2',3'-cyclic nucleotide 3'-phosphodiesterase

Overview
Name2',3'-cyclic nucleotide 3'-phosphodiesterase
Smed IDSMED30018465
Length (bp)2289
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 2',3'-cyclic nucleotide 3'-phosphodiesterase (SMED30018465) t-SNE clustered cells

Violin plots show distribution of expression levels for 2',3'-cyclic nucleotide 3'-phosphodiesterase (SMED30018465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 2',3'-cyclic nucleotide 3'-phosphodiesterase (SMED30018465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 2',3'-cyclic nucleotide 3'-phosphodiesterase (SMED30018465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018465SMESG000060338.1 dd_Smed_v4_2431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018465SMESG000060338.1 OX_Smed_1.0.12964ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Match: CNP (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:HGNC Symbol;Acc:HGNC:2158])

HSP 1 Score: 158.688 bits (400), Expect = 1.110e-41
Identity = 117/406 (28.82%), Postives = 190/406 (46.80%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ--SDGTFKYDRSKYNE-AENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +L  + +FILRG  GSGKST+   + DK+ +   + S+D Y +   + G F  +  + +E    +C+ +  + L      V+ D  H R  + +   +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K DL+ ++ +     LH TTKFC YG A  AE Y +   +++S  + F + I    +T KT    ++L+  +Q+QLW  D                        + KL+    +  P G RAH+TL      + VQ+GLD LEI+  +     G+ V  +  G +   G GR+ L L   +  + +FTG Y
Sbjct:   12 LQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRIL------VLDDTNHERE-RLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS-EQQLQLWPSD------------------------VDKLSPTDNL--PRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYY 378          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Match: CNP (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:HGNC Symbol;Acc:HGNC:2158])

HSP 1 Score: 158.303 bits (399), Expect = 2.031e-41
Identity = 117/406 (28.82%), Postives = 190/406 (46.80%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ--SDGTFKYDRSKYNE-AENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +L  + +FILRG  GSGKST+   + DK+ +   + S+D Y +   + G F  +  + +E    +C+ +  + L      V+ D  H R  + +   +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K DL+ ++ +     LH TTKFC YG A  AE Y +   +++S  + F + I    +T KT    ++L+  +Q+QLW  D                        + KL+    +  P G RAH+TL      + VQ+GLD LEI+  +     G+ V  +  G +   G GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRIL------VLDDTNHERE-RLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS-EQQLQLWPSD------------------------VDKLSPTDNL--PRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYY 398          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Match: N4BP2L1 (NEDD4 binding protein 2 like 1 [Source:HGNC Symbol;Acc:HGNC:25037])

HSP 1 Score: 89.3521 bits (220), Expect = 4.972e-20
Identity = 40/123 (32.52%), Postives = 76/123 (61.79%), Query Frame = 3
Query:  507 VFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPI 875
            +++LRG  GSGK+T+   L+  F  A++ S+D +F + DG ++++     EA  W Q +  +A+ +G SP+IIDN ++ +W+ K    ++++ +Y V+   P T W+F+V++L  +   S+ I
Sbjct:   22 LYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARQIVSSKWI 144          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Match: N4BP2L1 (NEDD4 binding protein 2 like 1 [Source:HGNC Symbol;Acc:HGNC:25037])

HSP 1 Score: 88.5817 bits (218), Expect = 7.114e-20
Identity = 38/117 (32.48%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  507 VFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKS 857
            +++LRG  GSGK+T+   L+  F  A++ S+D +F + DG ++++     EA  W Q +  +A+ +G SP+IIDN ++ +W+ K    ++++ +Y V+   P T W+F+V++L  ++
Sbjct:   22 LYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRN 138          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Match: N4BP2L1 (NEDD4 binding protein 2 like 1 [Source:HGNC Symbol;Acc:HGNC:25037])

HSP 1 Score: 89.7373 bits (221), Expect = 2.463e-19
Identity = 40/140 (28.57%), Postives = 81/140 (57.86%), Query Frame = 3
Query:  507 VFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLY 926
            +++LRG  GSGK+T+   L+  F  A++ S+D +F + DG ++++     EA  W Q +  +A+ +G SP+IIDN ++ +W+ K    ++++ +Y V+   P T W+F+V++L  ++       +I +    +E  +  +
Sbjct:   44 LYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFH 183          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Celegans
Match: F26A1.13 (pep chromosome:WBcel235:III:4847009:4849907:-1 gene:WBGene00017811.1 transcript:F26A1.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F26A1.13)

HSP 1 Score: 49.6766 bits (117), Expect = 8.278e-6
Identity = 31/145 (21.38%), Postives = 62/145 (42.76%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGW 935
            R + ++RG +GSGKST+   L +   N V+                     N+  N     + + ++  K  +++D  +++    K   ++++   Y + ++ P T WR D  +  ++S K E I  I+  I + +       GW
Sbjct:   28 RTIILIRGVTGSGKSTLARELVNHSENGVIVK-------------------NDVSNNITRSVRKFIDEDKHLIVVDEENVQRSSVKKFAELAVNGHYEIFVLEPDTDWRHDAIECKKRSEKDEEIGSIESKIMQLKEN---QLGW 150          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Fly
Match: CG7139 (gene:FBgn0027532 transcript:FBtr0078486)

HSP 1 Score: 75.485 bits (184), Expect = 1.240e-13
Identity = 43/143 (30.07%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKF-------VNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +++ I+RGPSGSGKST+ E L  +        V   V SSD YF    G + ++ +    A  W Q ++     SG SP+I+DN +   W+ +  V  +++  Y++ ++ P T W     +L +K+  + P   I + +  FE
Sbjct:  103 KLMIIMRGPSGSGKSTLAESLLRQAHLLDRHQVRDFVLSSDDYFKTRRG-YVFNPTLLPAAHEWNQQRVRDKAASGWSPIIVDNTNTMVWEMQPYVQFAVRHGYVIELLEPNTSWCKSASKLAQKNVHNVPRENIQRMLERFE 244          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Match: cnp (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:ZFIN;Acc:ZDB-GENE-030521-29])

HSP 1 Score: 100.908 bits (250), Expect = 4.321e-22
Identity = 74/240 (30.83%), Postives = 117/240 (48.75%), Query Frame = 3
Query:  915 IPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADL---LDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWA-GDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFT 1622
            +PL++GWFL   + + I     D L+ L  +   +  ++      EF S+A+    L+ +      LH TTKFC YG A  A+ Y +   V+E+ G+   + +   ++T +TF   + L    Q+ LW  G+D         K G  PT L    G+  L        P G RAH+TL  + G + VQ+GLD LEI+ +Q + + G  V  ++ G++    +GR+YL L   I   T F+
Sbjct:  206 LPLFYGWFLLKEEEERIKCATMDFLKTLDTLEAFKEHIS------EFTSEANKEVDLEQYFQNPLPLHCTTKFCDYGKAEGAKEYAELQVVKEATGKSEELSVTALIVTPRTFGARVALTE-TQLNLWPEGED---------KVGVAPTLLP---GVESL--------PAGSRAHVTLGCSAGVEAVQTGLDLLEILVLQKEGKEGTQVE-MDMGTLSYLSEGRWYLALREAITADTTFS 417          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Match: cnp (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:ZFIN;Acc:ZDB-GENE-030521-29])

HSP 1 Score: 100.523 bits (249), Expect = 4.619e-22
Identity = 74/240 (30.83%), Postives = 117/240 (48.75%), Query Frame = 3
Query:  915 IPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADL---LDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWA-GDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFT 1622
            +PL++GWFL   + + I     D L+ L  +   +  ++      EF S+A+    L+ +      LH TTKFC YG A  A+ Y +   V+E+ G+   + +   ++T +TF   + L    Q+ LW  G+D         K G  PT L    G+  L        P G RAH+TL  + G + VQ+GLD LEI+ +Q + + G  V  ++ G++    +GR+YL L   I   T F+
Sbjct:  187 LPLFYGWFLLKEEEERIKCATMDFLKTLDTLEAFKEHIS------EFTSEANKEVDLEQYFQNPLPLHCTTKFCDYGKAEGAKEYAELQVVKEATGKSEELSVTALIVTPRTFGARVALTE-TQLNLWPEGED---------KVGVAPTLLP---GVESL--------PAGSRAHVTLGCSAGVEAVQTGLDLLEILVLQKEGKEGTQVE-MDMGTLSYLSEGRWYLALREAITADTTFS 398          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Match: n4bp2l2 (NEDD4 binding protein 2-like 2 [Source:ZFIN;Acc:ZDB-GENE-131121-433])

HSP 1 Score: 93.5893 bits (231), Expect = 1.268e-19
Identity = 50/135 (37.04%), Postives = 79/135 (58.52%), Query Frame = 3
Query:  504 IVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            ++ +LRG  GSGKST+   L     N VV S+D YF Q D  + +D +   +A +W Q +  QA+  G SPVIIDN ++++W+ K  V+++++  Y V  + P TPW+ D  QL +++    P   I K ++ FE
Sbjct:  296 VLVLLRGVPGSGKSTLARELLSTGPNGVVLSTDDYFFQ-DNRYAFDSALLGDAHDWNQKRAEQAMLDGCSPVIIDNTNVKAWEMKPYVELALENGYRVDFLEPDTPWKCDPAQLEKRNKHGVPRDTIAKMLDGFE 429          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Match: n4bp2 (NEDD4 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-061103-451])

HSP 1 Score: 78.1814 bits (191), Expect = 2.664e-14
Identity = 41/127 (32.28%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  483 KWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTK 863
            +  L  +++ +LRG  GSGK+T+   +  +    VV S+D YF++ +G + ++ +   EA  W   +   A E G+SP+IIDN + + W+ K  V ++ K  Y V+   P T W+    +L EK T+
Sbjct:  372 RLKLEGQVLVLLRGAPGSGKTTLANAMLAQNPGGVVLSTDEYFMR-NGHYYFEPNLLGEAHEWNHQRAKDAFEKGRSPIIIDNTNTQCWEMKPYVAMAQKHRYKVLFREPDTWWKTKPREL-EKRTR 496          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Match: n4bp2 (NEDD4 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-061103-451])

HSP 1 Score: 78.1814 bits (191), Expect = 2.749e-14
Identity = 41/127 (32.28%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  483 KWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTK 863
            +  L  +++ +LRG  GSGK+T+   +  +    VV S+D YF++ +G + ++ +   EA  W   +   A E G+SP+IIDN + + W+ K  V ++ K  Y V+   P T W+    +L EK T+
Sbjct:  372 RLKLEGQVLVLLRGAPGSGKTTLANAMLAQNPGGVVLSTDEYFMR-NGHYYFEPNLLGEAHEWNHQRAKDAFEKGRSPIIIDNTNTQCWEMKPYVAMAQKHRYKVLFREPDTWWKTKPREL-EKRTR 496          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Match: pcmtd1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 [Source:Xenbase;Acc:XB-GENE-5750991])

HSP 1 Score: 153.68 bits (387), Expect = 1.725e-39
Identity = 115/400 (28.75%), Postives = 192/400 (48.00%), Query Frame = 3
Query:  456 PFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ------SDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAI-PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            P L     +  +  S+I+ +LRG  GSGKS + + ++ K+ ++  + S+D Y ++      S G +     K +E  N C  + ++A     + VI+D+ H    + +   D++ KF + V+++ PKTPWR D  QL +++     + E+       E  I PLYFGWFL  RD DN+ + A + LE L N+   +  L A     E   K DLL ++    + LH TTKFC +G    +E Y +  AV+++  + F +HI    +T +T    I+L   +Q+ LW  D ++++          P  +                 P G RAH+TL      + VQ+G+D LE + +Q     G+ +  +  G I  +  G + L L      +T+F+G Y
Sbjct:   73 PLLVDDHTVTTVRESKILVLLRGLPGSGKSELAKEVEQKYKDSSRLFSADQYNIRPAIRSASGGEY----VKLDEDLNSCCER-HEA-----NMVIVDDTHHDRERLEELFDLANKFQFTVIVLEPKTPWRLDCAQLKDRNHWKLSLEELKNLRPTLEKDILPLYFGWFLAKRDEDNLRKTAHEFLEQLGNLKAFKKRLQAFG--VEDKHKLDLLKYFAKTPNILHCTTKFCDFGKVPGSEEYAQLEAVRKNYSRGFTLHISALFVTPRTAGAQIELT-QEQLHLWPSDAEKEVM---------PKDIL----------------PRGSRAHITLGCASDIQDVQTGIDLLEFVKLQQAGREGENMGELLGGKISYYDNGMWMLALPRKKEVKTIFSGYY 434          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Match: ttbk2 (tau tubulin kinase 2 [Source:Xenbase;Acc:XB-GENE-493335])

HSP 1 Score: 100.138 bits (248), Expect = 3.526e-23
Identity = 57/176 (32.39%), Postives = 97/176 (55.11%), Query Frame = 3
Query:  498 SRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPA------IPLYFGWFLNDRDSDNILQFATDTLELLINI 1007
            S+ +++LRG  GSGKS++   LK  F +A+V S+D YF+  DGT+ +D     EA  W Q +  +A+  GK+P+IIDN +I++W+ K    ++++  Y V+ + P T W+F+V +L      S   W    S N+   A      + L+  +F++ +    ++ F  DT E  + I
Sbjct:   51 SKHIYLLRGLPGSGKSSLARKLKQDFPSALVFSTDEYFLMDDGTYLFDHEMLPEAHKWNQKRARKAMSKGKTPIIIDNTNIQAWEMKPYAVMALENQYQVIFLEPSTRWKFNVAELARYVVMS---WCGHMSYNQASRAATEQLWLLLHLPFFMSYQGCCVVIAFLHDTQEWALLI 223          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Match: nadsyn1 (NAD synthetase 1 [Source:Xenbase;Acc:XB-GENE-971835])

HSP 1 Score: 90.1225 bits (222), Expect = 5.741e-18
Identity = 48/136 (35.29%), Postives = 78/136 (57.35%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            R + +LRG  GSGK+T+   L +   N  V S+D YF Q DG + YD     +A NW Q +  +A++ G+SP+IIDN +I+ W+ K  V ++++  Y V  V P   W+ D  +L +++T   P  +I + +  +E
Sbjct:  540 RKLVLLRGLPGSGKTTLARFLLNLNPNGFVFSTDDYFCQKDG-YTYDVKLLGDAHNWNQCRARRAMDDGRSPIIIDNTNIQGWEMKPYVQMAIERGYFVDFVEPDNWWKLDPLELAKRNTHRVPQEKISQMLERYE 674          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Match: N4BP2 (NEDD4 binding protein 2 [Source:NCBI gene;Acc:100493484])

HSP 1 Score: 74.7146 bits (182), Expect = 5.104e-13
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +++ +LRG  GSGK+T+   L  +    +  S+D YF +  G ++YD +   EA  W   +  +A E   SP+IIDN ++++W+ K     +MK  Y V    P T W++  ++L  +++      +I + +  FE
Sbjct:  340 KVLILLRGAPGSGKTTLARMLLQQNPLGINLSTDEYFYKK-GQYRYDVNLLGEAHEWNHKRAKEAFEKNISPIIIDNTNLQAWEMK---PYAMKHKYKVTFREPDTWWKYKPKELERRNSHGVTKEKIKRMLENFE 471          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Match: N4BP2 (NEDD4 binding protein 2 [Source:NCBI gene;Acc:100493484])

HSP 1 Score: 74.7146 bits (182), Expect = 5.405e-13
Identity = 40/136 (29.41%), Postives = 72/136 (52.94%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +++ +LRG  GSGK+T+   L  +    +  S+D YF +  G ++YD +   EA  W   +  +A E   SP+IIDN ++++W+ K     +MK  Y V    P T W++  ++L  +++      +I + +  FE
Sbjct:  340 KVLILLRGAPGSGKTTLARMLLQQNPLGINLSTDEYFYKK-GQYRYDVNLLGEAHEWNHKRAKEAFEKNISPIIIDNTNLQAWEMK---PYAMKHKYKVTFREPDTWWKYKPKELERRNSHGVTKEKIKRMLENFE 471          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Match: Cnp (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:MGI Symbol;Acc:MGI:88437])

HSP 1 Score: 153.295 bits (386), Expect = 8.056e-40
Identity = 117/407 (28.75%), Postives = 187/407 (45.95%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFV----QSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +   + +FILRG  GSGKST+   + +K+ +   + S+D Y +    ++D +  Y R   + A  +C+  I       +  V+ D  H R  +     +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K +L+ ++ +     LH TTKFC YG A  AE Y +   V+ S G+ F + I    +T KT    + L   +++QLW                  P+ L K +    L        P G RAH+TL      +PVQ+GLD L+I+        G+ V  +  G +   G+GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLHECKTLFILRGLPGSGKSTLARLILEKYHDGTKMVSADAYKIIPGSRADFSEAYKRLDEDLA-GYCRRDI-------RVLVLDDTNHERE-RLDQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRHFISGDEPKEKLELVSYFGKRPPGVLHCTTKFCDYGKAAGAEEYAQQEVVKRSYGKAFKLSISALFVTPKTAGAQVVLTD-QELQLW------------------PSDLDKPSASEGL--------PPGSRAHVTLGCAADVQPVQTGLDLLDILQQVKGGSQGEAVGELPRGKLYSLGKGRWMLSLTKKMEVKAIFTGYY 397          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Match: N4bp2l1 (NEDD4 binding protein 2-like 1 [Source:MGI Symbol;Acc:MGI:2140872])

HSP 1 Score: 94.3597 bits (233), Expect = 4.137e-21
Identity = 41/140 (29.29%), Postives = 84/140 (60.00%), Query Frame = 3
Query:  507 VFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLY 926
            +++LRG  GSGK+T+   L+  +  A++ S+D +F + DGT++++ +   EA  W Q +  +A+ +G SP+IIDN ++ +W+ K    ++++ +Y V+   P T W+F+V++L  ++    P  +I +    +E  +  +
Sbjct:   42 LYLLRGLPGSGKTTLARQLQHDYPRALIFSTDDFFFKEDGTYEFNPNLLEEAHEWNQRRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVPKEKIQRMKERYEHNVTFH 181          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Match: N4bp2l2 (NEDD4 binding protein 2-like 2 [Source:MGI Symbol;Acc:MGI:2687207])

HSP 1 Score: 90.1225 bits (222), Expect = 2.893e-18
Identity = 45/136 (33.09%), Postives = 85/136 (62.50%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +++ +LRG  GSGK+T+   L  +  + +V S+D YF   DG ++Y+ ++  +A +W QN+  QA++ G+SPVIIDN + ++W+ K  V++++   Y V    P+T W+FD E+L +++       +I + ++ +E
Sbjct:  394 KLLILLRGLPGSGKTTLSRILLGQSRDGIVFSTDDYFHHQDG-YRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNTQAWEMKPYVEMAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYE 528          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Match: N4bp2 (NEDD4 binding protein 2 [Source:MGI Symbol;Acc:MGI:2684414])

HSP 1 Score: 74.7146 bits (182), Expect = 3.479e-13
Identity = 39/109 (35.78%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  531 GSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKS 857
            GSGKS +   L++     V+ S+D YF   +G +++D     EA  W QN+  +A E   SPVIIDN ++++W+ K  V +S K  Y V+   P T W+F  ++L  ++
Sbjct:  373 GSGKSFLARTLQEDNPGGVILSTDDYFY-INGQYQFDVKYLGEAHEWNQNRAKEAFEKKVSPVIIDNTNLQAWEMKPYVALSQKHKYKVLFREPDTWWKFKPKELARRN 480          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Match: N4bp2 (NEDD4 binding protein 2 [Source:MGI Symbol;Acc:MGI:2684414])

HSP 1 Score: 74.7146 bits (182), Expect = 3.892e-13
Identity = 39/109 (35.78%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  531 GSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKS 857
            GSGKS +   L++     V+ S+D YF   +G +++D     EA  W QN+  +A E   SPVIIDN ++++W+ K  V +S K  Y V+   P T W+F  ++L  ++
Sbjct:  373 GSGKSFLARTLQEDNPGGVILSTDDYFY-INGQYQFDVKYLGEAHEWNQNRAKEAFEKKVSPVIIDNTNLQAWEMKPYVALSQKHKYKVLFREPDTWWKFKPKELARRN 480          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Match: sp|P13233|CN37_RAT (2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Cnp PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 2.798e-41
Identity = 121/407 (29.73%), Postives = 189/407 (46.44%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFV----QSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEID-KSINEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +   + +FILRG  GSGKST+   + +K+ N   + S+D Y +    ++D + +Y R   + A  +C+  I       +  V+ D  H R  +     +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K DL+ ++ +     LH TTKFC YG AT AE Y +   V+ S G+ F + I    +T KT    + L   +++QLW                  P+ L K +    L        P G RAH+TL      +PVQ+GLD LEI+        G+ V  +  G +   G+GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLHECKTLFILRGLPGSGKSTLARLIVEKYHNGTKMVSADAYKIIPGSRADFSEEYKRLDEDLA-GYCRRDI-------RVLVLDDTNHERE-RLDQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSLDDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRHFISGDEPKEKLDLVSYFGKRPPGVLHCTTKFCDYGKATGAEEYAQQDVVRRSYGKAFKLSISALFVTPKTAGAQVVL-NEQELQLW------------------PSDLDKPSSSESL--------PPGSRAHVTLGCAADVQPVQTGLDLLEILQQVKGGSQGEEVGELPRGKLYSLGKGRWMLSLAKKMEVKAIFTGYY 397          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Match: sp|P09543|CN37_HUMAN (2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 9.754e-41
Identity = 117/406 (28.82%), Postives = 190/406 (46.80%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ--SDGTFKYDRSKYNE-AENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +L  + +FILRG  GSGKST+   + DK+ +   + S+D Y +   + G F  +  + +E    +C+ +  + L      V+ D  H R  + +   +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K DL+ ++ +     LH TTKFC YG A  AE Y +   +++S  + F + I    +T KT    ++L+  +Q+QLW  D                        + KL+    +  P G RAH+TL      + VQ+GLD LEI+  +     G+ V  +  G +   G GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRIL------VLDDTNHERE-RLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS-EQQLQLWPSD------------------------VDKLSPTDNL--PRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYY 398          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Match: sp|P16330|CN37_MOUSE (2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3)

HSP 1 Score: 153.295 bits (386), Expect = 5.635e-39
Identity = 117/407 (28.75%), Postives = 187/407 (45.95%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFV----QSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +   + +FILRG  GSGKST+   + +K+ +   + S+D Y +    ++D +  Y R   + A  +C+  I       +  V+ D  H R  +     +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K +L+ ++ +     LH TTKFC YG A  AE Y +   V+ S G+ F + I    +T KT    + L   +++QLW                  P+ L K +    L        P G RAH+TL      +PVQ+GLD L+I+        G+ V  +  G +   G+GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLHECKTLFILRGLPGSGKSTLARLILEKYHDGTKMVSADAYKIIPGSRADFSEAYKRLDEDLA-GYCRRDI-------RVLVLDDTNHERE-RLDQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRHFISGDEPKEKLELVSYFGKRPPGVLHCTTKFCDYGKAAGAEEYAQQEVVKRSYGKAFKLSISALFVTPKTAGAQVVLTD-QELQLW------------------PSDLDKPSASEGL--------PPGSRAHVTLGCAADVQPVQTGLDLLDILQQVKGGSQGEAVGELPRGKLYSLGKGRWMLSLTKKMEVKAIFTGYY 397          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q5RFD0|CN37_PONAB (2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Pongo abelii OX=9601 GN=CNP PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 5.800e-39
Identity = 115/406 (28.33%), Postives = 188/406 (46.31%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ--SDGTFKYDRSKYNE-AENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +   + +FILRG  GSGKST+   + DK+ +   + S+D Y +   + G F  +  + +E    +C+ +  + L      V+ D  H R  + +   +++ ++ Y V++V PKT WR    QL EK+      W++    + + +P +     PLYFGWFL  + S+ + +     LE L N    +  L       E   K DL+ ++ +     LH TTKFC YG A  AE Y +   +++S  + F + I    +T KT    ++L+  +Q+QLW  D                        + KL+    +  P G RAH+TL      + VQ+GLD LEI+  +     G+ V  +  G +   G GR+ L L   +  + +FTG Y
Sbjct:   32 LQFPFLQDEDTVATLQECKTLFILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRIL------VLDDTNHERE-RLEQLFEMADQYQYQVVLVEPKTAWRLGCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFIPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS-EQQLQLWPSD------------------------VDKLSPTDNL--PRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYY 398          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Match: sp|P06623|CN37_BOVIN (2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Bos taurus OX=9913 GN=CNP PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 6.370e-39
Identity = 114/405 (28.15%), Postives = 188/405 (46.42%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAV-VCSSDHYFVQ--SDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKS-INEFEPAI-----PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHW-RMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + FPFL     +  +   + +FILRG  GSGKST+   + DK+ +   + S+D Y +   + G+F  +  + +E    C  + ++ L      V+ D  H R  + +   +++ ++ Y V++V PKT WR D  QL EK+      W++    + + +P +     PLYFGWFL  + S  + +     LE L N    +  L       E   K +L+ ++ +     LH TTKFC YG A  AE Y +   V++S  + F + I    +T KT    ++L+  +Q+ LW  +D + +S + N                          P G RAH+TL      + VQ+G+D LEI+  +     G+ V  +  G +   G GR+ L L   +  + +FTG Y
Sbjct:   12 LQFPFLQDEETVATLQECKTLFILRGLPGSGKSTLARFIVDKYRDGTKMVSADSYKITPGARGSFSEEYKQLDEDLAACCRRDFRVL------VLDDTNHERE-RLEQLFELADQYQYQVVLVEPKTAWRLDCAQLKEKNQ-----WQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSAALWKTGQTFLEELGNHKAFKKELRHFVSGDEPREKIELVTYFGKRPPGVLHCTTKFCDYGKAAGAEEYAQQDVVKKSYCKAFTLTISALFVTPKTTGARVELS-EQQLALWP-NDVDKLSPSDN-------------------------LPRGSRAHITLGCAGDVEAVQTGIDLLEIVRQEKGGSRGEEVGELSRGKLYSLGSGRWMLSLAKKMEVRAIFTGYY 377          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Match: A0A4V3SGI8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002044 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 4.704e-80
Identity = 148/454 (32.60%), Postives = 241/454 (53.08%), Query Frame = 3
Query:  336 HQPINMESSVTNFSYKQNTIDSNFGSIR-PVDNQ--LYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHY-FVQSDGT-FKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSD--------------------------NILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWR----------MKTDRL----HVTTKFCAYGTATDAESYLKSGAVQES-LGQLFPIHIKGFLLTTKTFSGHIQLAGPKQI--QLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSI 1553
            H P ++  +V+      N      G  R PV     + ++V+FPFLT+  + +W++++R +FILRGP GSGKS I EC++ +F + VVCS+D + +++S G  +++D S+  EA  WCQ + Y A ESG SP++IDN ++R+W+ +Y  D++ +F+Y V++V+P+TPWRFD + L  ++     +  I+  +  FE   PLY+GW    + S+                           +L +A ++   ++ +P++R+ LA+A  L +     D+L HW           +K  R     H+T K+  +G A  A+ Y  SGAV ES LG+LF + + G   + +T    I+L     +   LWA DDQ  +S+   ++   P  +           V+Q  RP GCRAH+TL        V++GLD L I+D +L    G+ VA+V  GS+
Sbjct:   46 HIPHSLSPTVSAVPVSPNASAPELGYQRVPVQESKVITKYVNFPFLTNDEIARWIVNTRFMFILRGPPGSGKSYIAECIRLRFPSTVVCSADEFWYLESSGAEYQFDISRVAEAHQWCQGKAYDAAESGVSPLVIDNTNVRAWETRYYTDLAKRFEYAVIMVIPQTPWRFDTDALAMRNVHFVGLHAIEAKVRNFEHVFPLYYGWLWPGKSSNCGKRRNESSSGSDLTKANSWPLEETQELLNWAWNSFITIVGLPDVRVHLASALGLSDTAPITDVLRHWHSATLPTFGVGLKVSRAASVPHITAKYARFGRAAGAQQYALSGAVTESLLGRLFTVQVTGLFFSLRTVGVRIRLPADDLVLRHLWASDDQAVLSTDRTEFADLPDIMMNS------EHVEQTHRPLGCRAHVTLALASDVSAVETGLDLLRIVDSELARRPGEHVAIVPGGSV 493          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Match: A0A1S8X683 (2',3'-cyclic nucleotide 3'-phosphodiesterase OS=Opisthorchis viverrini OX=6198 GN=X801_01840 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 5.386e-80
Identity = 150/454 (33.04%), Postives = 241/454 (53.08%), Query Frame = 3
Query:  336 HQPINMESSVTNFSYKQNTIDSNFGSIR-PVDNQ--LYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHY-FVQSDGT-FKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSD--------------------------NILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWR----------MKTDRL----HVTTKFCAYGTATDAESYLKSGAVQES-LGQLFPIHIKGFLLTTKTFSGHIQLAGPKQI--QLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSI 1553
            H P ++  +V       NT        R PV     + ++V+FPFLT+  + +W++S+R +FILRGP GSGKS I EC++ +F + VVCS+D + +++S+G  +++D S+  EA  WCQ + Y A ESG SP++IDN ++R+W+ +Y  D++ +F+Y V++V+P+TPWRFD + L  ++     +  I+  +  FE   PLY+GW    + S                            +L +A ++L  ++ +P++R+ LA+A  L +     D+L HW           +K  R     H+T K+  +G A  A+ Y  SGAV ES LG+LF + + G   + +T    I+L     +   LWA DDQ  +S+   ++   P  +           V+Q  RP GCRAH+TL        V++GLD L I+D +L    G+ VA+V  GS+
Sbjct:   46 HIPHSLSPTVPAVPDSPNTSAPELSYQRVPVQESKVITKYVNFPFLTNDEIARWIVSTRFMFILRGPPGSGKSYIAECIRLRFPSTVVCSADEFWYLESNGAEYQFDISRIAEAHQWCQGKAYDAAESGVSPLVIDNTNVRAWETRYYTDLAKRFEYAVIMVIPQTPWRFDTDALAMRNVHFVGLHAIEAKVRNFEHVFPLYYGWLWPGKSSSCGKRRNGSSAASDLTKANSWPLEETQELLNWAWNSLITIVGLPDVRVHLASALGLSDTAPITDVLRHWHSATLPAFGVGLKASRAASVPHITAKYARFGRAAGAQQYALSGAVTESLLGRLFTVQVTGLFFSLRTVGVRIRLPADDLVLRHLWASDDQAVLSTDRTEFADLPDIMMNS------EHVEQTNRPLGCRAHVTLALASDVSAVETGLDLLRIVDSELARRPGEHVAIVPGGSV 493          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Match: A0A075A175 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04033 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 5.916e-80
Identity = 150/454 (33.04%), Postives = 241/454 (53.08%), Query Frame = 3
Query:  336 HQPINMESSVTNFSYKQNTIDSNFGSIR-PVDNQ--LYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHY-FVQSDGT-FKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSD--------------------------NILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWR----------MKTDRL----HVTTKFCAYGTATDAESYLKSGAVQES-LGQLFPIHIKGFLLTTKTFSGHIQLAGPKQI--QLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSI 1553
            H P ++  +V       NT        R PV     + ++V+FPFLT+  + +W++S+R +FILRGP GSGKS I EC++ +F + VVCS+D + +++S+G  +++D S+  EA  WCQ + Y A ESG SP++IDN ++R+W+ +Y  D++ +F+Y V++V+P+TPWRFD + L  ++     +  I+  +  FE   PLY+GW    + S                            +L +A ++L  ++ +P++R+ LA+A  L +     D+L HW           +K  R     H+T K+  +G A  A+ Y  SGAV ES LG+LF + + G   + +T    I+L     +   LWA DDQ  +S+   ++   P  +           V+Q  RP GCRAH+TL        V++GLD L I+D +L    G+ VA+V  GS+
Sbjct:   46 HIPHSLSPTVPAVPDSPNTSAPELSYQRVPVQESKVITKYVNFPFLTNDEIARWIVSTRFMFILRGPPGSGKSYIAECIRLRFPSTVVCSADEFWYLESNGAEYQFDISRIAEAHQWCQGKAYDAAESGVSPLVIDNTNVRAWETRYYTDLAKRFEYAVIMVIPQTPWRFDTDALAMRNVHFVGLHAIEAKVRNFEHVFPLYYGWLWPGKSSSCGKRRNGSSAASDLTKANSWPLEETQELLNWAWNSLITIVGLPDVRVHLASALGLSDTAPITDVLRHWHSATLPAFGVGLKASRAASVPHITAKYARFGRAAGAQQYALSGAVTESLLGRLFTVQVTGLFFSLRTVGVRIRLPADDLVLRHLWASDDQAVLSTDRTEFADLPDIMMNS------EHVEQTNRPLGCRAHVTLALASDVSAVETGLDLLRIVDSELARRPGEHVAIVPGGSV 493          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Match: H2KS11 (2' 3'-cyclic-nucleotide 3'-phosphodiesterase OS=Clonorchis sinensis OX=79923 GN=Cnp PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 5.051e-79
Identity = 140/416 (33.65%), Postives = 228/416 (54.81%), Query Frame = 3
Query:  441 QFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHY-FVQSDGT-FKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSD--------------------------NILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWR----------MKTDRL----HVTTKFCAYGTATDAESYLKSGAVQES-LGQLFPIHIKGFLLTTKTFSGHIQLAGPKQI--QLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSI 1553
            ++V+FPFLT+  + +W++++R +FILRGP GSGKS I EC++ +F + VVCS+D + +++S+G  +++D S+  EA  WCQ + Y A ESG SP++IDN ++R+W+ +Y  D++ +F+Y V++V+P+TPWRFD + L  ++     +  I+  +  FE   PLY+GW    + S                            +L +A ++   ++ +P++R+ LA+A  L +     D+L HW           +KT R     H+T K+  +G A  A+ Y  SGAV ES LG+LF + + G   + +T    I+L     +   LWA DDQ  +S+   ++   P  +            +Q  RP GCRAH+TL        V++GLD L I+D +L    G+ VA+V  GS+
Sbjct:   84 KYVNFPFLTNDEIARWIVNTRFMFILRGPPGSGKSYIAECIRLRFPSTVVCSADEFWYLESNGAEYQFDISRIAEAHQWCQGKAYDAAESGVSPLVIDNTNVRAWETRYYTDLAKRFEYAVIMVIPQTPWRFDTDALAMRNVHFVGLHAIEAKVRNFEHVFPLYYGWLWPGKSSSCGKRRSGSSAGSDLTKANSWPLEETQELLNWAWNSFITIVGLPDVRVHLASALGLSDTAPITDVLRHWHSATLPTFGVGLKTSRAASVPHITAKYARFGRAAGAQQYALSGAVTESLLGRLFTVQVTGLFFSLRTVGVRIRLPADDLVLRHLWASDDQAALSTDRTEFADLPDIMMNS------EHAEQTHRPLGCRAHVTLALASDVSAVETGLDLLRIVDSELARRPGEHVAIVPGGSV 493          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Match: A0A4E0R0M6 (2' 3'-cyclic-nucleotide 3'-phosphodiesterase OS=Fasciola hepatica OX=6192 GN=D915_008019 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.522e-73
Identity = 140/413 (33.90%), Postives = 223/413 (54.00%), Query Frame = 3
Query:  435 LYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHY-FVQSDG-TFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWF------------LNDRDS---------DNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRL--------------HVTTKFCAYGTATDAESYLKSGAVQESL-GQLFPIHIKGFLLTTKTFSGHIQLAGPKQI--QLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSI 1553
            L Q+V+FPFLT+  +  W++ SR +F++RGP GSGKS I EC+K +F    +CS+D + +++S+G  +++D ++ +EA  WC  +   A ESG SP++IDN +IR+W+ ++  D++ +F Y V++V P+TPWRFD E L E++     +  I+  +  FE   PLY+GW             ++  DS           +LQ+A ++L  ++ +P++R+ LAAA  L +      LL HW   T+                H+T K+  YG A  A  Y +SGAV +SL GQL  + + G  ++ +T    I+L     I   LWAG+DQ  +S   + Y         ++G        Q  RP GCRAH+T+        V++G D L I+D +L  + G  VA++  GS+
Sbjct:   84 LRQYVNFPFLTNDELAIWIVKSRFMFLMRGPPGSGKSFIAECIKTRFPTTKICSADEFWYLESNGEVYQFDVNRLDEAHEWCHQRARAAAESGISPLVIDNTNIRAWESRFYTDLARRFHYTVIMVTPQTPWRFDTEALAERNVHFVGLEAIESKVRNFELVFPLYYGWLWPAERGNSLPESVSHGDSLGYDPLVQTTRLLQWAWESLVTVVGLPDVRVQLAAAFGLSDGTPSETLLQHWYSATEPCFGQGLQQSKAATIPHITAKYTRYGRAPGASQYGQSGAVTQSLMGQLSTVQVTGLFISVRTVGVRIRLPADDLILRHLWAGEDQAVLSVDRSAYDGNFNGFLGQSGYP-----HQEYRPPGCRAHVTMALAPDVSAVETGFDLLRIVDAELAYQMGDHVAIIPGGSV 491          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Cavefish
Match: cnp (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:NCBI gene;Acc:103043047])

HSP 1 Score: 103.99 bits (258), Expect = 2.900e-23
Identity = 72/243 (29.63%), Postives = 113/243 (46.50%), Query Frame = 3
Query:  906 EPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADL---LDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWA-GDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFT 1622
            EP IP +FGWFL     + I     D ++ L  +   +  L       EF  +A+    L+ +      LH TTKFC YG A  ++ Y +   V+++LG    + + G ++T +TF  H+ L   +Q+QLW  G D+E +                    A L  V+ +  P G RAH+TL      + VQ+G D L+I+  +   +    V  +E G++   G GR+YL L   + C T F+
Sbjct:  173 EPEIPEFFGWFLLSEVEERIKCSTMDFIKTLDTLEAFKTHLN------EFTGEAEKEVDLEQYFQNKGPLHCTTKFCDYGKAEGSKEYAEQQVVKDALGNSAELSVVGLMVTPRTFGAHVALTT-EQLQLWPEGADKEGVPE------------------ASLPSVEAL--PVGSRAHVTLGCAANVEAVQTGPDLLDILAQKKGGQEASTVEELELGTLSYLGGGRWYLTLREAVTCDTTFS 388          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Cavefish
Match: n4bp2 (NEDD4 binding protein 2 [Source:NCBI gene;Acc:103044526])

HSP 1 Score: 87.8113 bits (216), Expect = 3.053e-17
Identity = 45/129 (34.88%), Postives = 75/129 (58.14%), Query Frame = 3
Query:  477 VIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTK 863
            V + +L   ++ +LRG  GSGK+T+   + +     VV S+D YF + +GT+ Y+  +  EA +W   +  +A E G SP+IIDN +++ W+ K  V +++K  Y V+   P+T W+    +L EK TK
Sbjct:  343 VSRLILEGPVLVLLRGAPGSGKTTLASAMLEHNPGGVVLSTDEYFTR-NGTYHYNPDQLGEAHSWNHVRAKEAFEKGYSPIIIDNTNMQCWEMKPYVSLALKHKYRVLFREPETWWKTKPREL-EKRTK 469          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Cavefish
Match: n4bp2l2 (NEDD4-binding protein 2-like 2 [Source:NCBI gene;Acc:103036619])

HSP 1 Score: 81.2629 bits (199), Expect = 1.321e-15
Identity = 44/138 (31.88%), Postives = 78/138 (56.52%), Query Frame = 3
Query:  495 SSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +S ++ ++RG  G GKST+ + +     + ++ S+D YF Q D  F +D +    A +W Q +   A+   +SPVIIDN ++++W+ K  V ++++  Y V  V P T W+ D  +L +++T   P   I K ++ FE
Sbjct:  352 TSPVLILMRGLPGCGKSTLAKEILSCGPDGLILSTDDYFFQEDSYF-FDPTLLGNAHDWNQKRARDAMLDRRSPVIIDNTNVQAWEMKPYVTLALECGYRVDFVEPDTRWKCDPTELEKRNTHRVPRDTIAKMLDRFE 488          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Cavefish
Match: n4bp2l2 (NEDD4-binding protein 2-like 2 [Source:NCBI gene;Acc:103036619])

HSP 1 Score: 81.2629 bits (199), Expect = 1.321e-15
Identity = 44/138 (31.88%), Postives = 78/138 (56.52%), Query Frame = 3
Query:  495 SSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +S ++ ++RG  G GKST+ + +     + ++ S+D YF Q D  F +D +    A +W Q +   A+   +SPVIIDN ++++W+ K  V ++++  Y V  V P T W+ D  +L +++T   P   I K ++ FE
Sbjct:  352 TSPVLILMRGLPGCGKSTLAKEILSCGPDGLILSTDDYFFQEDSYF-FDPTLLGNAHDWNQKRARDAMLDRRSPVIIDNTNVQAWEMKPYVTLALECGYRVDFVEPDTRWKCDPTELEKRNTHRVPRDTIAKMLDRFE 488          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Sea Lamprey
Match: CNP (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:HGNC Symbol;Acc:HGNC:2158])

HSP 1 Score: 119.783 bits (299), Expect = 4.183e-30
Identity = 96/336 (28.57%), Postives = 146/336 (43.45%), Query Frame = 3
Query:  675 QNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPA-----IPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVS-------KADLLDHWRMKT-----DRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + +I +   +G   VI+D  +  +         +  F YL +IV P TPWR D   L   ++K+   W + ++I    P+     +PLYFGWFL       + + +   L  +  I E       A +   F+        K DL  ++R        + LH T  FCA G    +E Y  S AVQES G  F + +   L+T +T    +QL+   Q+ LW   D  D SS    + + P                    P G RAH++L    G +PVQ+G+D L+I+      E    ++V   G +  +G GR+ + LN   +  TLFTG Y
Sbjct:    3 RQKIRKKCAAGVDAVIVDGTNHVAMSVLRLGATARSFGYLTLIVCPTTPWRDDCCTL---ASKTHWGWGV-QAIEALRPSLQEALVPLYFGWFLTKGSVQTMCKISDTFLLKIAAISEF------ASEFQPFMKWQNEQDQKMDLGAYFRRSMFVGGPNVLHCTAMFCANGEVPGSEEYATSQAVQESCGHAFVLQVTALLVTPRTVGARVQLSA-AQMALW---DPNDCSS----HCTVPN------------------LPRGSRAHISLGCAPGVEPVQTGVDLLDILKCSTNPEKRIKLSV---GELCCYGAGRWIVNLNKGHLVTTLFTGAY 299          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009837.1 (pep scaffold:Pmarinus_7.0:GL476585:41524:64166:-1 gene:ENSPMAG00000008889.1 transcript:ENSPMAT00000009837.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 8.360e-22
Identity = 51/156 (32.69%), Postives = 92/156 (58.97%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQA---LESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEP--AIPLYFGWFLNDRD 953
            +++F+LRG  GSGKST+   +K++  N V+ S+D YFV+ +GT+ YD S   EA  W   ++ +A   +++G SP+IIDN +  SW+ +  V ++++  Y ++   P+TPW+F   +L +++       +I + +N +E    +    G F + RD
Sbjct:    2 KVLFLLRGLPGSGKSTLARNIKEQGPNGVILSTDDYFVK-NGTYCYDPSVLGEAHEWNHKRVREARDAMDAGMSPIIIDNTNTHSWEMRPYVAMALQRKYKIVFKEPETPWKFKTRELEKRNVHGISREKIIRMLNNYERHMTVERIMGSFKSTRD 156          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008353.1 (pep scaffold:Pmarinus_7.0:GL476515:238409:242895:1 gene:ENSPMAG00000007557.1 transcript:ENSPMAT00000008353.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.859e-17
Identity = 36/86 (41.86%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYK 758
            +++F+LRGP GSGKST+   L  +  N VV S+D +F + +G ++Y+ S+   A  W   Q  +A++ GKSPVIIDN ++  W+ K
Sbjct:   43 KLLFLLRGPPGSGKSTLARELLSEGPNGVVLSTDQFFCR-NGRYEYNASQLEAAHTWNHQQAEKAMKLGKSPVIIDNTNLNFWEMK 127          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Nematostella
Match: EDO49718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFG9])

HSP 1 Score: 85.1149 bits (209), Expect = 1.956e-19
Identity = 42/136 (30.88%), Postives = 83/136 (61.03%), Query Frame = 3
Query:  501 RIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFE 908
            +++ ++RG  GSGK+++ + L+    N V+ S+D +FV ++G +++D  K ++A  W + +  +A+E G SPVIIDN + +SW+ +  V ++ +  Y V+I  P T W++  +QL + +T    + +I   +  +E
Sbjct:    1 KLLILMRGLPGSGKTSLAKQLR---ANGVIYSTDDFFV-NNGNYEFDLMKLSDAHEWNKKRALKAMEEGISPVIIDNTNTQSWEMRPYVLMAQRLGYKVIIREPSTHWKWKPKQLFKNNTHGVGLDKIKSMLERYE 132          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Medaka
Match: CNP (2',3'-cyclic nucleotide 3' phosphodiesterase [Source:NCBI gene;Acc:101161559])

HSP 1 Score: 135.576 bits (340), Expect = 9.200e-33
Identity = 116/411 (28.22%), Postives = 193/411 (46.96%), Query Frame = 3
Query:  447 VDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVN-AVVCSSDHYFVQSDGTFKYDRS--KYNEAENWCQNQIYQALESGKSPVII---DNPHI-----RSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKS--EPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADL---LDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            + F  L        +  SR + +LRG  GSGKS +   + D + +   V S+D + ++ +   +        +EA   C        E G S V+I   D  HI     R W      +++ + + +++ + P+T WR DV QL +K+ +   E   E  K  +E E ++PLYFGWFL     + I   + D L+ L  +   +  L       +F  KA+    L+ +      LH TTKFC YG    ++ Y ++ AV+ + G +F + +    +T +T    + L   +Q+ LW  D ++++ SA+    S P                      G RAH+TL   EGT+PVQ+G+D L+I+ +Q + + G+ +  +E GS+I +G+GR+ L L  PI     F+  Y
Sbjct:  244 LSFALLNQEQTKDALKVSRTLVVLRGLPGSGKSFLARAIADSYKDLCSVISADAHGIKPENPEQSTEGYKALDEAVVTC------CKEGGASSVLIVVDDTNHIHDRVARLW------EMAEEHNLVLIFLEPQTEWRLDVAQLAKKTKRQLDEAKLEAMKVQHE-ELSLPLYFGWFLLPAVQEKIRCTSMDFLKTLDTLEAFKKHLI------DFTGKAEKEVDLEQYYKANGTLHCTTKFCNYGKVEGSKEYAQNPAVRSAYGSVFELSLTALFVTPRTAGARVSLTE-EQLLLWPADAEKEVESAVAAAASLPQ---------------------GSRAHITLGCAEGTEPVQTGVDLLQILALQKEGQQGEPLE-MELGSLIYYGEGRWMLTLREPIAVPACFSSFY 612          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Medaka
Match: n4bp2 (NEDD4 binding protein 2 [Source:NCBI gene;Acc:101172634])

HSP 1 Score: 85.5001 bits (210), Expect = 1.290e-16
Identity = 49/187 (26.20%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  483 KWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLY--FGWFLNDRD----SDNILQFATDTLELLINIPEIRLG 1025
            K  L  +++ +LRG  GSGKST+     ++     + S+D YF++ +G +++D +   EA  W   +  +A E G +P+IIDN +++ W+ K  V  ++K  Y V+   P T W+    +L  ++  +  +  I + ++ +E  + +    G  + +R      +N       +   LI+ PE+R G
Sbjct:  385 KLQLQGKVLVLLRGAPGSGKSTLARAFLEQNPGGAILSTDDYFLR-NGEYRFDPTVLGEAHEWNHKRAKEAFERGTNPIIIDNTNMQGWEMKPYVAQALKHGYKVLFKEPDTWWKNKPRELERRTAHNVVVETIRRMLSGYERFVTVQSIMGALMPERKQHIPQENKPSEPQPSAPDLISRPELREG 570          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Medaka
Match: n4bp2 (NEDD4 binding protein 2 [Source:NCBI gene;Acc:101172634])

HSP 1 Score: 85.5001 bits (210), Expect = 1.404e-16
Identity = 49/187 (26.20%), Postives = 94/187 (50.27%), Query Frame = 3
Query:  483 KWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLY--FGWFLNDRD----SDNILQFATDTLELLINIPEIRLG 1025
            K  L  +++ +LRG  GSGKST+     ++     + S+D YF++ +G +++D +   EA  W   +  +A E G +P+IIDN +++ W+ K  V  ++K  Y V+   P T W+    +L  ++  +  +  I + ++ +E  + +    G  + +R      +N       +   LI+ PE+R G
Sbjct:  385 KLQLQGKVLVLLRGAPGSGKSTLARAFLEQNPGGAILSTDDYFLR-NGEYRFDPTVLGEAHEWNHKRAKEAFERGTNPIIIDNTNMQGWEMKPYVAQALKHGYKVLFKEPDTWWKNKPRELERRTAHNVVVETIRRMLSGYERFVTVQSIMGALMPERKQHIPQENKPSEPQPSAPDLISRPELREG 570          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Medaka
Match: ENSORLT00000033682.1 (NEDD4-binding protein 2-like 2 [Source:NCBI gene;Acc:101156107])

HSP 1 Score: 77.0258 bits (188), Expect = 3.069e-15
Identity = 44/156 (28.21%), Postives = 82/156 (52.56%), Query Frame = 3
Query:  504 IVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQ 971
            ++ ++RG  GSGKST+   L     + ++ S+D YF Q +  ++YD      A  W  ++   AL  G+SPVIIDN ++ +W+ K  V ++++  Y V    P T W+FD  +L +++       +I + ++ F    P+     +N ++  ++L 
Sbjct:   94 VLILMRGLPGSGKSTMARELLSSGPSGIILSTDDYFAQKN-DYRYDPYLLGAAHEWNHSRARDALCDGRSPVIIDNTNLEAWEMKPYVKMALEKGYKVDFCEPDTSWKFDPYELEKRNKHGVNREKIAQMMDRF--CFPISIDIVMNSQEPLHVLH 246          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Match: SMESG000060338.1 (SMESG000060338.1)

HSP 1 Score: 998.423 bits (2580), Expect = 0.000e+0
Identity = 499/499 (100.00%), Postives = 499/499 (100.00%), Query Frame = 3
Query:  135 MGSLCCSLINRDNSSQIYVNEGLAKTDNEQISITHNNIPYKCIVPVXXXXXXXXXXXXXXXXXXXXNHQPINMESSVTNFSYKQNTIDSNFGSIRPVDNQLYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            MGSLCCSLINRDNSSQIYVNEGLAKTDNEQISITHNNIPYKCIVPVSSMSQSKISYYSQLSTSQYSNHQPINMESSVTNFSYKQNTIDSNFGSIRPVDNQLYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY
Sbjct:    1 MGSLCCSLINRDNSSQIYVNEGLAKTDNEQISITHNNIPYKCIVPVSSMSQSKISYYSQLSTSQYSNHQPINMESSVTNFSYKQNTIDSNFGSIRPVDNQLYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNAVVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNPHIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 499          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Match: SMESG000075346.1 (SMESG000075346.1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.566e-16
Identity = 68/266 (25.56%), Postives = 111/266 (41.73%), Query Frame = 3
Query:  834 VEQLHEKSTKSEPIWEIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            V  L  ++   +P+ E D SI +    IP + GWF N+ D   + +  TD LE ++ + ++R  L             DL+ +W  ++ RLHVT  F    TA  +  YLK   V +         + GFLLT +T+SGH++L  P   +      ++D+                                F    H+T+       PV SG DQ+ I  M  +N+  K    ++ G + +WG  ++Y  L  P++    F  +Y
Sbjct:   13 VASLFIRTNSMDPV-EADNSILK----IPNFVGWFWNELDEKELHRIETDFLERILAVKDLRNQLYNCT------KSNDLMQYWIKQSKRLHVTAMFLGKRTA-KSRKYLKR--VYKMFNTSNTAVVTGFLLTPRTYSGHVEL--PVNTRWMFDPSKQDL--------------------------------FTLLPHVTVRLAPHISPVVSGEDQVPIQKMIKENKIPKQQFSLDWGLVQDWGNCQFYAALKKPLVYSLQFLPKY 230          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Match: SMESG000075346.1 (SMESG000075346.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.825e-15
Identity = 65/251 (25.90%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  879 EIDKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            E D SI +    IP + GWF N+ D   + +  TD LE ++ + ++R  L             DL+ +W  ++ RLHVT  F    TA  +  YLK   V +         + GFLLT +T+SGH++L  P   +      ++D+                                F    H+T+       PV SG DQ+ I  M  +N+  K    ++ G + +WG  ++Y  L  P++    F  +Y
Sbjct:    5 EADNSILK----IPNFVGWFWNELDEKELHRIETDFLERILAVKDLRNQLYNCT------KSNDLMQYWIKQSKRLHVTAMFLGKRTA-KSRKYLKR--VYKMFNTSNTAVVTGFLLTPRTYSGHVEL--PVNTRWMFDPSKQDL--------------------------------FTLLPHVTVRLAPHISPVVSGEDQVPIQKMIKENKIPKQQFSLDWGLVQDWGNCQFYAALKKPLVYSLQFLPKY 208          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Match: SMESG000075364.1 (SMESG000075364.1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.172e-15
Identity = 63/240 (26.25%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  918 PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLD-HWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGD-DQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            P+Y GWF N+R   ++   A   L+ ++ + + +L L           K D LD +W  +  RLHVT  +         E YL    V +        H+ GFLLT KTFS H+ L+   +   W  D  Q+D                                 F    H+T+      +PVQSGLD L+I  M    +  K    ++ G++ +WG   +Y+ L  P+    +F  +Y
Sbjct:  114 PVYVGWFWNNRFQRHLYDLAKFCLKEILEVDDFKLNLVKKL-------KNDQLDNYWTEQKKRLHVTAMYIGNKKTRQNEQYL--DKVFKQFYTTTESHLTGFLLTPKTFSAHVNLSENVK---WMFDPAQQD--------------------------------EFHLLTHVTVATAPNVRPVQSGLDMLKIQKMIKSKKVPKQQVDIKVGTVYDWGDCCFYVVLKEPLNNDLMFLPKY 309          
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Match: SMESG000075364.1 (SMESG000075364.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.344e-15
Identity = 63/240 (26.25%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  918 PLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAAACDLPEFVSKADLLD-HWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQESLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGD-DQEDISSAMNKYGSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQLEIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY 1631
            P+Y GWF N+R   ++   A   L+ ++ + + +L L           K D LD +W  +  RLHVT  +         E YL    V +        H+ GFLLT KTFS H+ L+   +   W  D  Q+D                                 F    H+T+      +PVQSGLD L+I  M    +  K    ++ G++ +WG   +Y+ L  P+    +F  +Y
Sbjct:  102 PVYVGWFWNNRFQRHLYDLAKFCLKEILEVDDFKLNLVKKL-------KNDQLDNYWTEQKKRLHVTAMYIGNKKTRQNEQYL--DKVFKQFYTTTESHLTGFLLTPKTFSAHVNLSENVK---WMFDPAQQD--------------------------------EFHLLTHVTVATAPNVRPVQSGLDMLKIQKMIKSKKVPKQQVDIKVGTVYDWGDCCFYVVLKEPLNNDLMFLPKY 297          
The following BLAST results are available for this feature:
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNP1.110e-4128.822',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
CNP2.031e-4128.822',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
N4BP2L14.972e-2032.52NEDD4 binding protein 2 like 1 [Source:HGNC Symbol... [more]
N4BP2L17.114e-2032.48NEDD4 binding protein 2 like 1 [Source:HGNC Symbol... [more]
N4BP2L12.463e-1928.57NEDD4 binding protein 2 like 1 [Source:HGNC Symbol... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F26A1.138.278e-621.38pep chromosome:WBcel235:III:4847009:4849907:-1 gen... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG71391.240e-1330.07gene:FBgn0027532 transcript:FBtr0078486[more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnp4.321e-2230.832',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
cnp4.619e-2230.832',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
n4bp2l21.268e-1937.04NEDD4 binding protein 2-like 2 [Source:ZFIN;Acc:ZD... [more]
n4bp22.664e-1432.28NEDD4 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
n4bp22.749e-1432.28NEDD4 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcmtd11.725e-3928.75protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
ttbk23.526e-2332.39tau tubulin kinase 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
nadsyn15.741e-1835.29NAD synthetase 1 [Source:Xenbase;Acc:XB-GENE-97183... [more]
N4BP25.104e-1329.41NEDD4 binding protein 2 [Source:NCBI gene;Acc:1004... [more]
N4BP25.405e-1329.41NEDD4 binding protein 2 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnp8.056e-4028.752',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
N4bp2l14.137e-2129.29NEDD4 binding protein 2-like 1 [Source:MGI Symbol;... [more]
N4bp2l22.893e-1833.09NEDD4 binding protein 2-like 2 [Source:MGI Symbol;... [more]
N4bp23.479e-1335.78NEDD4 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
N4bp23.892e-1335.78NEDD4 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13233|CN37_RAT2.798e-4129.732',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Ra... [more]
sp|P09543|CN37_HUMAN9.754e-4128.822',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Ho... [more]
sp|P16330|CN37_MOUSE5.635e-3928.752',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mu... [more]
sp|Q5RFD0|CN37_PONAB5.800e-3928.332',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Po... [more]
sp|P06623|CN37_BOVIN6.370e-3928.152',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Bo... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SGI84.704e-8032.60Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X6835.386e-8033.042',3'-cyclic nucleotide 3'-phosphodiesterase OS=Op... [more]
A0A075A1755.916e-8033.04Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KS115.051e-7933.652' 3'-cyclic-nucleotide 3'-phosphodiesterase OS=Cl... [more]
A0A4E0R0M63.522e-7333.902' 3'-cyclic-nucleotide 3'-phosphodiesterase OS=Fa... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnp2.900e-2329.632',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
n4bp23.053e-1734.88NEDD4 binding protein 2 [Source:NCBI gene;Acc:1030... [more]
n4bp2l21.321e-1531.88NEDD4-binding protein 2-like 2 [Source:NCBI gene;A... [more]
n4bp2l21.321e-1531.88NEDD4-binding protein 2-like 2 [Source:NCBI gene;A... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CNP4.183e-3028.572',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
ENSPMAT00000009837.18.360e-2232.69pep scaffold:Pmarinus_7.0:GL476585:41524:64166:-1 ... [more]
ENSPMAT00000008353.12.859e-1741.86pep scaffold:Pmarinus_7.0:GL476515:238409:242895:1... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO497181.956e-1930.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CNP9.200e-3328.222',3'-cyclic nucleotide 3' phosphodiesterase [Sour... [more]
n4bp21.290e-1626.20NEDD4 binding protein 2 [Source:NCBI gene;Acc:1011... [more]
n4bp21.404e-1626.20NEDD4 binding protein 2 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000033682.13.069e-1528.21NEDD4-binding protein 2-like 2 [Source:NCBI gene;A... [more]
back to top
BLAST of 2',3'-cyclic nucleotide 3'-phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060338.10.000e+0100.00SMESG000060338.1[more]
SMESG000075346.18.566e-1625.56SMESG000075346.1[more]
SMESG000075346.11.825e-1525.90SMESG000075346.1[more]
SMESG000075364.12.172e-1526.25SMESG000075364.1[more]
SMESG000075364.12.344e-1526.25SMESG000075364.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018465 ID=SMED30018465|Name=2',3'-cyclic nucleotide 3'-phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=2289bp
GTTTAAATAAATAGAATTCAAGGTCATATGTTTTTTGAAACCTTTAATTT
TACTTAGTTTAGTAAGATATCAGATAAATGATGCGGTATTAACTATTAGA
TAATTCAAAAAGTATTATTTAACAGTAAAAACTGATGGGTAGCCTTTGTT
GCAGCCTGATCAACCGTGACAATTCATCACAAATTTATGTGAATGAAGGA
CTGGCTAAAACAGACAATGAACAAATAAGTATTACTCATAACAATATTCC
TTACAAATGTATTGTTCCCGTTTCATCAATGAGCCAATCAAAAATCTCAT
ATTACAGCCAATTGTCAACCAGTCAGTACAGTAACCATCAGCCAATCAAC
ATGGAGTCATCAGTTACTAATTTTAGCTATAAACAGAATACAATTGACTC
AAACTTTGGTTCTATCAGGCCTGTCGATAACCAACTTTATCAATTTGTTG
ATTTCCCATTCCTTACTTCGTTAGCTGTAATCAAATGGATGCTTTCATCT
AGAATTGTATTTATTCTCCGAGGCCCGTCTGGATCTGGGAAAAGCACGAT
CGTAGAATGTCTCAAAGATAAATTTGTTAATGCAGTGGTGTGCTCATCGG
ATCATTATTTCGTTCAAAGCGATGGCACATTCAAGTATGACAGATCTAAG
TACAATGAAGCCGAGAATTGGTGTCAGAATCAAATTTACCAAGCTCTGGA
ATCAGGGAAATCCCCGGTCATAATTGATAATCCCCATATTCGCTCTTGGC
AATATAAATACAGCGTCGATGTGTCAATGAAGTTCGATTATCTCGTCATG
ATTGTTGTTCCGAAAACGCCGTGGAGATTTGATGTTGAACAATTACATGA
AAAAAGCACAAAATCAGAACCGATCTGGGAAATTGACAAATCCATCAATG
AATTCGAGCCAGCAATTCCACTATATTTCGGTTGGTTTCTCAATGACAGA
GACAGTGATAATATTCTTCAATTCGCCACCGACACGCTAGAACTGTTAAT
AAATATCCCAGAAATTCGCCTGGGGCTTGCAGCTGCTTGCGATTTGCCAG
AATTCGTATCCAAGGCAGATTTATTAGATCATTGGAGGATGAAAACTGAC
AGATTGCATGTGACAACGAAATTTTGTGCATATGGAACAGCTACCGATGC
TGAATCTTATCTTAAGTCTGGAGCTGTTCAAGAAAGTCTTGGGCAGTTAT
TTCCAATTCACATTAAAGGATTTTTATTGACTACAAAAACGTTTAGTGGA
CATATACAGTTGGCAGGTCCTAAGCAAATTCAATTATGGGCTGGTGATGA
TCAAGAAGATATATCATCAGCCATGAATAAATATGGATCCAAGCCAACCA
GTCTTAGCAAGAAAACTGGAATAGCAAAATTAAATGGCGTCAAACAAGTC
AGACGCCCATTCGGATGTCGTGCTCACATGACCCTCATGTACACCGAAGG
TACAAAGCCGGTTCAAAGTGGCCTAGATCAACTGGAAATAATCGACATGC
AATTAAAGAACGAGACCGGTAAATTCGTGGCCGTTGTTGAGTCCGGGAGT
ATCATTGAGTGGGGACAAGGACGATATTATCTGGAACTGAATTATCCAAT
AATTTGTCAAACTCTTTTCACTGGGCAATACTGAATTTGACTGTGCTAGA
TTAGACATTGAAAATTGTACACATTTTCTATTGCATTTCTGAAGCTGCGA
ATGGAATTTGATGGGATTTGTAACAACAAGATTCTGCATGTATCATACGT
ATGTTTCAATTTGATATTGGTTTCGTTTTATACATTTTCTTTGATTTTTA
CGTGCTCCCCTCCCAGCAGGAATTTTTAATTTATCTTACTCTGCGCATGT
TTCTTGTGTTTTCACAGAATTTGGCCCGGGGGTAAGTATTTACCTGGCTG
GAATGATCTGGGAATTCTGTGACACGAATTGATAAAATTCGATACATTTC
CGTGAAACCTCTCAAAATTATACCAGTTTTTTAGGATTTTTCTTTTTATA
TATTTGCCGGCAAATAATTAATAATTTCTCAAATATTCTGCTAGTTGAAA
TTTCCAATTAATGATCGAAAAATATTTTGTTTAGCATTTATTTATAAATA
GTAAAAAATATTTGTGTATTCCTGGATCGAGCGTATCATCGGCGAGAAGT
TTTTCATCTTCTTGGTATATAATTATTGACTTTAGGAATAGACTAACATC
AAAAAATGCTGAAATGCTTGTTTTCTTATACCATAATGCCAGAAACATGA
AGTAAAACTATAACCTTATTTTTTTCTTAGTATAAATAG
back to top

protein sequence of SMED30018465-orf-1

>SMED30018465-orf-1 ID=SMED30018465-orf-1|Name=SMED30018465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MGSLCCSLINRDNSSQIYVNEGLAKTDNEQISITHNNIPYKCIVPVSSMS
QSKISYYSQLSTSQYSNHQPINMESSVTNFSYKQNTIDSNFGSIRPVDNQ
LYQFVDFPFLTSLAVIKWMLSSRIVFILRGPSGSGKSTIVECLKDKFVNA
VVCSSDHYFVQSDGTFKYDRSKYNEAENWCQNQIYQALESGKSPVIIDNP
HIRSWQYKYSVDVSMKFDYLVMIVVPKTPWRFDVEQLHEKSTKSEPIWEI
DKSINEFEPAIPLYFGWFLNDRDSDNILQFATDTLELLINIPEIRLGLAA
ACDLPEFVSKADLLDHWRMKTDRLHVTTKFCAYGTATDAESYLKSGAVQE
SLGQLFPIHIKGFLLTTKTFSGHIQLAGPKQIQLWAGDDQEDISSAMNKY
GSKPTSLSKKTGIAKLNGVKQVRRPFGCRAHMTLMYTEGTKPVQSGLDQL
EIIDMQLKNETGKFVAVVESGSIIEWGQGRYYLELNYPIICQTLFTGQY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
IPR027417P-loop_NTPase
IPR008431CNPase
IPR009097Cyclic_Pdiesterase
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:00041132',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0009214cyclic nucleotide catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008431Cyclic nucleotide phosphodiesterasePFAMPF05881CNPasecoord: 261..499
e-value: 1.1E-36
score: 126.6
IPR008431Cyclic nucleotide phosphodiesterasePANTHERPTHR101562',3'-CYCLIC-NUCLEOTIDE 3'-PHOSPHODIESTERASEcoord: 104..499
NoneNo IPR availablePFAMPF13671AAA_33coord: 125..243
e-value: 3.1E-10
score: 40.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 124..259
e-value: 2.4E-24
score: 88.2
NoneNo IPR availableGENE3DG3DSA:3.90.1740.10coord: 260..499
e-value: 4.6E-51
score: 175.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 123..264
IPR009097Cyclic phosphodiesteraseSUPERFAMILYSSF55144LigT-likecoord: 258..499