TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30018449
Length (bp)1536
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30018449) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30018449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018449SMESG000014923.1 SmedASXL_006081SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018449SMESG000014923.1 SmedASXL_006080SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018449SMESG000014923.1 dd_Smed_v4_25112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018449SMESG000014923.1 dd_Smed_v4_20034_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018449SMESG000014923.1 dd_Smed_v6_20034_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018449SMESG000014923.1 dd_Smed_v6_25112_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018449SMESG000014923.1 OX_Smed_1.0.01058ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 121.324 bits (303), Expect = 5.436e-29
Identity = 90/341 (26.39%), Postives = 163/341 (47.80%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKI-KDESQKKQSLLY---DLQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQ--HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DH+  C K  V C +  IGC E  V  E+  +H +              Q L+  +A++     E K +  D+S     LL     L+ K + F+     + +  E + +  +    +H+L+    Q  ++  +++ Q +                +R   +    +  LE++ L M+   + G   WKI +F +KR+EA +G I  I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P  D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:  201 KFQDHVKTCGKCRVPCRFHAIGCLE-TVEGEKQQEHEV--------------QWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLD----QDKIEALSSKVQQL----------------ERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 122.094 bits (305), Expect = 5.948e-29
Identity = 92/374 (24.60%), Postives = 170/374 (45.45%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMK-ECFEELKKIKD----------ESQKKQSLLYDLQDKISEFKR-----------------KFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++V CP   C     LR ++  H++ C      C +   GC  +G   +++I  H       H   L     +L+ +++L++ E  E+ K I+           E ++++ +L + + KI   +R                  F Q  +E   +K  ++  ++++ +L            N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  200 VVVSCPH-KCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQG--TNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 560          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 122.094 bits (305), Expect = 5.948e-29
Identity = 92/374 (24.60%), Postives = 170/374 (45.45%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMK-ECFEELKKIKD----------ESQKKQSLLYDLQDKISEFKR-----------------KFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++V CP   C     LR ++  H++ C      C +   GC  +G   +++I  H       H   L     +L+ +++L++ E  E+ K I+           E ++++ +L + + KI   +R                  F Q  +E   +K  ++  ++++ +L            N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  200 VVVSCPH-KCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQG--TNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 560          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 117.857 bits (294), Expect = 6.825e-28
Identity = 89/350 (25.43%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  315 VKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHL-IVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKK----QSLLYDLQDKISEFK---RKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            + C  P C+     + + DH+         C Y +  CS  K     I   + ++ N +  K     IQ+L N++   +   E  K++   ++ K    Q ++    +K+ E     R F Q  +E   +K  ++  ++++ +L            N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  146 LPCVRPDCKEKVLRKDLRDHVEKA------CKYREATCSHCKSQVPMIALQVSLLQNESVEKN--KSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 117.472 bits (293), Expect = 1.601e-27
Identity = 57/161 (35.40%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  858 LERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  379 LRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 72.7886 bits (177), Expect = 1.835e-13
Identity = 49/171 (28.65%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  876 SMKQHFGS-IQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKM--CLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQES-GDIHTSYKFNYDPV-LDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRI-----VLKCVVAPLKEK 1358
            +  + FG  + WKID   ++  EA+SG    I+S PF S++ GYKM  C  L  DG  AGK  ++S++  +++GE D  L+WP    + I +++Q    +   +  +  DP  L        +P+ + N  +G        +++N   +K+D+I     V +C   P++ K
Sbjct:  256 TCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGK--SISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQN--YVKDDKIYVQIDVDRCETLPVQLK 422          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 58.151 bits (139), Expect = 5.155e-9
Identity = 35/109 (32.11%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  963 DIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGY-DFIKLDEL 1286
             IYS+PFYS+  GYKM     P G         SVF  +M+GE D IL+WP + +VT  I++ +  ++ T  K  Y   + + +   ++P+   N  +G+ +F+ L ++
Sbjct:  182 SIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLT--KTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKV 288          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 83.9593 bits (206), Expect = 6.033e-17
Identity = 43/155 (27.74%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQ--ESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLK 1352
            G++ WKI +++ K  EA+     ++ S PFY+++ GYK+   +  +G   G+ T++SV+  ++ GE D +L+WP    +T  +  Q  +SG    +  F  DP  + ++   ++P     +G+G+      EL+ +   +K D + L+  V P K
Sbjct:  322 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPD---QLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 473          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 83.5741 bits (205), Expect = 8.171e-17
Identity = 43/155 (27.74%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQ--ESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLK 1352
            G++ WKI +++ K  EA+     ++ S PFY+++ GYK+   +  +G   G+ T++SV+  ++ GE D +L+WP    +T  +  Q  +SG    +  F  DP  + ++   ++P     +G+G+      EL+ +   +K D + L+  V P K
Sbjct:  331 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPD---QLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 482          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 54.6842 bits (130), Expect = 1.251e-7
Identity = 36/149 (24.16%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHL-FDKPKTDINV-GYGY-DFIKLDELIKNNKLLKNDRIVLK 1331
            G+I W+I+         ++     +YS   Y++ +GYK C +L     +  K   LS+   +M+ END  L WP K  + + +++     +       +D ++ K   L F KP+  I+  G+G+ ++  +  +I+      +DR+++K
Sbjct:  330 GTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARL---NIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLS-----QHDTIMTKPEILAFHKPREAISTRGFGFLEYANISNIIQLG-FCADDRLLIK 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 53.5286 bits (127), Expect = 2.602e-7
Identity = 45/183 (24.59%), Postives = 87/183 (47.54%), Query Frame = 3
Query:  822 RFSEILHGKLESL-ERET-LSMKQHFGSIQ-------WKIDNFTKKRKEAQSGIIADIYSEPFYSNKN-GYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            +    LH  ++++ + ET ++M+Q   S+Q       W+I +++KK +E++      I     +SNK  GY + L ++ +G    KG N+     ++ GE D +L WP +L+  I I +Q +         N     D  + +F + K+D  +     F    ++I +   L+ND + ++  V
Sbjct:  301 KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQ--YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT---------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 53.1434 bits (126), Expect = 3.350e-7
Identity = 45/183 (24.59%), Postives = 87/183 (47.54%), Query Frame = 3
Query:  822 RFSEILHGKLESL-ERET-LSMKQHFGSIQ-------WKIDNFTKKRKEAQSGIIADIYSEPFYSNKN-GYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            +    LH  ++++ + ET ++M+Q   S+Q       W+I +++KK +E++      I     +SNK  GY + L ++ +G    KG N+     ++ GE D +L WP +L+  I I +Q +         N     D  + +F + K+D  +     F    ++I +   L+ND + ++  V
Sbjct:  279 KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQ--YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT---------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 450          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 127.487 bits (319), Expect = 5.529e-31
Identity = 94/373 (25.20%), Postives = 168/373 (45.04%), Query Frame = 3
Query:  315 VKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-----------EGKVASERINDHLIVDNYTHAKT---------LVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLES----------LERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            V CP   C F   LR ++  H + C K  V C +   GCS           E   ASE +    + +    AK              + +L + +A ++  +EE+++   + ++K   L  +Q  +S    K ++   E   L+  L+    ++E LR  ++  ++   +     +         +   Q+ +   H  L S          L+ + L      G++ WKI ++ ++++EA       +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF +MRGE D +LQWP K +VT+ +++Q     H    F  DP    +R    +P  ++N+  G        +++N   +K+D I +K  V
Sbjct:  204 VACPN-HCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQK---LVSMQMLMSSHSEKLLEVEMELRELR-PLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTR--HDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFR----RPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTV 565          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 122.479 bits (306), Expect = 2.430e-29
Identity = 101/390 (25.90%), Postives = 173/390 (44.36%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQ-------------------------------KSDENIHLKLKLQQTEHKLEDLR---HQLDMKQNATEN-------QMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DHI  C K    C +  +GC +  V  E+I+DH    +Y H   L++ I  +K  +  ++    EL   K         +++L   + E + K  Q                                +     L+L+L   + K+ +L     +L++K N  EN       +M       E    +   +Q   EIL+ K+  LER                  +S   + G   WKI +F+KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  +++D I +K +V
Sbjct:  201 KYVDHIKLCTKFRTPCRFHVVGC-DMTVEKEKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHK---------IHELHQSLRELELKMGQLCGAGASVQGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 570          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 113.62 bits (283), Expect = 6.497e-28
Identity = 62/192 (32.29%), Postives = 105/192 (54.69%), Query Frame = 3
Query:  831 EILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            EIL+ K+  LER                  +S   + G   WKI +F+KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  +++D I +K +V
Sbjct:   89 EILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 113.62 bits (283), Expect = 6.497e-28
Identity = 62/192 (32.29%), Postives = 105/192 (54.69%), Query Frame = 3
Query:  831 EILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            EIL+ K+  LER                  +S   + G   WKI +F+KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  +++D I +K +V
Sbjct:   89 EILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 109.383 bits (272), Expect = 2.456e-26
Identity = 83/314 (26.43%), Postives = 151/314 (48.09%), Query Frame = 3
Query:  426 CSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKL-EDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            C   KV  E+I++H     + H   L++ I  +K  +  +     E  K+ D  ++ Q    DL+ K   F+     + +  E     ++    +H+L +D    L  K    E Q+               ++   +E + G+L  +   T       G   W+I +FTKKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +++N+  G   F  L +L   N  +++D I +K +V
Sbjct:    1 CLPSKVEKEKIHEHERACAHEHLNLLLHYIMGMKVSLEGL-----EKTKVADLGRRCQ----DLEVKAGTFEDVVCVLNREVERFATTMEASNRQHRLDQDKIEALSNKVRQLERQV-------------GVKDLTVAE-MEGRLREMSATTFD-----GVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQS----------NREHIIDAFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIV 276          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 123.635 bits (309), Expect = 6.187e-30
Identity = 120/476 (25.21%), Postives = 203/476 (42.65%), Query Frame = 3
Query:   87 TEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKF------CP---QNFDECKEEXXXXXXXXXXXXAANSRISRIIVK-----------CPEPS-----CEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTL--------VNCIQNLKNEMALM---KECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSD--------------ENIH--LKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            T++    +C  CKNLL+      CG RYC  C+   +  V +       CP   +  D     +            A     + I++           CPE       C+       I  H   C K  + C     GC   K+  E++   L V +++   TL        V C + ++N+  L    K   E L K+ D  Q  +    DL  ++       +Q S               ENI   L  +++++ H  E+L  QL   Q   E    ++      L           E++  +LE+  +E+  +  + G   WKI  F KKR++A +G    ++S PFY+NK GYKMCL+++ +G   G+ T+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P +++N+  G   F ++ +L   N  +++D I +K +V
Sbjct:   29 TKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAVCERSDWTGALISVGHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTCE----GCGRKKIPREKV--RLFVCSFSRNITLSLPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLS---VQGSPAPPFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQ--------KELIVAELETRMQES-ELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 121.709 bits (304), Expect = 7.289e-29
Identity = 98/376 (26.06%), Postives = 170/376 (45.21%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-----------EGKVASERINDHLIVDNYTHAKTLV---------NCIQNLKNEMALMKECFE-ELKKIKDESQKKQSLLYDLQ-------DKISEFK---RKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            +++ CP   C     LR ++  H+  C      C +   GC+           E   A + +N      NY  AK  +           IQ L N+M      FE E+++ K++ +  ++ +  LQ       DK+ +     R   Q  DE   +K   +  +++L  L  ++  K  A+ N  +     N   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +V++ +++Q     H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  195 VVISCPH-MCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMC----SFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQL--EVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 553          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 119.398 bits (298), Expect = 1.490e-28
Identity = 113/462 (24.46%), Postives = 194/462 (41.99%), Query Frame = 3
Query:   87 TEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKF------CP---QNFDECKEEXXXXXXXXXXXXAANSRISRIIVK-----------CPEPS-----CEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDL------QDKISEFKRKFIQKSDENIH-------LKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            T++    +C  CKNLL+      CG RYC  C+   +  V +       CP   +  D     +            A     + I++           CPE       C+       I  H   C K  + C     GC   K+  E++   + +     A   V C + ++N+     +C E   K   E   K S             K++E   KF     +N         L  +++++ H  E+L  QL       E  +                 Q+  E++  +LE+  +E+  +  + G   WKI  F KKR++A +G    ++S PFY+NK GYKMCL+++ +G   G+ T+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P +++N+  G   F ++ +L   N  +++D I +K +V
Sbjct:   29 TKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAVCERSDWTGALISVGHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTCE----GCGRKKIPREKVRLFVCMPCRYAA---VGCTEMVEND-----KCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTL----------------GQK--ELIVAELETRMQES-ELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 116.701 bits (291), Expect = 2.379e-27
Identity = 92/353 (26.06%), Postives = 159/353 (45.04%), Query Frame = 3
Query:  384 CDKKIVKCPYF--------------DIGCSEGKVASERINDHLIVDNYTHAKTLV---------NCIQNLKNEMALMKECFE-ELKKIKDESQKKQSLLYDLQ-------DKISEFK---RKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            C   ++ CP+                I   E   A + +N      NY  AK  +           IQ L N+M      FE E+++ K++ +  ++ +  LQ       DK+ +     R   Q  DE   +K   +  +++L  L  ++  K  A+ N  +     N   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +V++ +++Q     H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  192 CPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMC----SFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQL--EVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 528          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 97.8265 bits (242), Expect = 4.238e-21
Identity = 51/152 (33.55%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYD-FIKLDEL--IKNNKLLKNDRIVLKCVV 1340
            G + WKI ++ +K++EA  G    I+S+ FY++  GY++C + + +G  +GKG+ LS++F +M+GE D IL WP K +VT+ +++Q     H +  F  DP        F +P +++N+  G   F    +L   KN   +K+D + +K VV
Sbjct:  383 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSS----FKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 530          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 128.642 bits (322), Expect = 1.544e-31
Identity = 95/337 (28.19%), Postives = 160/337 (47.48%), Query Frame = 3
Query:  369 DHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDE-SQKKQSLLYD---LQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKL-EDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            DH+ AC K  V C +  +GCSE  V +E + DH +              Q L+  +AL+   F E +      +Q    LL     L+ KI+ F+     + +  E + +  +    +H+L +D    L  K    E  +        K    +D  Q+ SE             L +  + G   WKI +FT+KR+EA +G    I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +LQWP   +VT+ +++            N + V+D +R       F +P +D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:  211 DHVRACSKCRVLCRFHTVGCSE-MVETENLQDHEL--------------QRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSI------GLKDLAMADLEQKVSE-------------LEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHN----------NREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 128.257 bits (321), Expect = 1.773e-31
Identity = 95/337 (28.19%), Postives = 160/337 (47.48%), Query Frame = 3
Query:  369 DHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDE-SQKKQSLLYD---LQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKL-EDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            DH+ AC K  V C +  +GCSE  V +E + DH +              Q L+  +AL+   F E +      +Q    LL     L+ KI+ F+     + +  E + +  +    +H+L +D    L  K    E  +        K    +D  Q+ SE             L +  + G   WKI +FT+KR+EA +G    I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +LQWP   +VT+ +++            N + V+D +R       F +P +D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:  204 DHVRACSKCRVLCRFHTVGCSE-MVETENLQDHEL--------------QRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSI------GLKDLAMADLEQKVSE-------------LEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHN----------NREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 124.02 bits (310), Expect = 8.910e-30
Identity = 93/374 (24.87%), Postives = 171/374 (45.72%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMK-ECFEELKKIKD----------ESQKKQSLLYDLQDKISEFKR-----------------KFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++V CP   C     LR ++  H++ C      C +   GC  +G   +++I  H       H   L     +L+ +++L++ E  E+ K I+           E ++++ +L + + KI   +R                  F Q  +E   +K  ++  ++++ +L         A  N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  199 VVVSCPH-KCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQG--TNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 559          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 118.242 bits (295), Expect = 6.599e-28
Identity = 67/233 (28.76%), Postives = 117/233 (50.21%), Query Frame = 3
Query:  642 RKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            R F Q  +E   +K  ++  ++++ +L         A  N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  312 RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP----NSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 118.242 bits (295), Expect = 6.599e-28
Identity = 67/233 (28.76%), Postives = 117/233 (50.21%), Query Frame = 3
Query:  642 RKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            R F Q  +E   +K  ++  ++++ +L         A  N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  312 RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDP----NSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.240e-30
Identity = 95/337 (28.19%), Postives = 160/337 (47.48%), Query Frame = 3
Query:  369 DHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDE-SQKKQSLLYD---LQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKL-EDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            DH+ AC K  V C +  +GCSE  V +E + DH +              Q L+  +AL+   F E +      +Q    LL     L+ KI+ F+     + +  E + +  +    +H+L +D    L  K    E  +        K    +D  Q+ SE             L +  + G   WKI +FT+KR+EA +G    I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +LQWP   +VT+ +++            N + V+D +R       F +P +D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:  204 DHVRACSKCRVLCRFHTVGCSE-MVETENLQDHEL--------------QRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSI------GLKDLAMADLEQKVSE-------------LEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHN----------NREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 6.233e-29
Identity = 93/374 (24.87%), Postives = 171/374 (45.72%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMK-ECFEELKKIKD----------ESQKKQSLLYDLQDKISEFKR-----------------KFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++V CP   C     LR ++  H++ C      C +   GC  +G   +++I  H       H   L     +L+ +++L++ E  E+ K I+           E ++++ +L + + KI   +R                  F Q  +E   +K  ++  ++++ +L         A  N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  199 VVVSCPH-KCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQG--TNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 559          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 2.610e-28
Identity = 90/341 (26.39%), Postives = 163/341 (47.80%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKI-KDESQKKQSLLY---DLQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQ--HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DH+  C K  V C +  IGC E  V  E+  +H +              Q L+  +A++     E K +  D+S     LL     L+ K + F+     + +  E + +  +    +H+L+    Q  ++  +++ Q +                +R   +    +  LE++ L M+   + G   WKI +F +KR+EA +G I  I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P  D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:  201 KFQDHVKTCGKCRVPCRFHAIGCLE-TVEGEKQQEHEV--------------QWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLD----QDKIEALSSKVQQL----------------ERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.856e-28
Identity = 92/374 (24.60%), Postives = 170/374 (45.45%), Query Frame = 3
Query:  309 IIVKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMK-ECFEELKKIKD----------ESQKKQSLLYDLQDKISEFKR-----------------KFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++V CP   C     LR ++  H++ C      C +   GC  +G   +++I  H       H   L     +L+ +++L++ E  E+ K I+           E ++++ +L + + KI   +R                  F Q  +E   +K  ++  ++++ +L            N  +     +   +  S  + R +++       L  + L    + G + WKI ++ ++++EA  G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF IMRGE D +L WP K +VT+ +++Q S   H    F  DP        F KP  ++N+  G        +++N   +K+D I +K +V
Sbjct:  200 VVVSCPH-KCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQG--TNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADM------DLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSS----FKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 560          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.035e-25
Identity = 81/349 (23.21%), Postives = 173/349 (49.57%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCS-EGK----VASER--INDHLIV---DNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQ-----NATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQ-----HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKN--NKLLKNDRIVLKCVV 1340
            ++ +H+  C +    CP+   GC+ +GK    +  ER  + DH+++    NY   + + +  Q+L+ + + +++  E +KK + E  K+ + ++          +     +D++  L+ +++Q    +     +LD++      ++ + ++ +L   +++L     E  +    ++     L +     KQ     + G + WK+ ++  K++EA  G    ++S+PFY+++ GY++C + + +G  +GKGT+LS++F +MRGE D +LQWP +  VT+ +++Q     H    F  DP        F +P  ++N+  G         ++N  N  +K+D + LK  V
Sbjct:  207 RVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKEL-KQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSS----FKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.058e-50
Identity = 141/470 (30.00%), Postives = 237/470 (50.43%), Query Frame = 3
Query:   36 RYENIWRILSEYRVNSMTE-ISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNE-----------MALMKECFEELKKIKDES-----------QKKQSLLYDLQDKISEFKRKFI----QKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNA-TENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDIN---VGYG----YDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            + +N+  +LS+Y V  + E +++DL+C++C  L+++AC   CGC YC+ CI+ YL Q   +CP +  ECKE+ LN++ ++  +   ++RISRI+VKCP   C +  EL ++ +H++ C  + V+CP   IGC E  +  + +  HL      H + +++    LK+E           ++ +KE     K + DE            + K +++  L   I E K + I     K  E   LK  +Q    ++E +++ L++  +   +NQ+ +L  E   +K   D N    E     L  L +   ++   F    W+I+ ++KKR+      + D+YS+ F S  + YK CL L+        G NL ++  IM+GE D  L+WPM+  VT+ II Q+S   H +  F YD    + +  FD+PK + N   +G      Y +IK   +I     L ND I++ CVV
Sbjct:    5 KLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDF---MWRIEEYSKKRR-----TVTDVYSDSFQS--HNYKFCLNLYI------YGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYD-TYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMI-----LVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3L7HD98 (TNF receptor-associated factor OS=Cricetulus griseus OX=10029 GN=CgPICR_012378 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.631e-34
Identity = 118/465 (25.38%), Postives = 201/465 (43.23%), Query Frame = 3
Query:   87 TEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEE-------XXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELR---------------------------KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECF-EELKKIKDESQKKQSLL---YDLQDKISEFKRKF--IQKSDENIHLKLKLQQTEHKL-EDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            T++ +  +C  C+N+L+      CG RYC  C+ S L       PQN   C  E        +    +   DNAA   +  +   CP   C +   L+                           K  DH+ +C+K  V C +  +GCSE  V +E + DH +              + L+  +AL+   F E       +SQ    +L   + L+ K + F+     + +  E + +  +    +H+L +D    L  K    E  +        K    +D  Q+ SE             L    + G   WKI +F +KR+EA +G    I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P +D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:   26 TKLEAKYLCSACRNILRRPFQAQCGHRYCSFCLNSILSSG----PQNCAACVHEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYEVHYEVCPKFPLTCDGCGKKKISREKFQDHVRSCNKCRVPCRFHTVGCSE-MVENEELQDHEV--------------KKLREHLALLLSSFLESPASQGSQSQAGPEMLQRCHSLEQKTATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSI------GLKDLAMADLEQKVSE-------------LEASTYDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVTSSSFQRPLSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 442          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I3WEV1 (Tumor necrosis factor receptor-associated factor 3 OS=Pinctada fucata OX=50426 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.406e-33
Identity = 97/360 (26.94%), Postives = 179/360 (49.72%), Query Frame = 3
Query:  372 HINACDKKIVKCPYFDIGCS-EGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKL-QQTEH------KLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSE------ILHGKLESL-------ERE----------------TLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            H+  C K+  +C Y  +GC+ EG   SE +  H   D   H + +     N+  +   ++   +++   +D S++   LL D+  +++E KR       +   +KLK+  QTE       K+EDL  +  + ++A + Q+I     +   + +  E +  S+       + G   S+       ER+                 L    + G++ WKI ++++++++A +G    +YS+PFY+++ GYKMC +++ +G   G+GT+LS+FF IMRGE D +L WP K +VT+ +++Q++G  H S  F  DP    +R    KP T++NV  G        +++    ++ D I +K +V
Sbjct:  174 HLITCPKRPQRCRYHSVGCTFEG--TSEEVQQHERDDTDRHLELITMYTANMDLQSLEVRRELQDMSLERDNSRR---LLDDVSRQMAEIKRSMDDMKIQVRDVKLKIVSQTERIIHVERKVEDLAKKDSVDRHARDLQVIRETQASMSERIRQLEGRAPSQGNPAVPAIEGNTGSVVPQVQQHERQLGLQDIRLAELDLRFQVLETASYDGTLIWKIKDYSRRKQDAITGRTLSLYSQPFYTSRTGYKMCARVYLNGDGMGRGTHLSLFFVIMRGEYDTLLSWPFKQKVTLMLLDQDTGTRHLSDTFRPDPSSSSFR----KPTTEMNVASGCPLFVSHAVLETRTYVREDTIFIKIIV 524          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: B4DGI3 (TNF receptor-associated factor OS=Homo sapiens OX=9606 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.349e-32
Identity = 117/450 (26.00%), Postives = 198/450 (44.00%), Query Frame = 3
Query:   87 TEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEE-------XXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVK----CPYFDI---GCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRH----------QLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQ--HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            T++ +  +C  C+N+L+      CG RYC  C+ S L       PQN   C  E        +    +   DNAA   +  +   CP   C +   L+   ++ + C   +      CP F +   GC + K+  E+  DH+        KT   C    +       E  E  K+ + E Q  +  L  L   + E K     +S     L  + +  E K     +          ++ M   A   Q      + E L  K  + +R   +    +  LE++ L M+   + G   WKI +F +KR+EA +G I  I+S  FY+++ GYKMCL+++ +G   G+GT+LS+FF +M+G ND +L+WP   +VT+ +++Q           N + V+D +R       F +P  D+N+  G   F  + ++   N  +++D I +K +V
Sbjct:   26 TKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSG----PQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLK---EYESCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHV--------KTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN----------NREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 450          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A401RTZ6 (TNF receptor-associated factor OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0020091 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.421e-31
Identity = 104/412 (25.24%), Postives = 183/412 (44.42%), Query Frame = 3
Query:  111 CVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKN--NKLLKNDRIVLKCVV 1340
            C  C+ +L+NA    CG R+C  C+ + L    +FCP +                                          L     H+N+C  + ++C      C E  V  + ++DHL+      A    +C    + EM + +    EL+    E Q+K S L  L  +I + +++    +      ++KL Q+++    + +   +   +   Q+ +           S    R +EI       L  + L    + G + WKI ++ ++++EA SG    +YS+PFYS+  GYKMC +++ +G   GKGT+LS+FF +MRGE D +L WP K +VT+ +++Q     H S  F  DP    +R    +P++++NV  G        +++N  +  +K+D I +K  V
Sbjct:   56 CEHCQRVLRNAKQTECGHRFCESCLNALLRVPGQFCPAD---------------------------------------QQPLDNTEAHLNSCPFQTIQCSR----CPE-MVQRQELSDHLMFKCKRQAAQCRHC----QKEMTVAELKVSELE---SEIQEKHSALQKLAGQIPKMEKEMSLTNQSVNRSEIKLNQSQNIRITINYPWLLISESVGQQVTQHDNLL------SVHEVRLAEI------DLRFQLLETASYNGRLIWKIRDYARRKQEAVSGKTLSLYSQPFYSSSFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDPLLPWPFKQKVTLTLLDQGLAKAHVSDTFKPDPNSSSFR----RPQSEMNVASGCPLFVTQTVLENEMHHYIKDDTIFIKVTV 400          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 122.479 bits (306), Expect = 2.099e-29
Identity = 98/377 (25.99%), Postives = 174/377 (46.15%), Query Frame = 3
Query:  369 DHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKF-IQ--------------------KSDENIHLKLKLQQTEHKLEDLR---HQLDMKQNATEN-------QMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            DHI  C K    C +  +GC +  V  E+I+DH    +Y H   L++ I  +K  +  ++   + L+    + Q+    L +L+ K+ +      +Q                     +     L+L+L   + K+ +L     +L++K    EN       +M       E    +   +Q   EIL+ K+  LER                  +S   + G   WKI +F+KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  +++D I +K +V
Sbjct:  204 DHIKLCTKFRTPCRFHVVGC-DMSVEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQP--QSLELASHKIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTTVGAALELQLHSEKTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 567          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 2.381e-27
Identity = 51/149 (34.23%), Postives = 86/149 (57.72%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            G++ WKI ++ +++ EA +     +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF +MRGE D +L WP K +VT+ +++Q     H    F  DP    +R    +P  ++N+  G        +++N   +K+D I +K  V
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFR----RPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 114.775 bits (286), Expect = 3.704e-27
Identity = 62/192 (32.29%), Postives = 105/192 (54.69%), Query Frame = 3
Query:  831 EILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            EIL+ K+  LER                  +S   + G   WKI +F+KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  +++D I +K +V
Sbjct:  273 EILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 108.612 bits (270), Expect = 8.297e-25
Identity = 52/155 (33.55%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            G   WKI +F+++R++A +G    ++S  FYS+K GYKMCL+L+ +G   G+G++LS+FF +MRG+ D +L+WP   +VT+ +++Q           N + ++D +R       F +P +++N+  G   F  L +L   +  L++D I +K +V
Sbjct:  382 GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQN----------NREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 98.5969 bits (244), Expect = 1.461e-21
Identity = 80/338 (23.67%), Postives = 157/338 (46.45%), Query Frame = 3
Query:  390 KKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETL---SMKQHF---------GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDEL-IKNNKLLKNDRIVLKCVVAP 1346
            K+   C + +IGC+  K   +++ +H +     H   LV  ++N++  +    E   +   + D +     L  D  D  +  K   +      + +  +L   + +L+ + + +       E   + +++         +  Q    ++  + + L R+ L   S++Q           G+  W+I + ++K KEA +G  +  YS  FY+++ G+K+C++L+  G   GKGT++S+FF IM+G+ D +L WP K +VT  +I+Q             + V+D +R       F +P +++NV  G   F  L +L    +  +K+D + +KCVV P
Sbjct:  191 KRKETCVFSEIGCT-FKGNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPAL-DLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQN----------QREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVDP 516          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.410e-34
Identity = 92/364 (25.27%), Postives = 172/364 (47.25%), Query Frame = 3
Query:  315 VKCPEPSCEFHDELR-KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDE-SQKKQSLLYDLQ----------DKISEFKRKFIQKSDE--NIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSE---ILH-GKLESLER--ETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAP 1346
            + CP  +CE H   R ++  H++AC      C +  +GC+  +  SE + +H      +H   +++    L+ + A ++   E+   + +  +Q+   L  DL            ++        Q +++  ++H+  +  Q +     LR  +     AT  + +  L          +E     E    +H G L++ ER  + L    + G + WKI ++ ++++EA SG    +YS+PFY++  GYKMC + + +G   G+GT+LS+FF +MRGE D +L+WP +  VT+ +++Q +   H S  F  DP    +R    +P  D+NV  G         ++ +  L +D + ++ VV P
Sbjct:   61 LPCPN-NCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDM-----ATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFR----RPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVDP 414          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 7.599e-29
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 3
Query:  858 LERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            L  + L    + G + WKI ++ +++++A SG    +YS+PFY++  GY+MC + + +G   G+GT+LS+FF +MRGE D +L WP +  VT+ +++Q +     S  F  DP    +R    +P +D+N+  G         +++   L++D I +K VV
Sbjct:  313 LRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFR----RPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 70.8626 bits (172), Expect = 2.982e-13
Identity = 77/366 (21.04%), Postives = 150/366 (40.98%), Query Frame = 3
Query:  360 KIGDHINA-CDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLY-------DLQDKISEFKRKFIQKSDENIHLKL-KLQQTEHKLEDL----RHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEA-QSGIIAD---------IYSEPFYSNKNGYKMCLQLH-------------PDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQ-ESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINV-GYGY-DFIKLDELIKNNKLLKNDRIVLKCVV 1340
            ++G H+   C +  V C +  +GC E ++    +  H+      H + L N ++ L+ ++    +           S    SL +       D+Q   +   +    ++  +   +L +L++    LE+      HQ+      T+NQ   L            E  R    L  ++   E    +     G   W+++ F++       SG  +D         ++S  FY+   GY++CL+L              P    AG+  +L++F  +++G+ D  L WP K  + I +++Q E   +H +   + DP L      F +P    N  G+GY +F+ ++ L  +   L++D +V++C V
Sbjct:  223 QLGPHLEVDCQQAQVPCTFSPLGC-EAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQ----PSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLA-----------EATRLVRSLEARVAESESRLCA-----GIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSA----FQRPSVHRNPKGFGYMNFMDINTL-HHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 119.783 bits (299), Expect = 4.951e-29
Identity = 97/371 (26.15%), Postives = 169/371 (45.55%), Query Frame = 3
Query:  315 VKCPEPSCEF--HDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQN---LKNEMALMKECFEELKKIKDESQKKQSLLYD--------------LQDKISEFKRKFIQKSDENIHLK--LKLQQTEHKLEDLRHQLDMKQN-----ATENQMIXXXXXXXXXXXXSDENQRFSEILHGKL--ESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQES-GDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            V CP    E    DEL  +    N C++  + C +   GC   K   E +  H       H   L+   QN    ++EMA       +L +++ E  K+Q  +Y+               Q K++  +R   ++  E   LK  ++LQ+ E  + +   +L M +N     A  +     +     L+ + D N+    +   +L    L+ + L    + G+  WKID +T++ +E  SG    IYS PFY  + GYK C +++P+G   GKG++LS+FF +MRGE D +L WP + +VT  +++Q+   DI  +  F  DP        F +P +++N+  G         ++    +++D + +K  V
Sbjct:  166 VVCPHCGAEGICRDEL--LHHQTNICEQAELPCSFAKHGC-HFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAA------KLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDT--FRPDPTSSS----FKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 108.612 bits (270), Expect = 2.781e-25
Identity = 54/149 (36.24%), Postives = 86/149 (57.72%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            G+  WKID FT++  EA+SG    IYS PFY+++ GYK+C +L P+G  + +   LS+F  +MRGE D IL WP +  +TI +I+Q++G ++ S  F+ DP        F +P  +INV  G        +++    +  + + +K VV
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG-MNISETFDPDPCSIS----FQRPTRNINVASGCPRFCSQTVLRTRGYMNENCVFVKVVV 523          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 105.145 bits (261), Expect = 3.252e-24
Identity = 65/275 (23.64%), Postives = 132/275 (48.00%), Query Frame = 3
Query:  516 QNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            +N+ NE   + +    +  ++ +    + L+ +    + E +R+  +       L +KLQ+++  +  L  QL++    T  + + +          +D  +R + +     +S+             + WKI N   KR EA SG +   YS  F++  +GYKMC +++ +G   G+  ++S+FF IMRGE D +L+WP + +VT+ +++Q++ + H    F  DP        F +P+ ++N+  G       E +  +  +++D + LK +V
Sbjct:  239 ENIDNEA--IGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGR-------LNVKLQESDDIIRRLERQLELHDQGTGLRNLAI----------ADLEERLNTLQGTTFDSV-------------LLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVE-HVIDAFRPDPSSSS----FQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 102.449 bits (254), Expect = 2.423e-23
Identity = 60/176 (34.09%), Postives = 101/176 (57.39%), Query Frame = 3
Query:  807 SDENQRFSEILHGKLESLERETLSMKQHF--GSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDIN-VGYGY-DFIKLDEL-----IKNNKLL 1307
            +  ++R +E+ H KL  LE   + ++     G+  WK+DNF + R+ + +G+ A I+S PFY++  GYKMCL+++ +G   G G ++S+F  +M+G+ D IL+WP    +T+ I++Q S  I +    +   V       F +P +  N  GYGY +F  +D+L     IKNN +L
Sbjct:  302 TSSDRRIAELTH-KLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQ-SDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEGQYIKNNSIL 475          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 93.9745 bits (232), Expect = 8.721e-21
Identity = 49/156 (31.41%), Postives = 90/156 (57.69%), Query Frame = 3
Query:  894 GSIQWKIDNFTKKRKEA-QSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLKEK 1358
            G   WKI N+  +  +A  S     I+S PFY+++ GYK+ L+ + +G   GKGT+LS++  IM+G+ D +L+WP K ++T  +I+Q     H ++  + +  L   + +F++P    N+G G      +E++++ + +K+D + +K VV P   K
Sbjct:  253 GIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVLESGEYVKDDVMFIKAVVEPGSSK 408          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 134.42 bits (337), Expect = 4.818e-34
Identity = 108/422 (25.59%), Postives = 183/422 (43.36%), Query Frame = 3
Query:  111 CVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPS--CEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGK----VASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRK------FIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVV 1340
            C  C+ +L       CG R+C+ CI   L      CP + +   ++ +  D         +  I  + V C   +  C+    L++I DH+N C       P+F++ C  GK    +  + I +HL         T   C    KN+M L      EL+K K+       +        S   R         +K  E       L+Q   ++E LR  LD  +              E    + D+     EI    ++ L  + L    + G++ WKI ++ +++++A +G    +YS+PFY+   GYKMC +++ +G   GKGT+LS+FF +MRGE D +L WP K +VT+ +++Q     H    F  DP    +R    +P  ++N+  G        ++++   +K+D I +K  V
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDV------CCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVC-------PFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFC----KNKMPLT-----ELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMD-LRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFR----RPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTV 442          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 131.339 bits (329), Expect = 2.344e-32
Identity = 106/379 (27.97%), Postives = 182/379 (48.02%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSL---LYDLQDKISEFKRK-----------FIQKSDENIH------LKLKLQQTEHKLEDLR---HQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFS-------EILHGKLESLERET----------------LSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DHI  C K    C +  +GC +  V  E+I+DH    +Y H   L++ I  +K  +  ++      ++++  SQK   L   L DL+ ++S+  R             +  S   +H      L+L+LQ  + K+ +L     +L++K +  EN +  L  E E+     +   R         EIL  K+  LER                  +S   + G   WKI +FTKKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +D+N+  G   F  L +L   N  ++++ I +K +V
Sbjct:  202 KYVDHIKFCSKFKAPCRFHVVGC-DTSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQP-----QRLEVASQKLHELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN----------NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 117.087 bits (292), Expect = 1.089e-27
Identity = 91/344 (26.45%), Postives = 164/344 (47.67%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKN---EMALMKECFEE----LKKIKDESQKKQSLL--YDLQDKISEFKRKFIQKSDENI--HLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRH-----LFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DH  +C K    CP+ ++GC +  V + +I++H       H + L+  + ++     + +   E  E+    L +  D+     + +   DL  K+S           ENI   L  +++++   LE   HQ  + Q   EN              + + +    ++   + E + RE L    + G   WKI +F+ +R+EA SG    ++S  FYS+K GYKMCL+L+ +G   G+GT+LS+FF +MR + D +L+WP   +VT+ +++Q           N + ++D +R       F +P +++N+  G   F  L +L   +  L++D I +K +V
Sbjct:  197 KFNDHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSAL---------ENIVCVLNREVERSSLTLEAFSHQHRLDQEKIEN--------LSNKIRQLERSLTVKDLQLSEAEQMVRE-LQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQN----------NREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 117.087 bits (292), Expect = 1.106e-27
Identity = 91/344 (26.45%), Postives = 164/344 (47.67%), Query Frame = 3
Query:  360 KIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKN---EMALMKECFEE----LKKIKDESQKKQSLL--YDLQDKISEFKRKFIQKSDENI--HLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRH-----LFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            K  DH  +C K    CP+ ++GC +  V + +I++H       H + L+  + ++     + +   E  E+    L +  D+     + +   DL  K+S           ENI   L  +++++   LE   HQ  + Q   EN              + + +    ++   + E + RE L    + G   WKI +F+ +R+EA SG    ++S  FYS+K GYKMCL+L+ +G   G+GT+LS+FF +MR + D +L+WP   +VT+ +++Q           N + ++D +R       F +P +++N+  G   F  L +L   +  L++D I +K +V
Sbjct:  204 KFNDHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSAL---------ENIVCVLNREVERSSLTLEAFSHQHRLDQEKIEN--------LSNKIRQLERSLTVKDLQLSEAEQMVRE-LQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQN----------NREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 109.383 bits (272), Expect = 5.397e-25
Identity = 55/174 (31.61%), Postives = 98/174 (56.32%), Query Frame = 3
Query:  837 LHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYR-----HLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            + G+L  +   T       G   W+I +F KKR++A +G    ++S  FY++K GYKMCL+++ +G   G+GT+LS+FF +MRG +D +L+WP   +VT+ +++Q           N + ++D +R       F +P +++N+  G   F  L +L   N  +++D I +K +V
Sbjct:  433 MEGRLREMAATTFD-----GVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQS----------NREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIV 591          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014923.1 (SMESG000014923.1)

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 444/445 (99.78%), Postives = 445/445 (100.00%), Query Frame = 3
Query:   24 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLKEK 1358
            MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIELLLENEKLKYKSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYS+KNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLKEK
Sbjct:    1 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIELLLENEKLKYKSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSHKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLKEK 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 265.388 bits (677), Expect = 4.483e-83
Identity = 166/470 (35.32%), Postives = 260/470 (55.32%), Query Frame = 3
Query:   24 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKE-----------CFEELKKIKDESQKKQSLLYDLQDKISEFKRKF---------IQKSDENIH-----LKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKF---NY--DPVLDKYRHLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 1340
            MS  + EN+W+I+ +Y   S+TEI +D++C +CK LL NA   PCGCR+CF CI  +L   EK CP + +ECK+E+L+++ NI +D   N +IS++ VKC E SC + DELRK+ DH   C  + V CPY +IGC +  ++ +++ DHL  + + H K L++ + N  NEM ++K               E+ ++K + ++++  + DLQ K ++   +          ++  D N+      L+L ++  + +L D   Q++ KQ     +M             S++  + S  +  KL  LE      ++  G   WK+D FT K  +A++GI   IYSE F ++KNG+KMCL++ PDG   GKGT+LSVFF +M+GE D IL+WP +  VT  +INQ +   H S      NY  D  L +         TD N G G+  F+  +EL  N  L++N++I +KC V
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEM-------------SNKIDKLSGNVDRKL--LEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQ--------PTDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSV 447          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 259.61 bits (662), Expect = 5.038e-81
Identity = 154/440 (35.00%), Postives = 244/440 (55.45%), Query Frame = 3
Query:   24 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISE--FKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQHFG-SIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGY-DFIKLDELIKNNKLLKNDRIVLK 1331
            M+  ++ENIW+I+  Y   S  E+ SD+IC +C  ++ N+ N PCGCR+C +CI +YL   E  CP N D+CK EL++++ NI +D   N++ISR+I+KCPE SC++ DELRKI  HI+ C+ + + CPY  IGC+E  V+  ++ DHL  D + H K L++CI NL NEM  +K      K   D++   QS L +++ K+ +   +   +++   N+     + + + K E L + +        N++  L   +      +  + +  + +   L  L    +++K+       WK+D F  K K A+ G    I+S+ FY+++ GYKMCLQL P+G        LSVF  +M+ + D IL+WP +   T  +INQ +   H+     YD    +     DKP  + NVGYGY DF+ L EL  N+   +ND+I +K
Sbjct:    1 MAKFKFENIWKIMENYDF-SGVEVDSDMICGLCGKVMINSHNAPCGCRFCLDCISNYLNGRENLCPGNKDDCKLELISLEENIAIDRPMNNKISRLIIKCPENSCDYVDELRKIELHISQCNSQTIICPYIKIGCNESDVSLGKMPDHLRNDIHNHTKLLMDCIDNLNNEMNEIKIIVGNFKGQFDKNTNDQSYLAEIESKLQQQTMEIDLLKQRVHNLENLDFVDRPKLKAESLNNIISDNFRNYPNRLDTLNRNSTNPINLTAVSNKIDDAMKFGLTKLADMEINLKRMKSFEFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNF--QMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIK 437          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025566.1 (SMESG000025566.1)

HSP 1 Score: 258.07 bits (658), Expect = 2.534e-80
Identity = 161/449 (35.86%), Postives = 253/449 (56.35%), Query Frame = 3
Query:   24 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKE----CFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXSDENQRFSEILHGKLESLERETLSMKQ-----HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGY-DFIKLDELIKNNKLLKNDRIVLKCVV 1340
            M+  + EN+W+I+   +  S+ EI  D+ C++CK LL NA N PCGCR+CF CI  +L    K CP N + CK E L+++ NI +DN  N +IS+I VKC E SCEF DEL K+ DH   C  +   CPY +IGC +  ++ +++ DHL  +  TH K L++   N  NEM ++K        E K +++E  + +      +++I+E +R  I  + EN+ ++  + +     E  R ++   Q    +Q+ E+ L N ++          S  +   +++++R+ L M+      ++G   WK+D FT K   A++GI  DIYSE F ++KN YKMCL ++PDGF  GKGT+L+V F +M+GE D IL+WP +  VT+ +INQ +   H     N     +       +P TD N G G+  F+  +EL  N  L++N++I +KC V
Sbjct:    1 MAFSKLENVWQIIINNKYESLAEIQHDMQCLLCKKLLINARNAPCGCRFCFSCISGFLDNENKICPGNTEFCKLEKLDMNINICVDNPINIKISQIKVKCAEKSCEFVDELIKMEDHSRTCKYRSAACPYSNIGCDKCNISLDKVADHLQSEILTHTKLLMDFFGNFNNEMEMLKTNNYGLRAENKLLRNEINELKLDGERRREEIAELQRNIICLNGENVAMREIMNKLISDWERNRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMDNVDRKLLEMEANQNQLNYGEFAWKLDKFTDKMAHAKNGINTDIYSESFLTHKNSYKMCLSVNPDGFGDGKGTHLTVGFHLMKGEFDEILEWPFRYSVTLALINQRTRLPHVCKTTNC--ANNPNSKALIQP-TDRNGGMGFPQFVSHEELASNPDLMRNNQIFIKCSV 446          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026628.1 (SMESG000026628.1)

HSP 1 Score: 245.743 bits (626), Expect = 1.176e-75
Identity = 155/450 (34.44%), Postives = 263/450 (58.44%), Query Frame = 3
Query:   24 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEEXXXXXXXXXXXXAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIXXXXXXXXXXXXS-----DENQRFSEILHGKLESLERETLSMKQ-----HFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGY-DFIKLDELIKNNKLLKNDRIVLKCVV 1340
            M+N + EN+ +I+S   V +  +   D +CVIC N+  N C+  CGC+YC++CI++YL   +K CP    +C+ ++LNI+ +ILLD +  SRISR+IVK PE + +F D++++I + I +       CP+  IGC   +   E I+DHL   N +H+K L++ I +LK+E+  +K    E+   K E++K +  + ++    SE K   I  SD  ++ ++K +Q E+  + L HQ D   + T+   ++   E   ++  S       +QR    ++ KL   +R+   ++      +FG   W + +F++K  EA+  I  + YS+ F+++KNGYKMCL++ P G   GKG++L+++F +M+G  D IL WPMK +VT  +I+Q +G +H      +D   D +   ++KP T+  +GYGY  FI+++EL+KN  + + DRI +KC V
Sbjct:    1 MANGKSENLTKIISNGVVENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIK---SEITNSKRENKKLKKEI-EIMKFDSERKEALI--SDLLMNDRMKTEQIEYLFQQL-HQSDSDSDETQYTHVDDKSEVSSVRTMSISRSASHSQRSISKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNF--AWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 441          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF25.436e-2926.39TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF35.948e-2924.60TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.948e-2924.60TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF36.825e-2825.43TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.601e-2735.40TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.835e-1328.65TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-25.155e-932.11TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf46.033e-1727.74gene:FBgn0026319 transcript:FBtr0334401[more]
Traf48.171e-1727.74gene:FBgn0026319 transcript:FBtr0077429[more]
Traf61.251e-724.16gene:FBgn0265464 transcript:FBtr0071188[more]
Traf-like2.602e-724.59gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like3.350e-724.59gene:FBgn0030748 transcript:FBtr0074273[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.529e-3125.20TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf2a2.430e-2925.90Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
BX901915.16.497e-2832.29pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.16.497e-2832.29pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8082.456e-2626.43un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF26.187e-3025.21TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh27.289e-2926.06slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.490e-2824.46TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh22.379e-2726.06slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a14.238e-2133.55solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf21.544e-3128.19TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.773e-3128.19TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf38.910e-3024.87TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf36.599e-2828.76TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf36.599e-2828.76TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE1.240e-3028.19TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q60803|TRAF3_MOUSE6.233e-2924.87TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN2.610e-2826.39TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q13114|TRAF3_HUMAN2.856e-2824.60TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE2.035e-2523.21TNF receptor-associated factor 5 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1013.058e-5030.00TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A3L7HD985.631e-3425.38TNF receptor-associated factor OS=Cricetulus grise... [more]
I3WEV18.406e-3326.94Tumor necrosis factor receptor-associated factor 3... [more]
B4DGI33.349e-3226.00TNF receptor-associated factor OS=Homo sapiens OX=... [more]
A0A401RTZ62.421e-3125.24TNF receptor-associated factor OS=Chiloscyllium pu... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a2.099e-2925.99TNF receptor-associated factor 2-like [Source:NCBI... [more]
ENSAMXT00000035169.12.381e-2734.23pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2a3.704e-2732.29TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b8.297e-2533.55TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf11.461e-2123.67TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.410e-3425.27pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.17.599e-2932.30pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf62.982e-1321.04TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494644.951e-2926.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.781e-2536.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.252e-2423.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487732.423e-2334.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495458.721e-2131.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf34.818e-3425.59TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.22.344e-3227.97TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b1.089e-2726.45TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.106e-2726.45TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8085.397e-2531.61TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014923.10.000e+099.78SMESG000014923.1[more]
SMESG000025794.14.483e-8335.32SMESG000025794.1[more]
SMESG000020135.15.038e-8135.00SMESG000020135.1[more]
SMESG000025566.12.534e-8035.86SMESG000025566.1[more]
SMESG000026628.11.176e-7534.44SMESG000026628.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018449 ID=SMED30018449|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1536bp
GTTTTACAATAATTTCAATAGAAATGTCCAATTTACGATATGAAAACATC
TGGAGAATCCTTAGTGAGTACAGAGTCAATTCAATGACGGAGATTTCCAG
TGACCTAATATGCGTGATTTGTAAAAACCTTTTAAAGAATGCTTGTAATG
GACCTTGTGGTTGTCGATATTGTTTCGAATGCATTCAGTCCTACCTTGGA
CAAGTTGAGAAATTTTGTCCTCAAAATTTCGATGAATGCAAAGAAGAATT
ATTGAACATAGATCGAAATATCCTACTCGACAATGCTGCAAACAGCCGTA
TTTCTCGTATCATTGTCAAGTGTCCGGAACCATCTTGTGAGTTTCATGAC
GAACTACGGAAAATTGGAGATCACATAAATGCGTGTGATAAAAAGATTGT
CAAATGTCCATATTTTGATATAGGATGCAGTGAAGGAAAAGTCGCCAGTG
AGAGAATTAACGATCATCTCATTGTTGACAATTATACTCATGCAAAAACC
CTTGTAAATTGTATTCAAAACCTTAAAAATGAAATGGCATTGATGAAAGA
ATGCTTCGAGGAATTAAAAAAGATAAAAGACGAATCGCAAAAGAAACAAT
CTTTGTTATACGATCTTCAAGATAAAATATCGGAATTCAAAAGAAAATTC
ATACAGAAAAGTGATGAAAATATCCATTTGAAACTGAAACTGCAACAAAC
TGAACACAAGTTGGAAGACCTTCGTCATCAGCTAGACATGAAACAAAATG
CTACAGAAAATCAAATGATTGAATTATTGTTAGAAAATGAAAAATTGAAA
TACAAATCTGATGAAAACCAAAGATTTTCTGAGATTCTTCATGGGAAACT
AGAATCTCTTGAAAGAGAAACGCTGTCTATGAAACAACATTTCGGCTCTA
TTCAGTGGAAAATAGATAATTTTACAAAGAAACGAAAAGAGGCCCAATCA
GGAATCATTGCTGATATATACAGTGAGCCGTTTTATTCTAACAAAAACGG
TTACAAAATGTGCCTTCAGCTTCATCCCGACGGATTCAAAGCTGGAAAAG
GAACAAATCTCTCGGTTTTCTTTTTCATAATGCGAGGTGAAAATGATGTA
ATTCTCCAATGGCCTATGAAGCTGGAAGTGACAATTGGAATCATCAATCA
AGAATCGGGAGACATCCATACAAGTTACAAATTCAACTATGATCCTGTTT
TGGACAAATATCGGCACCTTTTTGACAAACCAAAGACTGACATCAATGTT
GGCTACGGATACGACTTTATCAAGCTTGATGAGCTCATCAAAAACAATAA
ACTGCTTAAGAACGACAGAATCGTCTTGAAATGTGTTGTGGCCCCTCTTA
AGGAAAAATGATGACCTCTTCCTTCTTTCTCTCATCTTTTGAACTGATTT
GATAGTTTATTTTATTACATGCATTTATTATATCTTTTTATCTATCATTT
TATTTCGTTAGATCTTACTATCGGTGATTTTGATTCTTAACTATAATCGA
TTCTATGCACCCGAATGATTTCAGCACAAATAAATG
back to top

protein sequence of SMED30018449-orf-1

>SMED30018449-orf-1 ID=SMED30018449-orf-1|Name=SMED30018449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=453bp
FTIISIEMSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNG
PCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRI
SRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASE
RINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDESQKKQS
LLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNA
TENQMIELLLENEKLKYKSDENQRFSEILHGKLESLERETLSMKQHFGSI
QWKIDNFTKKRKEAQSGIIADIYSEPFYSNKNGYKMCLQLHPDGFKAGKG
TNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVL
DKYRHLFDKPKTDINVGYGYDFIKLDELIKNNKLLKNDRIVLKCVVAPLK
EK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0001878response to yeast
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
GO:0016567protein ubiquitination
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 171..194
NoneNo IPR availableCOILSCoilCoilcoord: 223..250
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 32..446
NoneNo IPR availableCDDcd16449RING-HCcoord: 37..74
e-value: 1.14774E-7
score: 45.9213
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 30..83
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 302..428
e-value: 4.2E-10
score: 49.6
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 297..446
score: 16.504
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 19..138
e-value: 2.0E-15
score: 58.8
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 261..450
e-value: 8.3E-46
score: 157.9
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 104..184
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 298..449
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 32..446
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 37..73
score: 8.86