSDYEYEVLSSRISLELFPGLERKIIDKSFTFKPEIFSP---FAKVARDKHGT--LHGYXXXXXXXXSIDVSEVDWFEIIKR-GLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQE-----VADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSE------MLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYA 2009
            G T LHVA++F    V++ L     E  + A D  GRT LHY      +     L++ L  N L   +D+ G   ++Y E   +L +     +F   + +  +++  KE+S        + +  YL  +VG  L+K  A V + RP DP+ +L  +L  +A N               D  + E ++ SS   +E          D+S+   P    P   F+   RD+HG   LH   +  +    +       F I++   +N   RD    T  ++A    F     D+D  ++ +   G  + L  L   GY ++  D  E  G ++ D++ E        F   +         +       D N    I S       +LA   N  G   ++ A+   + ++  Y+ + +P++L++ D  NR   HY   
Sbjct:  470 GATPLHVAVVFGHTSVIRYLAGRFPET-THAVDVDGRTPLHYAATLADNGHYYNLLLHLGANPLI--LDNFGQKADFYKENQTDLSHKQLLRDFGAREELADEMLTDKEHSNMETPIFREEEGRYLASSVGDPLIKGLAKVAQSRPKDPLTYLATYLYNFARNKSGASIQKSDILIVPDRPEEEIDLDSSSTPME---DPHNTPDDESYLRSPASDVPESAFSPANRDEHGQSMLHFACVRTRPKDGL-------FHILQETQINLGYRDELYRTARDVAEESNFQENVADIDRYVVYLAARGETEKLVELLLEGY-DHILDT-EDGGVNVVDITAERNHEATIQFLQGIPTYIGQREEVHRAIRGGDLNATKEILSRYGGGGTLLAVGKNTVGRCSMHIAVLCEHIDIVRYLANTYPETLRIGDNLNRTALHYAMG 891          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Match: A0A5N4ADR4 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_12309 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.734e-11
Identity = 115/470 (24.47%), Postives = 192/470 (40.85%), Query Frame = 3
Query:  795 GLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEIFPELFNLDYCI-EFIKSDLMNLQVINRKENSVTNKDSDAD----NDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATN---FDTSDYEYEVLSSRISLELFPGLERKIIDKSFTFKP------EIFSPFAKVARDKHGT--LHGYXXXXXXXXSIDVSEVDWFE-IIKRGLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQ----EVADFYTSLS--DEQTNLV-------TIFSDNS-SADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSNKQFMEIVDEYYPEGKDE---IDCFDYLPEYY 2102
            G + LHVA IF    +V+ L     E    A D+  RT LHY      +     L++ L +N      D  G++PE+Y    E F+    + EF   D+ +  +I+ K+ S  N   D       +  YL  ++G  L+K    V  KRP+DPI +L  +L  +A N     T + E  +      ++    +   I     T +P      E  S F K +RD+HG   LH          ++       F+ +I+  +N + RD    T  ++++        +++D  +L++  +G+   L  L   GY      + E   P +  VS     E   F  S+   +E+   V       +I+   S  AD N     + ++LA   N  G   ++ A+      +  Y+V+ FPD+L + D   R   HY       + ME +++   +G  +    D     P YY
Sbjct:  759 GTSPLHVATIFGNTSIVRYLAGRFPET-VLAVDNNDRTPLHYAAVLDDNNHYFNLLIHLGSNP--KAEDKFGHTPEFYRTDREEFSHRILLCEFGAEDVAD-DIIHDKDKSTNNVQVDMPFFYTEEGRYLASSLGDPLIKGLTEVANKRPDDPIAYLATYLYNFANNNSRGKTQENEEVITGPPEDVDSNNAIPTTI--DVVTLEPDAESTGEEESAFNKTSRDEHGQSMLHFAAARSHGRDAL-------FQLLIETEVNISYRDELYRTARDISIQANIPENTNEIDKYVLHIACKGDTDKLVELLLNGYDHITDVVDEDDVPIIEAVSSKEQDETVSFLQSILTFEEKRERVHHAIRQGSIYEVTSLLADENETG--SGKLLAIGKNSYGRCTLHIAVLCQQEEIVDYLVNTFPDTLNVGDNLERTALHYSMGI---EKMESINKLLVKGGAKRVIKDLKGRQPSYY 1210          

HSP 2 Score: 62.7734 bits (151), Expect = 3.591e-6
Identity = 58/244 (23.77%), Postives = 116/244 (47.54%), Query Frame = 3
Query:  336 SRDNHGNSLLHLAIQANCDVD-IFKLILKVS-NLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWEC---------RPYLEMAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLT-SSQTPMYDVIPF-RNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYY 1028
            SRD HG S+LH A   +   D +F+L+++   N+S+R++ ++  +D+ + ++     NEI  Y++   C  + + +  L++ G++           P +E    K  D+     + FL SI +  E  + +   I   +  E  ++L   ++T    ++   +N  G   LH+A++ ++ ++V  L+    +  +   D+L RT LHY  G +     ++L+V+     +    D  G  P YY
Sbjct:  974 SRDEHGQSMLHFAAARSHGRDALFQLLIETEVNISYRDELYRTARDISIQANIPENTNEIDKYVLHIACKGDTDKLVELLLNGYDHITDVVDEDDVPIIEAVSSKEQDET----VSFLQSILTFEEKRERVHHAIRQGSIYEVTSLLADENETGSGKLLAIGKNSYGRCTLHIAVLCQQEEIVDYLVNTFPDTLN-VGDNLERTALHYSMGIEKMESINKLLVKGGAKRVIK--DLKGRQPSYY 1210          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Match: B4JA28 (GH19789 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH19789 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.235e-9
Identity = 59/238 (24.79%), Postives = 111/238 (46.64%), Query Frame = 3
Query:  339 RDNHGNSLLHLAIQANCDVDIFKLILKVS--NLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLE-----MAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDL-GNSPEYY 1028
            RD HG S+LH A   +        +++ S  ++++R++ ++  +D+ + ++      EI  Y+  ++   + E +  L +QG++    +E       ID   ++ ++  + FL+S+ +L E  + L   I   N E    +        +  I  +N  G T LH+A++ E  ++V+ L+ L  E   K TD+L RT+LHY  G         ++++   N       DL G  P YY
Sbjct:  149 RDEHGQSMLHFACARSHRRGALYTLIEESRIDITYRDELYRTARDVALQANQPTNATEIDRYVFAQVVLGDVEPLEQLALQGYDHILDVEDESGKSVIDVATERQHEALVAFLNSLRTLEETREELHQMIRDKNMERLKELTAVPNAKWF--IRTKNYYGRTALHIAVLKESEEMVQHLVDLCPE-ALKVTDNLERTVLHYALGTNFCESVSRILIQ---NGAKRTAKDLKGRQPSYY 380          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Match: A0A4S2KPA0 (Uncharacterized protein OS=Temnothorax longispinosus OX=300112 GN=DBV15_03185 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.407e-9
Identity = 92/434 (21.20%), Postives = 173/434 (39.86%), Query Frame = 3
Query:  795 GLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEI-FPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNFDTSDYEYEVLSSRISLELFPGLERKII----------DKSFTFKPEIFSP---FAKVARDKHGT--LHGYXXXXXXXXSIDVSEVDWFEIIKRGLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVS------------QEVADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAF 2012
            G T LHVA++F    V++ L     E  + A D  GRT LHY      +     L++ L  N L    D+     +YY+    +L +     +F  S+ +  +++  K++S  +       +  YL  ++G  L+K    V   RP DPI +L  +L  +A+    ++ E +VL       + P  E + +          D  +   P+   P   F+   RD+HG   +H   +       +      +  +++  +N   RD    T  ++A         +++D  ++ +   G  + L  L   GY ++  D  E  G ++ DV+            Q + ++     +    + TI  D +    +  N    ++LA   N  G   ++ A+   +  L  +I   +P++L++ D   R   HY    
Sbjct:  709 GATPLHVAVVFGNTAVIRYLAGRFPET-ANAIDLDGRTPLHYAATLADNGHYYNLLLHLGANPLVE--DNFEQKADYYKQNQSDLSHKKLLRDFGASEKLADEMLTDKDDSGVDIPIFRSEEGRYLASSLGDPLIKGLTEVANARPKDPIAYLATYLYNFASKNKANEQESDVL-------IIPDREEENLGNVENHAFDDDAGYPRSPDSDVPESTFSNPNRDEHGQSMIHFAAVRSYSKDGL------YHLLLETQVNVGFRDELYRTARDVAEQANIRENVEEIDRFVVYLAARGETEKLVELLLEGY-DHILDA-EDDGVNIIDVAAQRQHEATVQFLQSIPNYVNQREEVHAAIRTIDEDRAKELLSKTN-GGGKLLAVGKNSIGRCALHIAVLREDEGLVKFIAKMYPETLRIGDNLERTALHYAMGV 1123          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Nematostella
Match: EDO45464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS0])

HSP 1 Score: 47.3654 bits (111), Expect = 4.783e-7
Identity = 22/42 (52.38%), Postives = 29/42 (69.05%), Query Frame = 3
Query: 1155 DTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATN 1280
            D+EYLKK VG+AL    A +V KRP DPI++L  +L+ Y  N
Sbjct:    2 DSEYLKKHVGEALSLGLAEIVNKRPVDPIEYLAFWLRKYVEN 43          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Match: SMESG000078142.1 (SMESG000078142.1)

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 629/629 (100.00%), Postives = 629/629 (100.00%), Query Frame = 3
Query:  249 ENFCEFIIKTKNXXXXXXXXXXXXXXXXXSRDNHGNSLLHLAIQANCDVDIFKLILKVSNLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLEMAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEIFPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNFDTSDYEYEVLSSRISLELFPGLERKIIDKSFTFKPEIFSPFAKVARDKHGTLHGYXXXXXXXXSIDVSEVDWFEIIKRGLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSNKQFMEIVDEYYPEGKDEIDCFDYLPEYYEFYQSAFRDLK 2135
            ENFCEFIIKTKNIEEIKQKLEELDLLLLQSRDNHGNSLLHLAIQANCDVDIFKLILKVSNLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLEMAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEIFPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNFDTSDYEYEVLSSRISLELFPGLERKIIDKSFTFKPEIFSPFAKVARDKHGTLHGYKLLLKKLKSIDVSEVDWFEIIKRGLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSNKQFMEIVDEYYPEGKDEIDCFDYLPEYYEFYQSAFRDLK
Sbjct:    4 ENFCEFIIKTKNIEEIKQKLEELDLLLLQSRDNHGNSLLHLAIQANCDVDIFKLILKVSNLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCNCEGEYIRGLVIQGWECRPYLEMAIDKLMDQLNDNFIGFLSSIDSLIELFKTLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHDVVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLFNCVDDLGNSPEYYEIFPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKDSDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNFDTSDYEYEVLSSRISLELFPGLERKIIDKSFTFKPEIFSPFAKVARDKHGTLHGYKLLLKKLKSIDVSEVDWFEIIKRGLNFALRDSNENTLLELALSMGFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSNKQFMEIVDEYYPEGKDEIDCFDYLPEYYEFYQSAFRDLK 632          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 51.2174 bits (121), Expect = 3.423e-6
Identity = 48/196 (24.49%), Postives = 88/196 (44.90%), Query Frame = 3
Query: 1506 IIKRGLNFALRDSNENTLLELALSM----GFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVAD--FYTSLSDEQTNL-----------VTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSN-KQFMEIV 2039
            +++RG N A RD N+ T  +   S     G + +K  +D  +LNM+ E N  A++ L   GY      I ++CG      + E+A   +Y  L D   N+             +   N+   T +   ++ + LA+  + +  ++++ A+   ++ L   I D FP  +   DCF R   HY  +  + +Q + I+
Sbjct:  656 LLERGANVAARDINKLTPRDYCESKEVEHGSVLLKM-IDDHVLNMVYEENYDAIEELIIQGY----DHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKY---LSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSII 843          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.580e-6
Identity = 48/196 (24.49%), Postives = 88/196 (44.90%), Query Frame = 3
Query: 1506 IIKRGLNFALRDSNENTLLELALSM----GFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVAD--FYTSLSDEQTNL-----------VTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSN-KQFMEIV 2039
            +++RG N A RD N+ T  +   S     G + +K  +D  +LNM+ E N  A++ L   GY      I ++CG      + E+A   +Y  L D   N+             +   N+   T +   ++ + LA+  + +  ++++ A+   ++ L   I D FP  +   DCF R   HY  +  + +Q + I+
Sbjct:  664 LLERGANVAARDINKLTPRDYCESKEVEHGSVLLKM-IDDHVLNMVYEENYDAIEELIIQGY----DHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKY---LSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSII 851          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.632e-6
Identity = 48/196 (24.49%), Postives = 88/196 (44.90%), Query Frame = 3
Query: 1506 IIKRGLNFALRDSNENTLLELALSM----GFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVAD--FYTSLSDEQTNL-----------VTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSN-KQFMEIV 2039
            +++RG N A RD N+ T  +   S     G + +K  +D  +LNM+ E N  A++ L   GY      I ++CG      + E+A   +Y  L D   N+             +   N+   T +   ++ + LA+  + +  ++++ A+   ++ L   I D FP  +   DCF R   HY  +  + +Q + I+
Sbjct:  655 LLERGANVAARDINKLTPRDYCESKEVEHGSVLLKM-IDDHVLNMVYEENYDAIEELIIQGY----DHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKY---LSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSII 842          
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.847e-6
Identity = 48/196 (24.49%), Postives = 88/196 (44.90%), Query Frame = 3
Query: 1506 IIKRGLNFALRDSNENTLLELALSM----GFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVAD--FYTSLSDEQTNL-----------VTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSN-KQFMEIV 2039
            +++RG N A RD N+ T  +   S     G + +K  +D  +LNM+ E N  A++ L   GY      I ++CG      + E+A   +Y  L D   N+             +   N+   T +   ++ + LA+  + +  ++++ A+   ++ L   I D FP  +   DCF R   HY  +  + +Q + I+
Sbjct:  647 LLERGANVAARDINKLTPRDYCESKEVEHGSVLLKM-IDDHVLNMVYEENYDAIEELIIQGY----DHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKY---LSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSII 834          
The following BLAST results are available for this feature:
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG422841.047e-1024.90gene:FBgn0259179 transcript:FBtr0343179[more]
CG422842.381e-1024.90gene:FBgn0259179 transcript:FBtr0343178[more]
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4MQ962.468e-1126.47GK21459 OS=Drosophila willistoni OX=7260 GN=Dwil\G... [more]
A0A0C9RYC73.822e-1123.11Slc24a1 protein OS=Fopius arisanus OX=64838 GN=Slc... [more]
A0A5N4ADR46.734e-1124.47Uncharacterized protein OS=Photinus pyralis OX=705... [more]
B4JA283.235e-924.79GH19789 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
A0A4S2KPA05.407e-921.20Uncharacterized protein OS=Temnothorax longispinos... [more]
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO454644.783e-752.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078142.10.000e+0100.00SMESG000078142.1[more]
SMESG000033773.13.423e-624.49SMESG000033773.1[more]
SMESG000033773.13.580e-624.49SMESG000033773.1[more]
SMESG000033773.13.632e-624.49SMESG000033773.1[more]
SMESG000033773.13.847e-624.49SMESG000033773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018476 ID=SMED30018476|Name=Dpy-30 motif,Ankyrin repeat-containing domain,Ankyrin repeat|organism=Schmidtea mediterranea sexual|type=transcript|length=2214bp
TTAAGTTTTCTCAATTTAGGTTTTACATTTTTGATGGTTTAACACTCGCT
TTTAGAAACATTTTTTTCATGTTATTGTTTTTAATTTTGTTAACAAACCA
TGACCGCATCTTTGTTAAAAATATCTGTTCTAACTCCTAATTCATCAGGA
CATTGTTGAATGAACTCGAGAAAAATGTAACCATATGGTCCTAAATAAGT
AAAACATCTATTTTATTATTATAATTATTAATCTCGATTATGTCGTTGGA
AAATTTTTGCGAATTTATTATCAAAACTAAAAATATCGAGGAAATAAAAC
AGAAACTCGAGGAATTGGATTTATTACTTCTTCAAAGCCGAGATAACCAT
GGAAACTCGTTATTGCATTTAGCAATTCAAGCAAATTGTGACGTTGACAT
TTTCAAATTAATCCTCAAAGTCTCAAACTTATCGTTTCGGAATGATGAAT
TCAAATTACCGCAGGATTTATTTGTCAGTAGTGATAACAATCGATATGTG
AATGAGATTGTGAATTATTTAGTCGATAAGTTGTGCAATTGTGAAGGGGA
ATATATTCGTGGTTTAGTTATTCAAGGTTGGGAGTGTCGGCCATATTTGG
AAATGGCTATTGATAAACTGATGGACCAATTAAATGATAACTTTATCGGT
TTTTTGTCTTCTATTGATAGTCTAATAGAATTATTCAAAACGTTGATTGA
TAAAATTGTCGTCGATAATTTTGAAGAATTCAATAATGTTTTAACTTCGT
CTCAGACTCCAATGTATGATGTTATTCCCTTCCGTAACCAATGTGGATTG
ACGTTGCTTCATGTTGCTCTTATATTTGAAAGACATGATGTAGTTAAATT
ATTAATTCAGTTGAGTGAGGAAAATAAATCAAAAGCTACTGATCATCTTG
GAAGAACGATATTGCATTATTTATACGGATTTAAACCGAGTCCAGTTAGA
GATGAACTCATAGTAGAACTATCGACAAATTCATTATTTAACTGTGTGGA
TGATCTGGGAAATTCTCCGGAATATTATGAGATTTTCCCTGAACTTTTCA
ATTTGGATTATTGCATAGAATTTATCAAGTCGGATTTGATGAATCTTCAA
GTGATTAATCGTAAGGAAAATAGCGTAACAAATAAAGACTCTGATGCTGA
CAATGATACGGAATATTTGAAAAAGACCGTTGGCAAGGCATTAGTCAAAG
CTTTTGCATTAGTTGTAGAAAAACGACCGAATGACCCGATTGATTTTTTA
GGTCATTTTTTGAAATTTTATGCAACAAATTTCGATACCAGTGATTACGA
GTATGAGGTTTTGTCATCGAGGATAAGTCTAGAATTGTTTCCTGGTCTCG
AGCGGAAAATAATCGATAAATCGTTTACTTTCAAACCGGAAATATTTTCT
CCATTTGCAAAAGTAGCACGAGATAAACATGGCACACTTCACGGCTATAA
ATTACTATTGAAAAAATTGAAATCCATCGATGTTTCTGAAGTCGATTGGT
TTGAGATAATTAAACGGGGCTTAAATTTTGCTTTACGCGATAGCAACGAG
AACACTTTACTTGAACTTGCTTTATCTATGGGTTTTATCAGAATAAAGGA
CGATTTAGATTCGGTGATCTTGAATATGATTAATGAAGGAAATCTACAAG
CATTGAAAAACCTATTTAGCTGTGGATATTTTGAAAACTTTCCAGACATC
TATGAGCTTTGTGGTCCAGATTTATTTGATGTATCTCAGGAAGTCGCAGA
TTTCTATACAAGCTTATCCGACGAACAAACTAATCTCGTCACGATATTTA
GTGATAATTCATCAGCCGACACAAACTGGTGTAATATAATTACCAGTGAA
ATGCTTGCATATGCATATAATAAAAAAGGTATGTCAGTCATCAATTGGGC
CATAGCCTCAAATAACAACAATCTTTTTCATTATATTGTGGATTATTTTC
CGGATTCTTTGAAATTGAAAGACTGTTTTAATAGAAACGTCTATCATTAT
TGCTATGCATTTTCAAATAAGCAATTTATGGAAATTGTTGATGAATATTA
TCCAGAAGGGAAAGATGAAATAGATTGCTTCGATTACCTTCCTGAATATT
ATGAATTCTATCAAAGTGCTTTTCGAGATTTAAAATAATGAATTATATTT
TATAAACTGAGTAGTATTAGATATTTGTGAATCGTTGTTCATTCTGGCTA
TATAATTTTAAAAT
back to top

protein sequence of SMED30018476-orf-1

>SMED30018476-orf-1 ID=SMED30018476-orf-1|Name=SMED30018476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MSLENFCEFIIKTKNIEEIKQKLEELDLLLLQSRDNHGNSLLHLAIQANC
DVDIFKLILKVSNLSFRNDEFKLPQDLFVSSDNNRYVNEIVNYLVDKLCN
CEGEYIRGLVIQGWECRPYLEMAIDKLMDQLNDNFIGFLSSIDSLIELFK
TLIDKIVVDNFEEFNNVLTSSQTPMYDVIPFRNQCGLTLLHVALIFERHD
VVKLLIQLSEENKSKATDHLGRTILHYLYGFKPSPVRDELIVELSTNSLF
NCVDDLGNSPEYYEIFPELFNLDYCIEFIKSDLMNLQVINRKENSVTNKD
SDADNDTEYLKKTVGKALVKAFALVVEKRPNDPIDFLGHFLKFYATNFDT
SDYEYEVLSSRISLELFPGLERKIIDKSFTFKPEIFSPFAKVARDKHGTL
HGYKLLLKKLKSIDVSEVDWFEIIKRGLNFALRDSNENTLLELALSMGFI
RIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQ
EVADFYTSLSDEQTNLVTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSV
INWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSNKQFMEIV
DEYYPEGKDEIDCFDYLPEYYEFYQSAFRDLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR007858Dpy-30_motif
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 16..36
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 305..350
e-value: 1.2E-6
score: 30.0
NoneNo IPR availablePANTHERPTHR24172FAMILY NOT NAMEDcoord: 423..589
NoneNo IPR availablePANTHERPTHR24172FAMILY NOT NAMEDcoord: 26..231
NoneNo IPR availablePANTHERPTHR24172:SF5coord: 423..589
NoneNo IPR availablePANTHERPTHR24172:SF5coord: 26..231
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 546..575
e-value: 240.0
score: 9.6
coord: 37..68
e-value: 130.0
score: 11.4
coord: 185..215
e-value: 3.2
score: 16.7
IPR007858Dpy-30 motifPFAMPF05186Dpy-30coord: 307..341
e-value: 7.7E-8
score: 31.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 185..227
score: 8.694
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 423..603
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 10..265