Rhodopsin-like orphan GPCR

Overview
NameRhodopsin-like orphan GPCR
Smed IDSMED30018459
Length (bp)1216
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rhodopsin-like orphan GPCR (SMED30018459) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rhodopsin-like orphan GPCR (SMED30018459) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018459

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018459h1SMcG0014615 dd_Smed_v4_88662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018459h1SMcG0014615 dd_Smed_v4_88662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018459h1SMcG0014615 dd_Smed_v4_88662_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Match: A0A193KUU9 (GCR149 OS=Schmidtea mediterranea OX=79327 GN=gcr149 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.861e-27
Identity = 34/77 (44.16%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  269 FDTIIGIMSGYINPIMSIFGIFINCFAIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGNS 499
             D++IG  SGYI P+ SI G+FIN +AI+ + +   N  QK YLI++A+ D+  + +  W++ FP  GLP++TNG S
Sbjct:   48 LDSVIGNWSGYILPLFSIVGLFINIYAIYKFNQIKQNIDQKTYLIAIAVFDIIGSSMLTWLYYFPAVGLPYVTNGKS 124          

HSP 2 Score: 75.485 bits (184), Expect = 1.861e-27
Identity = 67/222 (30.18%), Postives = 117/222 (52.70%), Query Frame = 3
Query:  495 ILFQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIK----FSRLRTKLQNQGGVKQRKLKSSEVRACLQXXXXXXXXXXXXXXMKTCYFSTLFID-DRFKQISLAKIGLIIELFYVGYLNVNFVTLL 1145
            I FQ S+  C+F+ +       FSFFI++F SID CL ++ P +    + K  L +VL +   N++  +PH   + L +V   KK  C   L  +    Y NY +F HPFG++ I L F+A ++++  + K     S +R K   +  V   KL   E++  +QIFILS+I+ ++   +K C+    +I+ +   +     +  I E+ ++ +LNV+ + L+
Sbjct:  127 IFFQKSNISCKFMQFNNDGSHGFSFFIMIFASIDSCLSIMAPSNGSTKSWKKPLCVVLIAVIWNLISCIPHILAYGLFYVD--KKFLCTDKLD-QNEYLYKNYTIFFHPFGVIYIWLSFMALLVILIVLQKRYDISSLIRRKNAYENSVNGEKL---EMKNAIQIFILSSISLVLAFLVK-CFDFAYYIEFNPLNKKVFESVSTIFEILFISHLNVHMLPLI 341          
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Match: A0A1I8FTE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 9.533e-15
Identity = 52/170 (30.59%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  495 ILFQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFV---GDLKKLYCGVSLPLKYSCFY--MNYAMFVHPFGMVLILLIFIA---NMIMMTSIIKFSRLRTKLQNQGGVKQRK---LKSSEVRACL 971
            +L   SD +C+   ++  F       +LL  +IDRCL V +PL   +    +A V VL+S  + IL  LP   +   T V   G    + CG+    K + +Y  M Y + V   G   ILLI  A   N+++   I+  +R R ++ N GG  Q +   L   E  A L
Sbjct:  178 LLMNDSDGVCKAARFVQAFSAVCVIIVLLAGAIDRCLTVHWPLWAHRLTRNHAFVGVLASVAAAILVSLPMVVIMGHTAVPMRGYNSSILCGIVFKPKSASYYAAMVYRLLVA--GDTSILLIAPALAVNVLITCRIVSITRQRRRVVNPGGWPQPRRPQLSREETSASL 345          

HSP 2 Score: 50.8322 bits (120), Expect = 9.533e-15
Identity = 24/80 (30.00%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  263 CIFDTIIGIMSGYINPIMSIFGIFINCFAIF-HYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGNS 499
            C   T++G++S Y  P+M    +  NC  I+    +  + SR  VYL +  + D   + +W +  +FP  G+PF+T G++
Sbjct:   96 CALATMLGVLSAYGLPLMFGLCLVSNCLVIYVCIVRLRLESRFSVYLCAFCLCDTVQSLVWGFAWVFPARGVPFMTRGSA 175          
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Match: A0A3S5CMM6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS26816 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.429e-11
Identity = 28/80 (35.00%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  263 CIFDTIIGIMSGYINPIMSIFGIFINCFAIFHYRKCYMN-SRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGNS 499
            CI   I+G++S YI P++ + G+ +NC   F + +C+   +RQ +YL  LA++D  T  ++ W+ +FP  G+P+ T+G +
Sbjct:   37 CILSRILGVLSAYIFPVIGLLGLLVNCLTAFIFLRCFRTPTRQMIYLACLAVSDGLTILLFGWLWVFPAKGIPYATDGKT 116          

HSP 2 Score: 26.5646 bits (57), Expect = 6.429e-11
Identity = 28/144 (19.44%), Postives = 61/144 (42.36%), Query Frame = 3
Query:  522 CRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSS 953
            CR   +   F       I L  ++DRC+ +  PL   +   K A  ++L+    + +  LP F +    +     K+ C ++   +   F   Y +     G +  +LI   N+ ++  + + + LR +L  +    ++++ +S
Sbjct:  128 CRIHRWAYSFTSCLGNNIFLLTTLDRCMSIYLPLKFSRLPQKRAWQMLLAITLVSGVMMLP-FGISTGLYPTQGNKVICWLT---EDQTFLQLYHVLFANAGFLQTVLIIAFNLALLIRLRQNALLRKQLTCKFTTGRKEVSAS 267          
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Match: A0A183LUD7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS7412 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.187e-10
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  263 CIFDTIIGIMSGYINPIMSIFGIFINCF-AIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGN 496
            CI  +I+G +S YI PI S FGI  N   A+        +SRQ +Y+ +LAI D  T  ++ W+ +FP  GLP+ T GN
Sbjct:   34 CITSSILGFLSAYIFPIYSTFGIISNILIAVIFICLIPNSSRQMIYMGALAITDALTQILFGWLWVFPSKGLPYATLGN 112          

HSP 2 Score: 36.965 bits (84), Expect = 3.187e-10
Identity = 42/154 (27.27%), Postives = 67/154 (43.51%), Query Frame = 3
Query:  501 FQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMN-YAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSSEV 959
            F IS+ LCRF  +   F       +LL  +IDRCL V  P+   K   + A  +++     + L  LP+  V       +L  L C     L Y+  ++N Y  FV    ++  L +   N+  M  + K    R K  N   +++RK  S+ +
Sbjct:  118 FNISENLCRFHRFAYSFSCTLGGNLLLLMAIDRCLCVYMPVKYSKIPQRYAWYLIVLIIIISCLLMLPYGIVVGWHLSNNL--LICW----LNYNDLFLNIYHAFVSDSCLIQFLFVIGLNIAFMIKLRKLLNNRRKFIN--NIEERKELSASI 263          
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Match: A0A183K403 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS9721 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.413e-10
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  263 CIFDTIIGIMSGYINPIMSIFGIFINCF-AIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGN 496
            CI  +I+G +S YI PI S FGI  N   A+        +SRQ +Y+ +LAI D  T  ++ W+ +FP  GLP+ T GN
Sbjct:   34 CITSSILGFLSAYIFPIYSTFGIISNILIAVIFICLIPNSSRQMIYMGALAITDALTQILFGWLWVFPSKGLPYATLGN 112          

HSP 2 Score: 36.965 bits (84), Expect = 3.413e-10
Identity = 45/159 (28.30%), Postives = 69/159 (43.40%), Query Frame = 3
Query:  501 FQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNA-----LVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMN-YAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSSEV 959
            F IS+ LCRF  +   F       +LL  +IDRCL V  P+   K   + A     L+I++S      L  LP+  V       +L  L C     L Y+  ++N Y  FV    ++  L +   N+  M  + K    R K  N   +++RK  S+ +
Sbjct:  118 FNISENLCRFHRFAYSFSCTLGGNLLLLMAIDRCLCVYMPVKYSKIPQRYAWYLIGLIIIIS-----CLLMLPYGIVVGWHLSNNL--LICW----LNYNDLFLNIYHAFVSDSCLIQFLFVIGLNIAFMIKLRKLLNNRRKFNNN--LEERKELSASI 263          
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001380.1 (pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-1 gene:ENSPMAG00000001242.1 transcript:ENSPMAT00000001380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 6.853e-6
Identity = 40/155 (25.81%), Postives = 73/155 (47.10%), Query Frame = 3
Query:  501 FQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSL--PLKYSCF--YMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSS 953
            F  SDFLCR I Y+       S ++L+   +DR + +  PL   + + K +  ++  S F ++LF LP   +F ++ V +   + C      P     +  +M  ++F+ P    +I+LI+   MI   +   +  ++ K Q +G  +    KSS
Sbjct:  116 FNGSDFLCRAIKYLQILGMFASTYVLIMMGLDRYIAICHPLRTLRQSSKQSYQMIFVSWFLSMLFSLPQAFIFSMSEVENSGIIDCWAEFIKPWGTKAYITWMTGSVFIIP----VIILIWCYGMI---TFAIWKNIKAKTQ-EGDSRHNPAKSS 262          
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Match: SMESG000009155.1 (SMESG000009155.1)

HSP 1 Score: 129.028 bits (323), Expect = 1.805e-48
Identity = 80/209 (38.28%), Postives = 121/209 (57.89%), Query Frame = 3
Query:  510 SDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSSEVRACLQXXXXXXXXXXXXXXMKTCYFSTLFIDDRFKQISLAKIGLIIELFYVGYLNVNFV 1136
            SDF C+FIY  IYF +Q SF ILL CS+DRCL ++     R W+ K+A+ +++     N+L  LPH   FQ  F+ +++K  C V   ++ +  Y  Y    HPFG++ I L  + N++++  +   S+    ++N  G  Q K + SE+++C+QI ILS  +F   V M+  YFS + I D    IS+   GL IE+ YV  LNVNF+
Sbjct:  131 SDFFCKFIYSSIYFWNQMSFTILLACSVDRCLSIMIFFDSRHWSRKSAIKVIIGVVLWNVLSSLPHGFFFQKYFLPNIQKYVCAVYNFVELATLYSFYQTLFHPFGVIYITLNVLVNLLLIKIVFSHSKQLKLVRNSIGSGQSKRRVSEIKSCVQILILSLYSFFFIVAMRGTYFSMMVIGDPSISISMKNNGLFIEMLYVASLNVNFL 339          

HSP 2 Score: 83.1889 bits (204), Expect = 1.805e-48
Identity = 40/117 (34.19%), Postives = 67/117 (57.26%), Query Frame = 2
Query:  146 EIVRKEFLHQDAQNPYTPVLYCSISDFLGENATISIVETCIFDTIIGIMSGYINPIMSIFGIFINCFAIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGN 496
            +IV K     ++ N Y+   +C++      N ++   + C +D I  IMSG++NPI SI G+ IN   IF++ K    +R  +YL ++A  +   N  W W+H+FP++GLPF+T+  
Sbjct:    7 QIVIKYLASDESPNRYSTQFHCAVIRLDLPNNSLPYWKYCQYDRIFSIMSGFVNPIFSILGLIINIIVIFYFSKIGF-TRHTIYLSAIAGTETILNLFWTWIHLFPMWGLPFMTDSK 122          
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Match: SMESG000009162.1 (SMESG000009162.1)

HSP 1 Score: 126.331 bits (316), Expect = 4.761e-48
Identity = 84/212 (39.62%), Postives = 119/212 (56.13%), Query Frame = 3
Query:  495 ILFQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSSEVRACLQXXXXXXXXXXXXXXMKTCYFSTLFIDDRFKQISLAKIGLIIELFYVGYLNVN 1130
            IL   S   C+F+Y  I+F    SF ILLFCSIDRCL +L PL CR W+ K+A+ IV+ S   N +  +PH   F+L +    K++ C        S  Y  Y +   PFG+V I++    N I++ SI K S+L    +N   +   KL+ SE+++C+QI  LS++ FL  ++MK  Y+S+ F    F  I L KIG + EL YV  LN N
Sbjct:   73 ILSSQSRIFCKFVYTTIFFWQDMSFLILLFCSIDRCLSILMPLDCRTWSYKSAISIVILSVVWNFINCIPHLLTFELYYDIQSKQMKCFPYALGTMSDMYSFYHILFSPFGLVYIMIDIGVNGILVKSIWKHSKLIKFDKNNNTITTGKLRKSEIKSCIQICSLSSLHFLFVISMKMSYYSSQF----FPNIFLDKIGFMFELLYVASLNFN 280          

HSP 2 Score: 84.7297 bits (208), Expect = 4.761e-48
Identity = 38/69 (55.07%), Postives = 50/69 (72.46%), Query Frame = 2
Query:  290 MSGYINPIMSIFGIFINCFAIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGN 496
            M+GY NP+MS  G+FIN   ++ +      +RQKVYL +LAI+D+ TN IW WMH+FP FGLPFI+NG 
Sbjct:    1 MTGYFNPLMSCLGLFINILIVYRFIINSRITRQKVYLSALAISDVSTNIIWTWMHLFPAFGLPFISNGQ 69          
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Match: SMESG000009159.1 (SMESG000009159.1)

HSP 1 Score: 77.411 bits (189), Expect = 9.512e-31
Identity = 34/77 (44.16%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  269 FDTIIGIMSGYINPIMSIFGIFINCFAIFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNGNS 499
             D++IG  SGYI P+ SI G+FIN +AI+ + +   N  QK YLI++A+ D+  + +  W++ FP  GLP++TNG S
Sbjct:   48 LDSVIGNWSGYILPLFSIVGLFINIYAIYKFNQIKQNIDQKTYLIAIAVFDIIGSSMLTWLYYFPAVGLPYVTNGKS 124          

HSP 2 Score: 75.485 bits (184), Expect = 9.512e-31
Identity = 67/222 (30.18%), Postives = 117/222 (52.70%), Query Frame = 3
Query:  495 ILFQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIK----FSRLRTKLQNQGGVKQRKLKSSEVRACLQXXXXXXXXXXXXXXMKTCYFSTLFID-DRFKQISLAKIGLIIELFYVGYLNVNFVTLL 1145
            I FQ S+  C+F+ +       FSFFI++F SID CL ++ P +    + K  L +VL +   N++  +PH   + L +V   KK  C   L  +    Y NY +F HPFG++ I L F+A ++++  + K     S +R K   +  V   KL   E++  +QIFILS+I+ ++   +K C+    +I+ +   +     +  I E+ ++ +LNV+ + L+
Sbjct:  127 IFFQKSNISCKFMQFNNDGSHGFSFFIMIFASIDSCLSIMAPSNGSTKSWKKPLCVVLIAVIWNLISCIPHILAYGLFYVD--KKFLCTDKLD-QNEYLYKNYTIFFHPFGVIYIWLSFMALLVILIVLQKRYDISSLIRRKNAYENSVNGEKL---EMKNAIQIFILSSISLVLAFLVK-CFDFAYYIEFNPLNKKVFESVSTIFEILFISHLNVHMLPLI 341          
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Match: SMESG000022976.1 (SMESG000022976.1)

HSP 1 Score: 61.2326 bits (147), Expect = 5.454e-15
Identity = 38/92 (41.30%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  236 NATISIVET---CIFDTIIGIMSGYINPIMSIFGIFIN--CFAIFHYR-KCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNG 493
            N TI    T   CI   I+G+ SGYI P + +FGI  N   F +F  R    + +RQ +YL +LAIAD F+   + W+ +FP  GLP+I+ G
Sbjct:   26 NTTIEDERTSALCISSHILGVFSGYIFPFVGVFGIIFNFMIFYVFMIRYPPKLRTRQLIYLSALAIADNFSIITFGWLWIFPAKGLPYISKG 117          

HSP 2 Score: 38.5058 bits (88), Expect = 5.454e-15
Identity = 38/159 (23.90%), Postives = 67/159 (42.14%), Query Frame = 3
Query:  501 FQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKN--ALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSCFYMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQRKLKSSEVRACL 971
            F  ++  C+   YI  F    +  + L  SIDRCL +  PL   K  GK     ++ +++  S IL  +  FA+     V     + C +    +++     Y +     G +  + I   N+ ++  +     LR +L+NQ G       S E+ AC+
Sbjct:  124 FNENNPTCKAHRYIYSFASTLAVNLFLLTSIDRCLSIYKPLKYSK-KGKTFAWTLVAITTVISGIL--MTPFAIIISLNVNKQNLIICWID-DARFAVSGQLYHVLFSNCGFIQTIAIITVNLALLYKLKNGQELRKELRNQTGS-----ASKEISACI 273          
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Match: SMESG000055742.1 (SMESG000055742.1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.550e-9
Identity = 37/108 (34.26%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  182 QNPYTPVLYCSISDFLGENATISIVETCIFDTIIGIMSGYINPIMSIFGIFIN---CFA-IFHYRKCYMNSRQKVYLISLAIADMFTNQIWVWMHMFPVFGLPFITNG 493
              PY  + +C   D   EN   S  + C+   I GI+S YI PI + FG   N   C+  I  Y K    +RQ + L  L+ AD+       W+ MFP  GLP+ + G
Sbjct:   15 DTPYDLLYFCHSED---ENNPKSDTQLCVLSHIFGIISVYIFPIFASFGFISNLLICYIFIVKYSK---KTRQTILLAVLSFADLLFILSLGWLWMFPAKGLPYASQG 116          

HSP 2 Score: 26.1794 bits (56), Expect = 4.550e-9
Identity = 20/65 (30.77%), Postives = 30/65 (46.15%), Query Frame = 3
Query:  468 LVYHS*PMVILF--QISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKWNGKNAL 656
            L Y S  M+ LF   +SDF CR       F   + F   L   +DR L + +P+    +  K+A+
Sbjct:  110 LPYASQGMIYLFIINLSDFSCRLFRGFCSFSFSWIFGAFLLVCLDRMLAIYYPMKMINFGYKSAV 174          
The following BLAST results are available for this feature:
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUU91.861e-2744.16GCR149 OS=Schmidtea mediterranea OX=79327 GN=gcr14... [more]
A0A1I8FTE79.533e-1530.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S5CMM66.429e-1135.00G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183LUD73.187e-1041.77G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183K4033.413e-1041.77G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001380.16.853e-625.81pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-... [more]
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin-like orphan GPCR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009155.11.805e-4838.28SMESG000009155.1[more]
SMESG000009162.14.761e-4839.62SMESG000009162.1[more]
SMESG000009159.19.512e-3144.16SMESG000009159.1[more]
SMESG000022976.15.454e-1541.30SMESG000022976.1[more]
SMESG000055742.14.550e-934.26SMESG000055742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018459 ID=SMED30018459|Name=Rhodopsin-like orphan GPCR|organism=Schmidtea mediterranea sexual|type=transcript|length=1216bp
TTTGCCAATATTAGCGACTCAAACAAAGAATATTGACTTGAACTCATTTA
AACAACAGTAGTATCAACAGCATCAATTTAATATATATTTGAAATAATTG
AAATTCTTCTAGAAATTTTCCTGTAAGAACAAAATGACATCAAAAGAAAT
CGTGAGAAAAGAATTTTTACACCAAGATGCCCAAAACCCTTACACTCCTG
TCCTGTACTGTTCCATTTCAGATTTCCTGGGAGAAAATGCTACCATAAGC
ATCGTAGAGACTTGTATATTTGATACAATAATTGGCATAATGAGTGGATA
CATCAATCCAATTATGAGTATTTTTGGGATTTTTATTAATTGCTTTGCAA
TTTTTCATTACCGAAAATGTTACATGAATTCTCGTCAGAAGGTTTATTTG
ATTTCCTTGGCAATCGCTGATATGTTTACAAATCAAATCTGGGTATGGAT
GCACATGTTCCCCGTGTTTGGTTTACCATTCATAACCAATGGTAATTCTA
TTCCAAATTAGTGATTTCCTATGTAGATTTATTTATTATATCATATATTT
TGTGGATCAGTTTTCATTTTTCATTCTTTTATTCTGTTCGATAGACAGAT
GTCTCGTGGTCCTGTTTCCTTTGCATTGTCGAAAATGGAACGGAAAAAAC
GCTCTCGTTATCGTTTTGAGTTCAGCGTTTAGTAATATTTTATTTGGATT
GCCTCATTTTGCGGTTTTTCAGTTGACATTTGTTGGAGACTTGAAAAAAC
TATATTGCGGCGTTAGTTTGCCATTGAAGTATTCGTGCTTTTACATGAAT
TATGCAATGTTCGTCCATCCGTTTGGAATGGTTTTGATCTTGTTGATATT
TATCGCTAATATGATTATGATGACTTCAATCATAAAATTTTCAAGGTTGA
GAACGAAATTACAAAATCAAGGTGGAGTAAAACAACGCAAATTGAAATCA
TCCGAAGTCAGGGCTTGTCTTCAGATTTTTATTTTGTCGACAATAACCTT
TCTGATAACCGTGACGATGAAAACTTGTTATTTTTCCACGCTTTTCATTG
ATGATAGATTTAAACAAATCTCATTGGCTAAAATTGGTTTAATAATTGAA
TTATTTTACGTGGGATATTTGAATGTCAATTTTGTTACATTATTGTTCCA
GGTGACTTGCGAGAAATTTAAACTTAACAATTGGGTCCCAACAACCAACA
CCAATTTCTCATCATG
back to top

protein sequence of SMED30018459-orf-1

>SMED30018459-orf-1 ID=SMED30018459-orf-1|Name=SMED30018459-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MTSKEIVRKEFLHQDAQNPYTPVLYCSISDFLGENATISIVETCIFDTII
GIMSGYINPIMSIFGIFINCFAIFHYRKCYMNSRQKVYLISLAIADMFTN
QIWVWMHMFPVFGLPFITNGNSIPN*
back to top

protein sequence of SMED30018459-orf-2

>SMED30018459-orf-2 ID=SMED30018459-orf-2|Name=SMED30018459-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MVILFQISDFLCRFIYYIIYFVDQFSFFILLFCSIDRCLVVLFPLHCRKW
NGKNALVIVLSSAFSNILFGLPHFAVFQLTFVGDLKKLYCGVSLPLKYSC
FYMNYAMFVHPFGMVLILLIFIANMIMMTSIIKFSRLRTKLQNQGGVKQR
KLKSSEVRACLQIFILSTITFLITVTMKTCYFSTLFIDDRFKQISLAKIG
LIIELFYVGYLNVNFVTLLFQVTCEKFKLNNWVPTTNTNFSS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 5..185
e-value: 3.4E-9
score: 36.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 2..229
e-value: 1.3E-14
score: 55.9
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 8..228
NoneNo IPR availablePANTHERPTHR24243:SF208ETHR, ISOFORM Acoord: 8..228
NoneNo IPR availableCDDcd151967tmA_Vasopressin_Oxytocincoord: 5..84
e-value: 9.96097E-7
score: 46.459
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 5..185
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
NoneNo IPR availableTMHMMTMhelixcoord: 163..185
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 1..173
score: 12.588