Charged multivesicular body protein 2b

Overview
NameCharged multivesicular body protein 2b
Smed IDSMED30018460
Length (bp)962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Charged multivesicular body protein 2b (SMED30018460) t-SNE clustered cells

Violin plots show distribution of expression levels for Charged multivesicular body protein 2b (SMED30018460) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Charged multivesicular body protein 2b (SMED30018460) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Charged multivesicular body protein 2b (SMED30018460) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018460

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018460SMESG000054476.1 Contig2325GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30018460SMESG000054476.1 dd_Smed_v4_1514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Match: CHMP2B (charged multivesicular body protein 2B [Source:HGNC Symbol;Acc:HGNC:24537])

HSP 1 Score: 142.51 bits (358), Expect = 1.444e-40
Identity = 98/208 (47.12%), Postives = 140/208 (67.31%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            S +KK    + ++   RE +  QR + +D+  LE +EK+LE EIKK+AK GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL 210          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Match: CHMP2B (charged multivesicular body protein 2B [Source:HGNC Symbol;Acc:HGNC:24537])

HSP 1 Score: 139.813 bits (351), Expect = 4.886e-40
Identity = 78/158 (49.37%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  232 GNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:   12 GNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL 169          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Match: CHMP2B (charged multivesicular body protein 2B [Source:HGNC Symbol;Acc:HGNC:24537])

HSP 1 Score: 110.153 bits (274), Expect = 1.319e-28
Identity = 54/98 (55.10%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  232 GNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIF 525
            GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF
Sbjct:   69 GNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIF 166          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Match: CHMP2B (charged multivesicular body protein 2B [Source:HGNC Symbol;Acc:HGNC:24537])

HSP 1 Score: 100.908 bits (250), Expect = 3.716e-25
Identity = 84/208 (40.38%), Postives = 120/208 (57.69%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            S +KK    + ++   RE +  QR + +D+  LE +EK+LE EIKK+AK GNK+   VLAKQL+ LRKQK R                              T  TM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTR------------------------------TFATMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL 180          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 71.2478 bits (173), Expect = 6.799e-14
Identity = 61/188 (32.45%), Postives = 114/188 (60.64%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV 648
            F ++  P+E +R  +R   +  R+L++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K M  MN+ +K  ++  ++  FE++   + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ +  ++S  P+   G L V
Sbjct:    5 FGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPST-GGSLSV 191          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Match: C01A2.4 (pep chromosome:WBcel235:I:13392118:13394001:1 gene:WBGene00007216.1 transcript:C01A2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01A2.4)

HSP 1 Score: 137.117 bits (344), Expect = 4.503e-39
Identity = 92/208 (44.23%), Postives = 135/208 (64.90%), Query Frame = 1
Query:   79 MSFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKA 702
            M+ + KPDPKE  R  +RE +K  RDL  D+  ++  EK+LE EIKKLA +G+   A  LAKQL+QLR QK +++ M+ ++  +  Q   MQS  K+  AM TT KTM  MN  M  E++A  ++ F+    K+G+TEEMMN+TLD I +  G+ +E+  ++N+VLDEIGIE+NSK++  PA  + ++        +DLE QLARL++
Sbjct:    1 MNIFSKPDPKELERANKRELRKTNRDLESDRRQMDRREKELEQEIKKLAAKGHNDAARHLAKQLVQLRNQKTKSIGMSARISGVQAQNSHMQSMAKMGSAMGTTVKTMKAMNAQMPLEKVAANMREFQMAQEKMGLTEEMMNDTLDSILDAPGDADEQDAIVNQVLDEIGIEMNSKLANVPALPT-KVSSTAPADFDDLEAQLARLRS 207          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Match: vps-2 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9U2F6])

HSP 1 Score: 68.5514 bits (166), Expect = 3.127e-13
Identity = 54/184 (29.35%), Postives = 110/184 (59.78%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSG 636
            F ++  P E +R  +R   K  R+L++++  +E +EKK+ A+IK +AK+       V+AK L++ R+   + + M   + +++ + + ++S   +A AMK   K M +MN+ +   ++  ++  FE+++  + M EE+M + +DD   + G+EEE   ++N+VLDE+GI++  +++  P+A  G
Sbjct:    5 FGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKVIADIKNMAKKNQMDSVKVMAKDLVRTRRYIKKFIVMKANIQAVSLKVQTLKSQDAMASAMKGVTKAMQSMNRQLNLPQIQKIMMEFEKQSEIMDMKEEVMGDAIDDALGDAGDEEETDQIVNQVLDELGIQMGEEMAGLPSAAGG 188          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 62.003 bits (149), Expect = 3.428e-11
Identity = 61/207 (29.47%), Postives = 112/207 (54.11%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 705
            F KK DPKE++R  +R+ ++  R L++    ++ EE+K+  EIK+ AK+G+K    +LAK +IQ RK  ++      ++ S+    +   + I++A +++ + + M +M +++K  E+   ++    E MKLG+ EEM+ ETL+ +      E+ +  V N +L E+      ++ +AP A    +G   +   ED E    RL  L
Sbjct:    4 FGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLESVEPAGLEEKAQEEVEN-ILWEV---TQGELGKAPLAVKSNIGGVVTPAVEDFEGMAQRLAEL 206          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 62.003 bits (149), Expect = 3.428e-11
Identity = 61/207 (29.47%), Postives = 112/207 (54.11%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 705
            F KK DPKE++R  +R+ ++  R L++    ++ EE+K+  EIK+ AK+G+K    +LAK +IQ RK  ++      ++ S+    +   + I++A +++ + + M +M +++K  E+   ++    E MKLG+ EEM+ ETL+ +      E+ +  V N +L E+      ++ +AP A    +G   +   ED E    RL  L
Sbjct:    4 FGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLESVEPAGLEEKAQEEVEN-ILWEV---TQGELGKAPLAVKSNIGGVVTPAVEDFEGMAQRLAEL 206          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 62.003 bits (149), Expect = 3.428e-11
Identity = 61/207 (29.47%), Postives = 112/207 (54.11%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 705
            F KK DPKE++R  +R+ ++  R L++    ++ EE+K+  EIK+ AK+G+K    +LAK +IQ RK  ++      ++ S+    +   + I++A +++ + + M +M +++K  E+   ++    E MKLG+ EEM+ ETL+ +      E+ +  V N +L E+      ++ +AP A    +G   +   ED E    RL  L
Sbjct:    4 FGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLESVEPAGLEEKAQEEVEN-ILWEV---TQGELGKAPLAVKSNIGGVVTPAVEDFEGMAQRLAEL 206          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Fly
Match: CHMP2B (gene:FBgn0035589 transcript:FBtr0077166)

HSP 1 Score: 147.517 bits (371), Expect = 8.263e-43
Identity = 97/206 (47.09%), Postives = 136/206 (66.02%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKA 702
            F KKP  KEQ R  +R  +K  RD+ +++  +E EE+KLE EI++ A  GN     +LAKQL+++RKQK+R      K+ SI  Q K M +NI L++AM TT KTM  MNKVM+PE +   ++ F+  NMK+ MT+EM+N+TLDD+ NE G+EEE   V+NKVLDEIGIEI+ K+S  PA  S          ++D+  QLA+L++
Sbjct:    6 FGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEKDIADQLAKLRS 211          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Fly
Match: Vps2 (gene:FBgn0039402 transcript:FBtr0084967)

HSP 1 Score: 77.0258 bits (188), Expect = 5.705e-16
Identity = 64/188 (34.04%), Postives = 119/188 (63.30%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV 648
            F KK  P E +R  +R   K  RDL++++  +E +EKK+ A+IKK+AK+G      ++AK L++ R+   + M M   + +++ + + ++S   +A AMK   K M NMN+ +   ++  +L++FE+++  + M EEM+N+ +DD   +EG+EEE   V+++VLDE+G+++  ++ + P+A SG L +
Sbjct:    5 FGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSA-SGSLSI 191          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Fly
Match: Vps24 (gene:FBgn0037231 transcript:FBtr0078958)

HSP 1 Score: 60.4622 bits (145), Expect = 1.961e-10
Identity = 48/170 (28.24%), Postives = 91/170 (53.53%), Query Frame = 1
Query:  112 QMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAP 621
            Q+R+ +RE +KV+R L +                   A++ ++    +LAK+++  RK  NR       + SI  Q K   S +++A +++ + + +  M  +++  E+A ++++  +E MK G+ EEM++ET+D +   E  EEE +  ++KVL EI    + K+ EAP
Sbjct:   33 QIRSIQREEEKVKRSLKQ------------------AAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAP 181          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Fly
Match: Vps24 (gene:FBgn0037231 transcript:FBtr0347550)

HSP 1 Score: 60.4622 bits (145), Expect = 1.961e-10
Identity = 48/170 (28.24%), Postives = 91/170 (53.53%), Query Frame = 1
Query:  112 QMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAP 621
            Q+R+ +RE +KV+R L +                   A++ ++    +LAK+++  RK  NR       + SI  Q K   S +++A +++ + + +  M  +++  E+A ++++  +E MK G+ EEM++ET+D +   E  EEE +  ++KVL EI    + K+ EAP
Sbjct:   33 QIRSIQREEEKVKRSLKQ------------------AAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI---TDGKLGEAP 181          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 137.887 bits (346), Expect = 5.312e-39
Identity = 86/181 (47.51%), Postives = 130/181 (71.82%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPA 624
            S +KK    + ++   +E +  QR + +D+  LE +E+++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++ENMK+GMTE+M+N TLD+IF+E  +EEE   ++N+VLDEIGIEI+ K+  AP+
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEISGKMVRAPS 183          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 137.887 bits (346), Expect = 5.312e-39
Identity = 86/181 (47.51%), Postives = 130/181 (71.82%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPA 624
            S +KK    + ++   +E +  QR + +D+  LE +E+++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++ENMK+GMTE+M+N TLD+IF+E  +EEE   ++N+VLDEIGIEI+ K+  AP+
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEISGKMVRAPS 183          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Match: chmp2bb (charged multivesicular body protein 2Bb [Source:NCBI gene;Acc:405840])

HSP 1 Score: 137.502 bits (345), Expect = 7.531e-39
Identity = 96/209 (45.93%), Postives = 138/209 (66.03%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAH----SGRLGVKESTKDEDLETQLARL 696
            S +KK    + ++   +E +  QR + +D+  LE +EK+LE EIKK+AK GN+    VLAKQL+Q+RKQK R   ++ KV S++ Q K+M S +K+A AM TT KTM  +NK M P++    L+NF++E  K+ MTEEMMN+TLD+IF + G+EEE   ++N+VLDEIGIEI+ K++ AP+A     S      +   DED+E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQNKELRGTQRQIARDRTALEKQEKQLEMEIKKMAKTGNRDACKVLAKQLVQVRKQKTRTYAVSSKVTSMSTQTKLMNSQMKMAGAMATTTKTMQAVNKKMDPKKTMQTLQNFQKETAKMDMTEEMMNDTLDEIFEDSGDEEESQDIVNQVLDEIGIEISGKMAHAPSAARKTPSAATAKADGISDEDIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 137.502 bits (345), Expect = 8.484e-39
Identity = 89/187 (47.59%), Postives = 131/187 (70.05%), Query Frame = 1
Query:   79 MSFWKKPDP-----KEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPA 624
            + F+  P P     KEQ     +E +  QR + +D+  LE +E+++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++ENMK+GMTE+M+N TLD+IF+E  +EEE   ++N+VLDEIGIEI+ K+  AP+
Sbjct:    1 LHFFFLPRPVTDIIKEQ----SKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEISGKMVRAPS 183          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:798901])

HSP 1 Score: 79.7221 bits (195), Expect = 4.356e-17
Identity = 71/215 (33.02%), Postives = 126/215 (58.60%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK----------DEDLETQLARLK 699
            F ++  P+E +R  +R   +  RDL++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K MA MN+ +K  ++  ++  FE+++  + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ ++ ++S  PA   G L V    K          D DLE +L  L+
Sbjct:    5 FGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLSDELSNLPAT-GGSLSVAAGKKAEPQPTLADADADLEERLNNLR 218          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:NCBI gene;Acc:407966])

HSP 1 Score: 147.517 bits (371), Expect = 1.351e-42
Identity = 100/209 (47.85%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKES----TKDEDLETQLARL 696
            S +KK    + +R   +E +  QR + +D+  LE +EK+LE EIKK+AK GNK    VLAKQL+QLRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A  G      S      DE++E QL  L
Sbjct:    3 SLFKKKTVDDIIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKAGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDDEEESQDIVNQVLDEIGIEISGKMAKAPSAAKGLPSTSASKSSGISDEEIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:NCBI gene;Acc:407966])

HSP 1 Score: 145.206 bits (365), Expect = 1.431e-41
Identity = 100/214 (46.73%), Postives = 141/214 (65.89%), Query Frame = 1
Query:   67 IVITMSFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKES----TKDEDLETQLARL 696
            I ++  F  K    + +R   +E +  QR + +D+  LE +EK+LE EIKK+AK GNK    VLAKQL+QLRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A  G      S      DE++E QL  L
Sbjct:    9 ISLSNCFINKTIMSDIIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKAGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDDEEESQDIVNQVLDEIGIEISGKMAKAPSAAKGLPSTSASKSSGISDEEIERQLKAL 222          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Xenopus
Match: nelfa (negative elongation factor complex member A [Source:Xenbase;Acc:XB-GENE-988837])

HSP 1 Score: 74.3294 bits (181), Expect = 4.400e-15
Identity = 64/195 (32.82%), Postives = 119/195 (61.03%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDE 669
            F ++  P+E +R  +R   K  R++++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K MA MN+ +K  ++  ++  FE+++  + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ +  ++S  P+   G L V  + K E
Sbjct:    5 FGRRKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPST-GGSLSVAGAKKGE 198          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Xenopus
Match: coq6 (coenzyme Q6 monooxygenase [Source:Xenbase;Acc:XB-GENE-945926])

HSP 1 Score: 47.7506 bits (112), Expect = 7.676e-6
Identity = 40/164 (24.39%), Postives = 89/164 (54.27%), Query Frame = 1
Query:  106 KEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNR----NMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEI 585
            +++MR  +R+ + +QR+  K K  ++   K           +GN++   +LAK+++  +K  N+       MN  + S+ NQ  V+    +++ +++ + + M  M  ++K  E+   +++  +E MK G+ EEM+ +T + + +++  EE+  M I+++L EI
Sbjct:   24 RKEMRVIDRQIRDIQREQEKVKRSIKESAK-----------KGNREACVILAKEVVHSKKAVNKLYASKAHMNSVLMSMKNQLAVL----RVSGSLQKSTEVMKAMQNLVKIPEIQATMRDLSKEMMKAGIIEEMLEDTFEGMEDQDEMEEQAEMEIDRILFEI 172          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Mouse
Match: Chmp2b (charged multivesicular body protein 2B [Source:MGI Symbol;Acc:MGI:1916192])

HSP 1 Score: 142.51 bits (358), Expect = 1.024e-40
Identity = 98/208 (47.12%), Postives = 140/208 (67.31%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            S +KK    + ++   RE +  QR + +D+  LE +EK+LE EIKK+AK GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL 210          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Mouse
Match: Chmp2b (charged multivesicular body protein 2B [Source:MGI Symbol;Acc:MGI:1916192])

HSP 1 Score: 139.813 bits (351), Expect = 8.493e-40
Identity = 78/158 (49.37%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  232 GNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:   49 GNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL 206          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Mouse
Match: Chmp2a (charged multivesicular body protein 2A [Source:MGI Symbol;Acc:MGI:1916203])

HSP 1 Score: 71.2478 bits (173), Expect = 5.048e-14
Identity = 62/193 (32.12%), Postives = 115/193 (59.59%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK 663
            F ++  P+E +R  +R   +  R+L++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K M  MN+ +K  ++  ++  FE++   + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ +  ++S  P+   G L V    K
Sbjct:    5 FGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPST-GGSLSVAAGGK 196          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Mouse
Match: Chmp2a (charged multivesicular body protein 2A [Source:MGI Symbol;Acc:MGI:1916203])

HSP 1 Score: 71.2478 bits (173), Expect = 5.048e-14
Identity = 62/193 (32.12%), Postives = 115/193 (59.59%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK 663
            F ++  P+E +R  +R   +  R+L++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K M  MN+ +K  ++  ++  FE++   + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ +  ++S  P+   G L V    K
Sbjct:    5 FGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPST-GGSLSVAAGGK 196          
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Match: sp|Q5F3A2|CHM2B_CHICK (Charged multivesicular body protein 2b OS=Gallus gallus OX=9031 GN=CHMP2B PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 6.251e-43
Identity = 102/209 (48.80%), Postives = 143/209 (68.42%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KEST-KDEDLETQLARL 696
            S +KK    + ++   RE +  QR + +D+  LE +E++LE EIKK+AK GNK+   VLAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+    EEE   ++N+VLDEIGIEI+ K+++AP+A  G       K ST  DE++E QL  L
Sbjct:    3 SLFKKKTVDDIIKEQNRELRGTQRTITRDRAALEKQERQLELEIKKMAKTGNKEACKVLAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDEEEESQDIVNQVLDEIGIEISGKMAKAPSAARGLPSASTSKASTISDEEIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Match: sp|Q6NVL7|CHM2B_XENTR (Charged multivesicular body protein 2b OS=Xenopus tropicalis OX=8364 GN=chmp2b PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.158e-42
Identity = 100/209 (47.85%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKES----TKDEDLETQLARL 696
            S +KK    + +R   +E +  QR + +D+  LE +EK+LE EIKK+AK GNK    VLAKQL+QLRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A  G      S      DE++E QL  L
Sbjct:    3 SLFKKKTVDDIIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKAGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDDEEESQDIVNQVLDEIGIEISGKMAKAPSAAKGLPSTSASKSSGISDEEIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Match: sp|Q7SYR0|CH2BA_XENLA (Charged multivesicular body protein 2b-A OS=Xenopus laevis OX=8355 GN=chmp2b-a PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.040e-41
Identity = 100/209 (47.85%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKES----TKDEDLETQLARL 696
            S +KK    + ++   +E K  QR + +D+  LE +EK+LE EIKK+AK GNK    VLAKQL+QLRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A  G      S      DE++E QL  L
Sbjct:    3 SLFKKKTVDDIIKDQNKELKGQQRAITRDRTALEKQEKQLEMEIKKMAKAGNKDACKVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASEDEEESQDIVNQVLDEIGIEISGKMAKAPSAAKGLPSASASKSTGISDEEIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Match: sp|Q66IV6|CH2BB_XENLA (Charged multivesicular body protein 2b-B OS=Xenopus laevis OX=8355 GN=chmp2b-b PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 6.194e-41
Identity = 98/209 (46.89%), Postives = 140/209 (66.99%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSG----RLGVKESTKDEDLETQLARL 696
            S +KK    + +R   +E +  QR + +D+  LE +EK+LE EIKK+AK GNK    VLAKQL+QLRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MT+EM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A  G         +   DE++E QL  L
Sbjct:    3 SLFKKKTVDDIIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKTGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTDEMINDTLDDIFDASEDEEESQDIVNQVLDEIGIEISGKMAKAPSAAKGLPSTSAAKSKGISDEEIERQLKAL 211          
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Match: sp|Q3SX42|CHM2B_BOVIN (Charged multivesicular body protein 2b OS=Bos taurus OX=9913 GN=CHMP2B PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.368e-40
Identity = 98/208 (47.12%), Postives = 140/208 (67.31%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGV---KESTKDEDLETQLARL 696
            S +KK    + ++   RE +  QR + +D+  LE +EK+LE EIKK+AK GNK+   VLAKQL+ LRKQK R   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    ++NF++ENMK+ MTEEM+N+TLDDIF+   +EEE   ++N+VLDEIGIEI+ K+++AP+A          K +  DE++E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKSTISDEEIERQLKAL 210          
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Match: A0A0B7A8V6 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF103037 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.714e-56
Identity = 116/207 (56.04%), Postives = 154/207 (74.40%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 705
            F KKP  +EQ+R  +R  KK  RDL++D+N LE EEKKLE EIK  AKQGNKQ AT+LAKQLI LRKQ+ ++  M  K+ +I NQ K+M SN+K+A AM TT KTM  MNKVM P++ A M++ F++E  K+ MTEEM+++TLDDI  E G+EEE+  ++NKVLDEIGIEI  K+++AP+AH G+LG    T D+++E QLA L+ L
Sbjct:    5 FSKKPTVQEQLRANDRVLKKQTRDLDRDRNALEREEKKLEMEIKTAAKQGNKQAATILAKQLINLRKQRTKSYAMGSKISAIGNQQKMMHSNMKMASAMGTTTKTMTQMNKVMDPQKTAAMMQEFQKETAKMDMTEEMIDDTLDDILTESGDEEEQDAIVNKVLDEIGIEITGKLADAPSAHRGKLGQSSRTADDEIERQLAALRDL 211          
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Match: A0A1I8H3V5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.281e-55
Identity = 111/211 (52.61%), Postives = 150/211 (71.09%), Query Frame = 1
Query:   79 MSFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSG--RLGVKESTKDEDLETQLARLKAL 705
            M+FWKKP  +EQMR  +RE KK QRDL +D+ HLE EEK++E EIKK AKQGNK+  +VLAKQL++LR+QK R+  M  KV ++  Q KVM +N+K+ADAMKTT KTM  MNK M PE+    ++ F++ NMK+ M+EE MNE LDDIF    +E E+  V+ +VLDEIGI++N+++S+AP+  +   R     S+KD+D E  L RL  L
Sbjct:    1 MAFWKKPTVQEQMRANDRELKKTQRDLERDRGHLEREEKRIEGEIKKAAKQGNKEACSVLAKQLVRLRQQKTRSYAMGSKVSAVGTQQKVMGANLKMADAMKTTTKTMGQMNKAMSPEDTMKTMRQFQESNMKMEMSEETMNEALDDIFAGSDDEAEQDKVVAQVLDEIGIDMNAQMSKAPSTSTATPRAAAASSSKDDD-EEMLKRLAGL 210          
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Match: A0A433SR96 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_020469 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.393e-54
Identity = 115/211 (54.50%), Postives = 161/211 (76.30%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK----DEDLETQLARLKAL 705
            F KKP  +EQ+R  +R  +K  RD+++D+N LE EEKK+E EIKK AKQGNKQ AT+LAKQL+ LRKQK ++  MN K+ SI NQ K+M SN+K+A AM TT KTM  MNKVM P++ A M++ F++E+ K+ MTEEM+++TL+D+  E G+EEE+  ++N+VLDEIGIEI+ K+++AP+AH G+LG  ES++    D+++E QLA LK L
Sbjct:    5 FSKKPTVQEQLRANDRVLRKQTRDIDRDRNALEREEKKIEMEIKKAAKQGNKQAATILAKQLVALRKQKTKSYAMNSKISSIGNQQKLMHSNMKMASAMGTTTKTMTQMNKVMDPQKTAAMMREFQKESAKMDMTEEMIDDTLEDVLAESGDEEEQDAIVNQVLDEIGIEISGKLADAPSAHRGKLG--ESSRAVAADDEIERQLAALKDL 213          
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Match: V3ZTE3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203267 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.724e-53
Identity = 115/212 (54.25%), Postives = 160/212 (75.47%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK-----DEDLETQLARLKAL 705
            F KKP  ++Q+R  +R  K+ QR + +D+ +LE EEKK+E EIKK AKQGNKQ AT+LAKQL+ LRKQK +   +N K+G+I NQ K+M SN+K+A+AM TT KTM  MNKVM P++   M+++FE+E+ K+GMTEEM+++TLDDI  E G+EEE+  ++++VLDEIGIE++ K+  AP+AH G+LG  ES+K     D+D+E QLA LK L
Sbjct:    5 FKKKPTIEQQIRENDRTTKRTQRGVERDRANLEKEEKKIEMEIKKAAKQGNKQAATILAKQLVALRKQKTKTYAVNSKIGAIGNQQKLMHSNMKMANAMGTTTKTMVEMNKVMDPQKTMKMMQDFEKESTKMGMTEEMIDDTLDDILAESGDEEEQDAIVSQVLDEIGIELSGKMVNAPSAHRGQLG--ESSKAKGVSDDDIEKQLAALKDL 214          
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Match: K1Q629 (Charged multivesicular body protein 2b OS=Crassostrea gigas OX=29159 GN=CGI_10028266 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.080e-52
Identity = 115/209 (55.02%), Postives = 151/209 (72.25%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLG--VKESTKDEDLETQLARLKAL 705
            F KKP  +EQ+R  +R  +K QRDL +D+  LE EEK++E EIKK AKQGNKQ ATVLAKQL+ +RKQ+ ++  +  K+ +I NQ K+M SN+K+A AM TT KTM  MN VM P++ A M++ FE+ENMK+GM+E+M+N+TLDDI  E G+EEE   V+++VLDEIGIEI  K+  APAA S  LG   K    D+D+E QLA LK L
Sbjct:    2 FKKKPTVQEQLRENDRTMRKTQRDLTRDRGQLEKEEKRIEMEIKKAAKQGNKQAATVLAKQLVAIRKQQTKSYSVGSKISAIGNQQKLMHSNMKMAGAMATTTKTMQQMNTVMDPQKTAKMMQEFERENMKMGMSEDMINDTLDDILGESGDEEESDAVVSQVLDEIGIEITGKMVHAPAAPSKGLGETSKSRVTDDDIERQLAALKDL 210          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 137.887 bits (346), Expect = 4.398e-39
Identity = 98/209 (46.89%), Postives = 144/209 (68.90%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAA-HSGRLGVKEST---KDEDLETQLARL 696
            S +KK    + ++   +E +  QR + +D+  LE +EK++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++EN+K+ MTE+M+N+TLD+IFNE G+EEE   ++N+VLDEIGIEI+ K+ +AP+A  S     K  T    DED+E QL  L
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKMVKAPSAGKSIPSAAKTKTANISDEDIERQLRAL 211          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Match: chmp2bb (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103024321])

HSP 1 Score: 137.887 bits (346), Expect = 5.202e-39
Identity = 97/214 (45.33%), Postives = 140/214 (65.42%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGR---------LGVKESTKDEDLETQLARL 696
            S +KK    + ++   +E +  QR + +D+  LE +EK+LE EIKK+AK GNK    +LAKQL+QLRKQKNR   ++ KV S++ Q K+M S +K+A AM TT KTM  +NK M P++    ++NF++E  K+ MTEEMMN+TLDD+F + G+EEE   ++N+VLDEIGIEI+ K++ AP+A  GR             +   DE++E QL  L
Sbjct:    3 SLFKKKTVDDVIKEQTKELRGTQRQITRDRAALEKQEKQLEMEIKKMAKSGNKDACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKLMHSQMKMAGAMGTTAKTMQAVNKKMDPQKTMQTMQNFQKETAKMEMTEEMMNDTLDDLFEDSGDEEESQDIVNQVLDEIGIEISGKMAHAPSA--GRKTPAAAAASTSKADGISDEEIERQLRAL 214          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 128.257 bits (321), Expect = 4.123e-35
Identity = 86/176 (48.86%), Postives = 128/176 (72.73%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKV 609
            S +KK    + ++   +E +  QR + +D+  LE +EK++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++EN+K+ MTE+M+N+TLD+IFNE G+EEE   ++N+VLDEIGIEI+ KV
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKV 178          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 128.257 bits (321), Expect = 4.123e-35
Identity = 86/176 (48.86%), Postives = 128/176 (72.73%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKV 609
            S +KK    + ++   +E +  QR + +D+  LE +EK++E EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++EN+K+ MTE+M+N+TLD+IFNE G+EEE   ++N+VLDEIGIEI+ KV
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKV 178          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:103027439])

HSP 1 Score: 77.7962 bits (190), Expect = 1.647e-16
Identity = 70/215 (32.56%), Postives = 126/215 (58.60%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK----------DEDLETQLARLK 699
            F ++  P+E +R  +R   +  RDL++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K MA MN+ +K  ++  ++  FE+++  + M EEMMN+ +DD   +E +EEE   V+++VLDE+G+ ++ ++S  P+   G L V    K          D DLE +L  L+
Sbjct:    5 FGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLNLSDELSGLPST-GGSLSVPAGKKAEPQPTLADADADLEERLNNLR 218          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Yeast
Match: DID4 (Class E Vps protein of the ESCRT-III complex; required for sorting of integral membrane proteins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthesized vacuolar enzymes to the vacuole, involved in endocytosis [Source:SGD;Acc:S000001485])

HSP 1 Score: 69.3218 bits (168), Expect = 2.709e-14
Identity = 73/225 (32.44%), Postives = 127/225 (56.44%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRK--QKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIF-XXXXXXXXXAMVINKVLDEIGIEINSK--------VSEAPAAHSGRLGVKE---------STKDEDLETQLARLK 699
            F K   P+E+++  +R  ++ QR+L ++K  LE+++KKL +EIKK AK G    A V AK L++ R   QK  NM+  ++  S+  QA  ++S+ ++  +M      +A MN+ M   ++  +   FE+++  +G  +E M+E +D++  +E   +EE   ++NKVLDEIG+++NS+        VS AP A +  +G+ E            D+DL+ +L  LK
Sbjct:    8 FGKNVTPQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQA--VRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFEKQSDLMGQRQEFMDEAIDNVMGDEVDEDEEADEIVNKVLDEIGVDLNSQLQSTPQNLVSNAPIAETA-MGIPEPIGAGSEFHGNPDDDLQARLNTLK 229          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Nematostella
Match: EDO42022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L3])

HSP 1 Score: 180.644 bits (457), Expect = 4.653e-56
Identity = 113/208 (54.33%), Postives = 150/208 (72.12%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRL--GVKESTKDEDLETQLARLKA 702
             ++KPDPKEQMR  +R+  + QR+L +DKN LE +EK+LEAEIKKLA+QGNKQ AT LAKQL+QLRKQKN+NM ++ K+  I  QA+ MQS   +A AM  T + M  MNK M P  +   L+NFE+E+ K+ M EEMM ETLD + +E G+EEE+  ++N+VLDE+GIE+  K++ AP AH  +L  G K ST D D+E  LA+LKA
Sbjct:    1 MFRKPDPKEQMRQQKRQLNRTQRELARDKNALERQEKQLEAEIKKLARQGNKQAATALAKQLLQLRKQKNKNMSVSSKITGIGYQAQAMQSTATMAGAMSKTSQAMGAMNKQMDPASLQKTLQNFERESAKMDMNEEMMGETLDSVLDESGDEEEQDAIVNQVLDELGIEMAGKMASAPTAHGSKLSSGSKASTSDADIEEMLAKLKA 208          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Nematostella
Match: EDO43581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY62])

HSP 1 Score: 72.7886 bits (177), Expect = 3.386e-15
Identity = 57/184 (30.98%), Postives = 113/184 (61.41%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSG 636
            F +K  P+E ++  +R   +  RDL+++++ +E +EKK+  +IKK+AK G      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K MA MN+ +K  E+  ++  FE+++  + M EEMMN+ +DD+  +E ++EE   ++ +V DE+G+++  ++S  P   SG
Sbjct:    7 FGRKKTPEEMLKQNQRALNRAMRDLDRERSKMEQQEKKIINDIKKMAKMGQMDAVRIMAKDLVRTRRYVKKFILMKANIQAVSLKIQTLRSNNAMAQAMKGVTKAMATMNRQLKLPEIQKIMMEFEKQSEIMDMKEEMMNDAIDDVIGDEEDDEESEKLVQQVFDELGLQLTDELSGLPVTASG 190          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Nematostella
Match: EDO34240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPW3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.224e-8
Identity = 41/144 (28.47%), Postives = 77/144 (53.47%), Query Frame = 1
Query:   94 KPDPKEQMR----TTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETL 513
            K  PKEQ+R    T  +EN+++ R +   +N     ++ ++   K    +G+K    +LAK++IQ RK  N+      ++ S+  Q K   + +++A AM+ + + M+ M K++K  E+   +    +E MK G+ EEM+ +T 
Sbjct:    9 KKTPKEQVREWCATVRKENRQLDRQIRAIQNEEMKVKRSIKDAAK----RGDKDVCNILAKEIIQSRKAVNKMYSSKAQLNSVEMQMKNQLATLRMAGAMEKSTEVMSMMQKLVKLPEIRQTMMELSKEMMKAGIIEEMVEDTF 148          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Medaka
Match: chmp2ba (charged multivesicular body protein 2B [Source:NCBI gene;Acc:101166263])

HSP 1 Score: 147.132 bits (370), Expect = 1.233e-42
Identity = 98/210 (46.67%), Postives = 146/210 (69.52%), Query Frame = 1
Query:   82 SFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTK-----DEDLETQLARL 696
            S +KK    + ++   +E +  QR + +D+  LE +EK+LE EIKK+AK GN++   +LAKQL+QLRKQKNR   ++ KV S++ Q KVM S +K+A AM TT KTM  +NK M P++    +++F++ENMK+GMTE+M+N+TLD+IF+E G+EEE   ++++VLDEIGIEI+ K+ +APAA     G   S+K     D+++E QL  L
Sbjct:    3 SLFKKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQLELEIKKMAKSGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLKTMQDFQKENMKMGMTEDMINDTLDEIFDESGDEEESEDIVSQVLDEIGIEISGKMIKAPAAGKSVPGAASSSKQATISDDEIERQLRAL 212          
BLAST of Charged multivesicular body protein 2b vs. Ensembl Medaka
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:101157403])

HSP 1 Score: 75.8702 bits (185), Expect = 8.175e-16
Identity = 65/195 (33.33%), Postives = 119/195 (61.03%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDE 669
            F K+  P+E +R  +R   +  RDL++++  LE +EKK+ A+IKK+AKQG      ++AK L++ R+   + + M   + +++ + + ++SN  +A AMK   K MA MN+ +K  ++  ++  FE+++  + M EEMMN+ +DD   +E +EEE   ++++VLDE+G+ ++ ++S  P+   G L V    K E
Sbjct:    5 FGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMKANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSELMDMKEEMMNDAIDDAMGDEDDEEESDAIVSQVLDELGLNLSDELSSLPST-GGSLSVAGGKKAE 198          
BLAST of Charged multivesicular body protein 2b vs. Planmine SMEST
Match: SMESG000054476.1 (SMESG000054476.1)

HSP 1 Score: 356.295 bits (913), Expect = 7.763e-125
Identity = 207/209 (99.04%), Postives = 208/209 (99.52%), Query Frame = 1
Query:   79 MSFWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 705
            MSFWKKPDPKEQMRTTERENKKVQRDLN+DKNHLEMEEKKLEAEIKKLAKQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMA MLKNFEQENMKLGMTEEMMNETLDDIFNEEGNEEEEAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL
Sbjct:    1 MSFWKKPDPKEQMRTTERENKKVQRDLNRDKNHLEMEEKKLEAEIKKLAKQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMAKMLKNFEQENMKLGMTEEMMNETLDDIFNEEGNEEEEAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLETQLARLKAL 209          
BLAST of Charged multivesicular body protein 2b vs. Planmine SMEST
Match: SMESG000005024.1 (SMESG000005024.1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.242e-17
Identity = 77/225 (34.22%), Postives = 124/225 (55.11%), Query Frame = 1
Query:   85 FWKKPDPKEQMRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVS--------------EAPAAHSGRLG------VKESTKDEDLETQLARLK 699
            F K+  P++ MR  +R   K  R+L++++  LE EEKK+  +IKK+AKQG      ++AK L++ R    + + M   + +++ + + ++S   +A AMK   +TM  MNK M   ++  ++  FE+E+  + M EEMM +T+DD   EEG+EEE   ++N+VLDE+GIEI   +S                PAA+              +  D+DLE +LARLK
Sbjct:    5 FGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSNAGDDDDLEARLARLK 229          
BLAST of Charged multivesicular body protein 2b vs. Planmine SMEST
Match: SMESG000005024.1 (SMESG000005024.1)

HSP 1 Score: 73.559 bits (179), Expect = 3.706e-15
Identity = 74/215 (34.42%), Postives = 118/215 (54.88%), Query Frame = 1
Query:  115 MRTTERENKKVQRDLNKDKNHXXXXXXXXXXXXXXXXXQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVS--------------EAPAAHSGRLG------VKESTKDEDLETQLARLK 699
            MR  +R   K  R+L++++  LE EEKK+  +IKK+AKQG      ++AK L++ R    + + M   + +++ + + ++S   +A AMK   +TM  MNK M   ++  ++  FE+E+  + M EEMM +T+DD   EEG+EEE   ++N+VLDE+GIEI   +S                PAA+              +  D+DLE +LARLK
Sbjct:    2 MRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSNAGDDDDLEARLARLK 216          
BLAST of Charged multivesicular body protein 2b vs. Planmine SMEST
Match: SMESG000066797.1 (SMESG000066797.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.513e-8
Identity = 41/113 (36.28%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  403 ANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFXXXXXXXXXAMVINKVLDEIGIEINSKVS--EAPA-------AHSGRLGV--KESTKDE-DLETQLARLKAL 705
            AN+  +     M  +L  FE+E+  + + +EMMN+ LDD+   +  E+ +  +IN+V DE+GIE+NSK++  E P         +SG++ V   E+  DE DLE +LA LK +
Sbjct:   67 ANIQAISYERAMQKVLMEFEKESAVMEIKDEMMNDALDDVMEADDEEDMDK-IINQVFDELGIEMNSKLAFLETPGNTELKKPENSGKINVPSAEAGVDENDLEARLANLKKI 178          
The following BLAST results are available for this feature:
BLAST of Charged multivesicular body protein 2b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHMP2B1.444e-4047.12charged multivesicular body protein 2B [Source:HGN... [more]
CHMP2B4.886e-4049.37charged multivesicular body protein 2B [Source:HGN... [more]
CHMP2B1.319e-2855.10charged multivesicular body protein 2B [Source:HGN... [more]
CHMP2B3.716e-2540.38charged multivesicular body protein 2B [Source:HGN... [more]
CHMP2A6.799e-1432.45charged multivesicular body protein 2A [Source:HGN... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C01A2.44.503e-3944.23pep chromosome:WBcel235:I:13392118:13394001:1 gene... [more]
vps-23.127e-1329.35Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-243.428e-1129.47Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-243.428e-1129.47Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-243.428e-1129.47Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CHMP2B8.263e-4347.09gene:FBgn0035589 transcript:FBtr0077166[more]
Vps25.705e-1634.04gene:FBgn0039402 transcript:FBtr0084967[more]
Vps241.961e-1028.24gene:FBgn0037231 transcript:FBtr0078958[more]
Vps241.961e-1028.24gene:FBgn0037231 transcript:FBtr0347550[more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp2ba5.312e-3947.51charged multivesicular body protein 2Ba [Source:ZF... [more]
chmp2ba5.312e-3947.51charged multivesicular body protein 2Ba [Source:ZF... [more]
chmp2bb7.531e-3945.93charged multivesicular body protein 2Bb [Source:NC... [more]
chmp2ba8.484e-3947.59charged multivesicular body protein 2Ba [Source:ZF... [more]
chmp2a4.356e-1733.02charged multivesicular body protein 2A [Source:NCB... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
chmp2b1.351e-4247.85charged multivesicular body protein 2B [Source:NCB... [more]
chmp2b1.431e-4146.73charged multivesicular body protein 2B [Source:NCB... [more]
nelfa4.400e-1532.82negative elongation factor complex member A [Sourc... [more]
coq67.676e-624.39coenzyme Q6 monooxygenase [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Chmp2b1.024e-4047.12charged multivesicular body protein 2B [Source:MGI... [more]
Chmp2b8.493e-4049.37charged multivesicular body protein 2B [Source:MGI... [more]
Chmp2a5.048e-1432.12charged multivesicular body protein 2A [Source:MGI... [more]
Chmp2a5.048e-1432.12charged multivesicular body protein 2A [Source:MGI... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F3A2|CHM2B_CHICK6.251e-4348.80Charged multivesicular body protein 2b OS=Gallus g... [more]
sp|Q6NVL7|CHM2B_XENTR7.158e-4247.85Charged multivesicular body protein 2b OS=Xenopus ... [more]
sp|Q7SYR0|CH2BA_XENLA2.040e-4147.85Charged multivesicular body protein 2b-A OS=Xenopu... [more]
sp|Q66IV6|CH2BB_XENLA6.194e-4146.89Charged multivesicular body protein 2b-B OS=Xenopu... [more]
sp|Q3SX42|CHM2B_BOVIN6.368e-4047.12Charged multivesicular body protein 2b OS=Bos taur... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A8V62.714e-5656.04Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A1I8H3V59.281e-5552.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A433SR963.393e-5454.50Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
V3ZTE34.724e-5354.25Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
K1Q6291.080e-5255.02Charged multivesicular body protein 2b OS=Crassost... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp2ba4.398e-3946.89charged multivesicular body protein 2b [Source:NCB... [more]
chmp2bb5.202e-3945.33charged multivesicular body protein 2b [Source:NCB... [more]
chmp2ba4.123e-3548.86charged multivesicular body protein 2b [Source:NCB... [more]
chmp2ba4.123e-3548.86charged multivesicular body protein 2b [Source:NCB... [more]
chmp2a1.647e-1632.56charged multivesicular body protein 2A [Source:NCB... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DID42.709e-1432.44Class E Vps protein of the ESCRT-III complex; requ... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO420224.653e-5654.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435813.386e-1530.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342401.224e-828.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
chmp2ba1.233e-4246.67charged multivesicular body protein 2B [Source:NCB... [more]
chmp2a8.175e-1633.33charged multivesicular body protein 2A [Source:NCB... [more]
back to top
BLAST of Charged multivesicular body protein 2b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000054476.17.763e-12599.04SMESG000054476.1[more]
SMESG000005024.11.242e-1734.22SMESG000005024.1[more]
SMESG000005024.13.706e-1534.42SMESG000005024.1[more]
SMESG000066797.12.513e-836.28SMESG000066797.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018460 ID=SMED30018460|Name=Charged multivesicular body protein 2b|organism=Schmidtea mediterranea sexual|type=transcript|length=962bp
ATCACTTATAATTTAATAAATTAATAGTTATTTAAATTTCGCTTTAATAA
TTTTTTCCATAATTTAATTGTTATTACTATGTCATTTTGGAAAAAACCTG
ATCCTAAAGAGCAAATGCGAACAACAGAGAGAGAAAATAAAAAAGTTCAG
AGGGATTTAAATAAAGATAAAAATCATTTAGAAATGGAAGAGAAAAAATT
GGAAGCCGAAATCAAGAAGTTAGCCAAACAAGGAAACAAACAAGGTGCCA
CTGTATTAGCCAAACAGCTAATCCAGCTAAGGAAACAGAAAAATAGAAAT
ATGGAAATGAACATGAAAGTAGGATCAATTACAAACCAAGCTAAAGTGAT
GCAATCAAATATCAAACTGGCTGATGCTATGAAAACAACAGGTAAAACAA
TGGCTAACATGAACAAAGTAATGAAACCTGAAGAAATGGCTAATATGTTG
AAAAATTTTGAGCAAGAAAATATGAAATTAGGAATGACTGAGGAAATGAT
GAATGAAACTCTCGATGATATCTTTAATGAGGAAGGTAATGAAGAAGAAG
AAGCAATGGTTATAAATAAAGTGCTTGATGAAATTGGTATTGAGATCAAT
AGCAAGGTATCCGAGGCTCCAGCAGCTCATTCTGGTAGATTGGGTGTTAA
AGAATCGACAAAAGATGAAGATTTAGAAACTCAGTTAGCAAGATTAAAAG
CTTTATAATACTCTTAAATGAATTTTAAAGATGAAAAAGTTCAGATGTTT
TAACTATCAAATTAAATCTATTCAATGTAATACATTTATTTTCTATAAGA
TTGGTTGTTTTTGGCTTCGAGTTTCGCTTATTGTTAATATTTCATGAAGT
ATTATTCAGATATACTTGAAATAATTTATCAGAATTACAAAAAATGGTGT
TTTCTTTTTTATTAATTTATTTGGTTATTATTCAAAACAAATTTTGATTG
GTTCGGATTATC
back to top

protein sequence of SMED30018460-orf-1

>SMED30018460-orf-1 ID=SMED30018460-orf-1|Name=SMED30018460-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MSFWKKPDPKEQMRTTERENKKVQRDLNKDKNHLEMEEKKLEAEIKKLAK
QGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADA
MKTTGKTMANMNKVMKPEEMANMLKNFEQENMKLGMTEEMMNETLDDIFN
EEGNEEEEAMVINKVLDEIGIEINSKVSEAPAAHSGRLGVKESTKDEDLE
TQLARLKAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR005024Snf7_fam
Vocabulary: biological process
TermDefinition
GO:0007034vacuolar transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 13..54
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availablePANTHERPTHR10476:SF9CHARGED MULTIVESICULAR BODY PROTEIN 2Bcoord: 3..208
NoneNo IPR availablePANTHERPTHR10476CHARGED MULTIVESICULAR BODY PROTEINcoord: 3..208
IPR005024Snf7 familyPFAMPF03357Snf7coord: 21..184
e-value: 6.1E-29
score: 100.8