CUGBP, Elav-like family member 4

Overview
NameCUGBP, Elav-like family member 4
Smed IDSMED30018441
Length (bp)2249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CUGBP, Elav-like family member 4 (SMED30018441) t-SNE clustered cells

Violin plots show distribution of expression levels for CUGBP, Elav-like family member 4 (SMED30018441) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CUGBP, Elav-like family member 4 (SMED30018441) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CUGBP, Elav-like family member 4 (SMED30018441) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018441

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30018441SMESG000026947.1 dd_Smed_v4_14010_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30018441SMESG000026947.1 SmedASXL_015118SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018441SMESG000026947.1 dd_Smed_v4_14010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018441SMESG000026947.1 dd_Smed_v6_14010_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018441SMESG000026947.1 OX_Smed_1.0.03151ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 402.519 bits (1033), Expect = 1.210e-132
Identity = 230/504 (45.63%), Postives = 309/504 (61.31%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG-NIYGQTILDNQLS----PPRIFNPVAALS-FQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGG----SGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLFVGQIPR L+E DL+P+FE++G+I+E ++++DK TG+HKGCAFLTYC R S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ LH S+T+ GASSS+VVKFADTEKER  R++QQ+   L  M S +AL Q G  + Y Q ++  Q +         +P+A ++  Q+Q  + + +  G+    I P++G +    +AA   + +   L          G N  +  P  P+     +  + N      +Q+   PV  +                   Q A  G Q    + +A   ++Y  +     AFP P     Q        Q+  ++         GP+ CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLG-MFSPIAL-QFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAI-NANGLIATPITPSSGTSTPPAIAATPVSAIPAAL----------GVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPL-------------------QQAYAGMQ----HYTAAYPAAYSLV---APAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 465          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Match: CELF3 (CUGBP Elav-like family member 3 [Source:HGNC Symbol;Acc:HGNC:11967])

HSP 1 Score: 377.096 bits (967), Expect = 7.727e-123
Identity = 220/493 (44.62%), Postives = 298/493 (60.45%), Query Frame = 2
Query:  476 QIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG-NIYGQTILDNQLS----PPRIFNPVAALS-FQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGG----SGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            QIPR L+E DL+P+FE++G+I+E ++++DK TG+HKGCAFLTYC R S+   Q ALH+QK+LPGM RP+QVKPA  E + + RKLFVGML K QT+EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ LH S+T+ GASSS+VVKFADTEKER  R++QQ+   L  M S +AL Q G  + Y Q ++  Q +         +P+A ++  Q+Q  + + +  G+    I P++G +    +AA   + +   L          G N  +  P  P+     +  + N      +Q+   PV  +                   Q A  G Q    + +A   ++Y  +     AFP P     Q        Q+  ++         GP+ CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   15 QIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGD-RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLG-MFSPIAL-QFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAI-NANGLIATPITPSSGTSTPPAIAATPVSAIPAAL----------GVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPL-------------------QQAYAGMQ----HYTAAYPAAYSLV---APAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 466          

HSP 2 Score: 62.3882 bits (150), Expect = 1.597e-9
Identity = 33/90 (36.67%), Postives = 51/90 (56.67%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            KLFVG + +   + D+R MFE +G I E ++LR    G  KGCAF+ +     ++A    LH  ++LPG +  L VK A  E++   R++
Sbjct:   97 KLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGP-DGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRM 185          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Match: CELF1 (CUGBP Elav-like family member 1 [Source:HGNC Symbol;Acc:HGNC:2549])

HSP 1 Score: 328.946 bits (842), Expect = 4.836e-104
Identity = 211/503 (41.95%), Postives = 300/503 (59.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS------GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQ+PR+  E DLR +FE+YG +YE ++LRD+       KGC F+T+  R+++   Q ALH+ K LPGM  P+Q+KPA  E+    E+RKLF+GM++K  TE D+R +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI A+H +QTM+G SS +VVKFADT+K+++ ++   +   L      ++ A + GN+ G     N L P  +     AL   LQQT+   +L  ++  S++P  G       A     L +    ++ A +  +G N LT + +    +++T+ G S SS +  S N   P+ ++ +   ++  +      SL   A L G      SS  S+ +  ++ A   A+   I Q+  + L     Q  L +   G+      GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQ+MNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   12 DLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKR---MAQQLQQQMQQISAASVWGNLAGL----NTLGPQYL-----AL---LQQTASSGNLNTLS--SLHPMGGLN-----AMQLQNLAALAAAASAAQNTPSGTNALTTSSS--PLSVLTSSGSSPSSSSSNSVN---PIASLGALQTLAGATAGLNVGSLAGMAALNGGL---GSSGLSNGTGSTMEALTQAYSG-IQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS-KPY 482          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Match: CELF1 (CUGBP Elav-like family member 1 [Source:HGNC Symbol;Acc:HGNC:2549])

HSP 1 Score: 328.561 bits (841), Expect = 5.907e-104
Identity = 206/503 (40.95%), Postives = 296/503 (58.85%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS------GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQ+PR+  E DLR +FE+YG +YE ++LRD+       KGC F+T+  R+++   Q ALH+ K LPGM  P+Q+KPA  E+    E+RKLF+GM++K  TE D+R +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI A+H +QTM+G SS +VVKFADT+K+++ ++   +   L      ++ A + GN+ G     N L P  +     AL   LQQT+   +L  ++  S++P  G       A     L +    ++ A +  +G N LT + +  S         ++S+ +  S + +  V  I S   +  L+ +   +++   A +        SS  S+ +  ++ A   A+   I Q+  + L     Q  L +   G+      GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQ+MNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   12 DLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKR---MAQQLQQQMQQISAASVWGNLAGL----NTLGPQYL-----AL---LQQTASSGNLNTLS--SLHPMGGLN-----AMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSV-------LTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSG-IQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS-KPY 483          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Match: CELF1 (CUGBP Elav-like family member 1 [Source:HGNC Symbol;Acc:HGNC:2549])

HSP 1 Score: 328.561 bits (841), Expect = 5.907e-104
Identity = 206/503 (40.95%), Postives = 296/503 (58.85%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS------GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQ+PR+  E DLR +FE+YG +YE ++LRD+       KGC F+T+  R+++   Q ALH+ K LPGM  P+Q+KPA  E+    E+RKLF+GM++K  TE D+R +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI A+H +QTM+G SS +VVKFADT+K+++ ++   +   L      ++ A + GN+ G     N L P  +     AL   LQQT+   +L  ++  S++P  G       A     L +    ++ A +  +G N LT + +  S         ++S+ +  S + +  V  I S   +  L+ +   +++   A +        SS  S+ +  ++ A   A+   I Q+  + L     Q  L +   G+      GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQ+MNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   12 DLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKR---MAQQLQQQMQQISAASVWGNLAGL----NTLGPQYL-----AL---LQQTASSGNLNTLS--SLHPMGGLN-----AMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSV-------LTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSG-IQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS-KPY 483          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Match: unc-75 (Putative RNA-binding protein [Source:UniProtKB/TrEMBL;Acc:G5EE68])

HSP 1 Score: 275.404 bits (703), Expect = 2.400e-84
Identity = 132/226 (58.41%), Postives = 172/226 (76.11%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEER-------KTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG--NIYGQTILDNQLS 1093
            KD DAIKLFVGQIPR+L+E DLR +FE++G+IYEF+IL+DK TG+HKGCAFLTYCHR S+  CQ  LHDQK+LPGM R +QVKPA  +        K +++KLF+GML+K Q+E++VR LF +FGE++E TVLR  +G SKGCAFVK+   ++A  AISALHGSQTM GASSS+VVK+ADTEKERQ R++QQ+   + ++N  L + Q+G   N Y Q +    L+
Sbjct:   24 KDPDAIKLFVGQIPRNLEEKDLRHLFEQFGKIYEFTILKDKYTGMHKGCAFLTYCHRDSAVRCQATLHDQKTLPGMNRAMQVKPADTDSRPASPKDKMDDKKLFIGMLSKQQSEDEVRALFATFGELDEVTVLRGADGASKGCAFVKYKHGLDAHMAISALHGSQTMPGASSSLVVKYADTEKERQNRRMQQMAAQMGMLNPML-VNQVGMQYNAYQQVLQQQSLA 248          

HSP 2 Score: 66.6254 bits (161), Expect = 3.277e-11
Identity = 30/43 (69.77%), Postives = 38/43 (88.37%), Query Frame = 2
Query: 1796 GFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GFVSY N+  +QAAI AMNGFQ+G+KRLKVQLKRP+++S +PY
Sbjct:  423 GFVSYDNIHSSQAAITAMNGFQIGMKRLKVQLKRPRNES-RPY 464          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 208.764 bits (530), Expect = 2.692e-58
Identity = 95/190 (50.00%), Postives = 133/190 (70.00%), Query Frame = 2
Query:  416 NGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTR 985
            N  S S    D+DAIK+FVGQIPR   E+D R +FE+YG ++  +ILRDK T   KGC F+T+ HR+ +   Q ALH+ K + GM  P+Q+KPA  E +  ERKLF+G L+K   EE++R +F  FG IE+C+VLRDQ+G S+GCAFV F+++  A+ A   +H SQTM+G S+ +VVKFADT+K++  +
Sbjct:   41 NDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENR-NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 122.479 bits (306), Expect = 8.073e-29
Identity = 58/91 (63.74%), Postives = 66/91 (72.53%), Query Frame = 2
Query: 1652 GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GP+  NLFIYHLP +FGD DL+  F+PFG I SAKV++D+ TN SKCFGFVSY N   A  AI AMNGFQ+G KRLKVQL   K D   PY
Sbjct:  497 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQL---KVDRGNPY 584          

HSP 3 Score: 81.6481 bits (200), Expect = 8.446e-16
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  641 LHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGN-SKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKL 991
            ++ + + P  A    V P+  E  T+  K+FVG + +   E D RRLF+ +G +  C +LRD++   SKGC FV F  + +A+ A  ALH  + ++G    + +K ADTE  R  RKL
Sbjct:   28 INAKDTTPSTAADNDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTE-NRNERKL 144          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 208.764 bits (530), Expect = 2.692e-58
Identity = 95/190 (50.00%), Postives = 133/190 (70.00%), Query Frame = 2
Query:  416 NGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTR 985
            N  S S    D+DAIK+FVGQIPR   E+D R +FE+YG ++  +ILRDK T   KGC F+T+ HR+ +   Q ALH+ K + GM  P+Q+KPA  E +  ERKLF+G L+K   EE++R +F  FG IE+C+VLRDQ+G S+GCAFV F+++  A+ A   +H SQTM+G S+ +VVKFADT+K++  +
Sbjct:   41 NDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENR-NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 122.479 bits (306), Expect = 8.073e-29
Identity = 58/91 (63.74%), Postives = 66/91 (72.53%), Query Frame = 2
Query: 1652 GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GP+  NLFIYHLP +FGD DL+  F+PFG I SAKV++D+ TN SKCFGFVSY N   A  AI AMNGFQ+G KRLKVQL   K D   PY
Sbjct:  497 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQL---KVDRGNPY 584          

HSP 3 Score: 81.6481 bits (200), Expect = 8.446e-16
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  641 LHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGN-SKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKL 991
            ++ + + P  A    V P+  E  T+  K+FVG + +   E D RRLF+ +G +  C +LRD++   SKGC FV F  + +A+ A  ALH  + ++G    + +K ADTE  R  RKL
Sbjct:   28 INAKDTTPSTAADNDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTE-NRNERKL 144          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 208.764 bits (530), Expect = 2.692e-58
Identity = 95/190 (50.00%), Postives = 133/190 (70.00%), Query Frame = 2
Query:  416 NGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTR 985
            N  S S    D+DAIK+FVGQIPR   E+D R +FE+YG ++  +ILRDK T   KGC F+T+ HR+ +   Q ALH+ K + GM  P+Q+KPA  E +  ERKLF+G L+K   EE++R +F  FG IE+C+VLRDQ+G S+GCAFV F+++  A+ A   +H SQTM+G S+ +VVKFADT+K++  +
Sbjct:   41 NDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENR-NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 122.479 bits (306), Expect = 8.073e-29
Identity = 58/91 (63.74%), Postives = 66/91 (72.53%), Query Frame = 2
Query: 1652 GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GP+  NLFIYHLP +FGD DL+  F+PFG I SAKV++D+ TN SKCFGFVSY N   A  AI AMNGFQ+G KRLKVQL   K D   PY
Sbjct:  497 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQL---KVDRGNPY 584          

HSP 3 Score: 81.6481 bits (200), Expect = 8.446e-16
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  641 LHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGN-SKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKL 991
            ++ + + P  A    V P+  E  T+  K+FVG + +   E D RRLF+ +G +  C +LRD++   SKGC FV F  + +A+ A  ALH  + ++G    + +K ADTE  R  RKL
Sbjct:   28 INAKDTTPSTAADNDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTE-NRNERKL 144          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 208.764 bits (530), Expect = 2.692e-58
Identity = 95/190 (50.00%), Postives = 133/190 (70.00%), Query Frame = 2
Query:  416 NGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTR 985
            N  S S    D+DAIK+FVGQIPR   E+D R +FE+YG ++  +ILRDK T   KGC F+T+ HR+ +   Q ALH+ K + GM  P+Q+KPA  E +  ERKLF+G L+K   EE++R +F  FG IE+C+VLRDQ+G S+GCAFV F+++  A+ A   +H SQTM+G S+ +VVKFADT+K++  +
Sbjct:   41 NDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTENR-NERKLFIGQLSKKHNEENLREIFAKFGHIEDCSVLRDQDGKSRGCAFVTFTNRSCAVVATKEMHHSQTMEGCSAPLVVKFADTQKDKDVK 229          

HSP 2 Score: 122.479 bits (306), Expect = 8.073e-29
Identity = 58/91 (63.74%), Postives = 66/91 (72.53%), Query Frame = 2
Query: 1652 GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GP+  NLFIYHLP +FGD DL+  F+PFG I SAKV++D+ TN SKCFGFVSY N   A  AI AMNGFQ+G KRLKVQL   K D   PY
Sbjct:  497 GPDGANLFIYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQL---KVDRGNPY 584          

HSP 3 Score: 81.6481 bits (200), Expect = 8.446e-16
Identity = 43/118 (36.44%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  641 LHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGN-SKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKL 991
            ++ + + P  A    V P+  E  T+  K+FVG + +   E D RRLF+ +G +  C +LRD++   SKGC FV F  + +A+ A  ALH  + ++G    + +K ADTE  R  RKL
Sbjct:   28 INAKDTTPSTAADNDVSPSPSEPDTDAIKMFVGQIPRQWNETDCRRLFEKYGSVFSCNILRDKSTQASKGCCFVTFYHRKDAIEAQGALHNIKVIEGMHHPVQMKPADTE-NRNERKL 144          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331646)

HSP 1 Score: 331.257 bits (848), Expect = 4.852e-104
Identity = 221/512 (43.16%), Postives = 290/512 (56.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISA-LHGSQTMQGASSSIVVKFADTEKERQTRKLQQL-INPLNLM-NSSLALAQLGGNIYGQTILDN---QLSPPRIFNPVAALSFQLQQ---TSGLPS--LAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISN-----LSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFP---APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D D IK+FVGQ+P+S+ ES LR MFEEYG ++  ++LRDK TGI KGC F+T+  R ++   Q ALH+ K+L GM  P+Q+KPA  E +  ERKLFVGMLNK   E DVR+LF+  G IEECTVLRDQNG SKGCAFV F+++  A++AI   L  ++ M+G +S +VVKFADT+KE++ +K+QQ+  N  NL  N ++ L Q   ++    IL N   Q SP    + +   S QL Q     GL    L  +TGL    ++       VAA  A LL+P+  + Q               N  + A +T P  SN++ A A+            SAQ++N      SD     S Y +   G                  +P FG A     +P+     S  +     K +E      GPE CNLFIYHLP EF D DL   F PFG + SAKV++D+ T+ SKCFGFVS+ N   AQ AI+AMNGFQ+G KRLKVQLK+PK DS KPY
Sbjct:  116 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-NERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVT-TPILPNPPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAA--AGLLTPM--TVQ---------------NLAAIAAMTQPSLSNAAAAAAAATS-------PGSAQLTNTAALLWSDPNPMASAYMSTAAG------------------LPQFGSASALSTSPLASVALSAAAAAAAGKQIE------GPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK-DS-KPY 573          

HSP 2 Score: 72.4034 bits (176), Expect = 7.756e-13
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  698 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQ-NGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ 1087
            ++E   +  K+FVG + K+  E  +R +F+ +G +    VLRD+  G SKGC FV F ++  AL A  ALH  +T+ G    I +K AD+E   + +    ++N     N    L ++ G I   T+L +Q
Sbjct:  112 EKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 242          

HSP 3 Score: 70.0922 bits (170), Expect = 3.660e-12
Identity = 36/98 (36.73%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  440 SKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSS-EACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            S++ +  KLFVG + + L E+D+R +FE +G I E ++LRD+  G  KGCAF+T+  + ++  A +  L   K + G   PL VK A  +++ E++K+
Sbjct:  201 SENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKI 297          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331998)

HSP 1 Score: 331.257 bits (848), Expect = 4.852e-104
Identity = 221/512 (43.16%), Postives = 290/512 (56.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISA-LHGSQTMQGASSSIVVKFADTEKERQTRKLQQL-INPLNLM-NSSLALAQLGGNIYGQTILDN---QLSPPRIFNPVAALSFQLQQ---TSGLPS--LAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISN-----LSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFP---APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D D IK+FVGQ+P+S+ ES LR MFEEYG ++  ++LRDK TGI KGC F+T+  R ++   Q ALH+ K+L GM  P+Q+KPA  E +  ERKLFVGMLNK   E DVR+LF+  G IEECTVLRDQNG SKGCAFV F+++  A++AI   L  ++ M+G +S +VVKFADT+KE++ +K+QQ+  N  NL  N ++ L Q   ++    IL N   Q SP    + +   S QL Q     GL    L  +TGL    ++       VAA  A LL+P+  + Q               N  + A +T P  SN++ A A+            SAQ++N      SD     S Y +   G                  +P FG A     +P+     S  +     K +E      GPE CNLFIYHLP EF D DL   F PFG + SAKV++D+ T+ SKCFGFVS+ N   AQ AI+AMNGFQ+G KRLKVQLK+PK DS KPY
Sbjct:  116 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-NERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVT-TPILPNPPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAA--AGLLTPM--TVQ---------------NLAAIAAMTQPSLSNAAAAAAAATS-------PGSAQLTNTAALLWSDPNPMASAYMSTAAG------------------LPQFGSASALSTSPLASVALSAAAAAAAGKQIE------GPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK-DS-KPY 573          

HSP 2 Score: 72.4034 bits (176), Expect = 7.756e-13
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  698 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQ-NGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ 1087
            ++E   +  K+FVG + K+  E  +R +F+ +G +    VLRD+  G SKGC FV F ++  AL A  ALH  +T+ G    I +K AD+E   + +    ++N     N    L ++ G I   T+L +Q
Sbjct:  112 EKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 242          

HSP 3 Score: 70.0922 bits (170), Expect = 3.660e-12
Identity = 36/98 (36.73%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  440 SKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSS-EACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            S++ +  KLFVG + + L E+D+R +FE +G I E ++LRD+  G  KGCAF+T+  + ++  A +  L   K + G   PL VK A  +++ E++K+
Sbjct:  201 SENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKI 297          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331648)

HSP 1 Score: 331.257 bits (848), Expect = 4.852e-104
Identity = 221/512 (43.16%), Postives = 290/512 (56.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISA-LHGSQTMQGASSSIVVKFADTEKERQTRKLQQL-INPLNLM-NSSLALAQLGGNIYGQTILDN---QLSPPRIFNPVAALSFQLQQ---TSGLPS--LAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISN-----LSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFP---APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D D IK+FVGQ+P+S+ ES LR MFEEYG ++  ++LRDK TGI KGC F+T+  R ++   Q ALH+ K+L GM  P+Q+KPA  E +  ERKLFVGMLNK   E DVR+LF+  G IEECTVLRDQNG SKGCAFV F+++  A++AI   L  ++ M+G +S +VVKFADT+KE++ +K+QQ+  N  NL  N ++ L Q   ++    IL N   Q SP    + +   S QL Q     GL    L  +TGL    ++       VAA  A LL+P+  + Q               N  + A +T P  SN++ A A+            SAQ++N      SD     S Y +   G                  +P FG A     +P+     S  +     K +E      GPE CNLFIYHLP EF D DL   F PFG + SAKV++D+ T+ SKCFGFVS+ N   AQ AI+AMNGFQ+G KRLKVQLK+PK DS KPY
Sbjct:  116 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-NERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVT-TPILPNPPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAA--AGLLTPM--TVQ---------------NLAAIAAMTQPSLSNAAAAAAAATS-------PGSAQLTNTAALLWSDPNPMASAYMSTAAG------------------LPQFGSASALSTSPLASVALSAAAAAAAGKQIE------GPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK-DS-KPY 573          

HSP 2 Score: 72.4034 bits (176), Expect = 7.756e-13
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  698 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQ-NGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ 1087
            ++E   +  K+FVG + K+  E  +R +F+ +G +    VLRD+  G SKGC FV F ++  AL A  ALH  +T+ G    I +K AD+E   + +    ++N     N    L ++ G I   T+L +Q
Sbjct:  112 EKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 242          

HSP 3 Score: 70.0922 bits (170), Expect = 3.660e-12
Identity = 36/98 (36.73%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  440 SKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSS-EACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            S++ +  KLFVG + + L E+D+R +FE +G I E ++LRD+  G  KGCAF+T+  + ++  A +  L   K + G   PL VK A  +++ E++K+
Sbjct:  201 SENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKI 297          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0331647)

HSP 1 Score: 331.257 bits (848), Expect = 4.852e-104
Identity = 221/512 (43.16%), Postives = 290/512 (56.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISA-LHGSQTMQGASSSIVVKFADTEKERQTRKLQQL-INPLNLM-NSSLALAQLGGNIYGQTILDN---QLSPPRIFNPVAALSFQLQQ---TSGLPS--LAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISN-----LSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFP---APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D D IK+FVGQ+P+S+ ES LR MFEEYG ++  ++LRDK TGI KGC F+T+  R ++   Q ALH+ K+L GM  P+Q+KPA  E +  ERKLFVGMLNK   E DVR+LF+  G IEECTVLRDQNG SKGCAFV F+++  A++AI   L  ++ M+G +S +VVKFADT+KE++ +K+QQ+  N  NL  N ++ L Q   ++    IL N   Q SP    + +   S QL Q     GL    L  +TGL    ++       VAA  A LL+P+  + Q               N  + A +T P  SN++ A A+            SAQ++N      SD     S Y +   G                  +P FG A     +P+     S  +     K +E      GPE CNLFIYHLP EF D DL   F PFG + SAKV++D+ T+ SKCFGFVS+ N   AQ AI+AMNGFQ+G KRLKVQLK+PK DS KPY
Sbjct:  116 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-NERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVT-TPILPNPPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAA--AGLLTPM--TVQ---------------NLAAIAAMTQPSLSNAAAAAAAATS-------PGSAQLTNTAALLWSDPNPMASAYMSTAAG------------------LPQFGSASALSTSPLASVALSAAAAAAAGKQIE------GPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK-DS-KPY 573          

HSP 2 Score: 72.4034 bits (176), Expect = 7.756e-13
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  698 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQ-NGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ 1087
            ++E   +  K+FVG + K+  E  +R +F+ +G +    VLRD+  G SKGC FV F ++  AL A  ALH  +T+ G    I +K AD+E   + +    ++N     N    L ++ G I   T+L +Q
Sbjct:  112 EKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 242          

HSP 3 Score: 70.0922 bits (170), Expect = 3.660e-12
Identity = 36/98 (36.73%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  440 SKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSS-EACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            S++ +  KLFVG + + L E+D+R +FE +G I E ++LRD+  G  KGCAF+T+  + ++  A +  L   K + G   PL VK A  +++ E++K+
Sbjct:  201 SENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKI 297          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Match: bru1 (gene:FBgn0000114 transcript:FBtr0080345)

HSP 1 Score: 330.487 bits (846), Expect = 1.913e-103
Identity = 221/512 (43.16%), Postives = 290/512 (56.64%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISA-LHGSQTMQGASSSIVVKFADTEKERQTRKLQQL-INPLNLM-NSSLALAQLGGNIYGQTILDN---QLSPPRIFNPVAALSFQLQQ---TSGLPS--LAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISN-----LSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFP---APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D D IK+FVGQ+P+S+ ES LR MFEEYG ++  ++LRDK TGI KGC F+T+  R ++   Q ALH+ K+L GM  P+Q+KPA  E +  ERKLFVGMLNK   E DVR+LF+  G IEECTVLRDQNG SKGCAFV F+++  A++AI   L  ++ M+G +S +VVKFADT+KE++ +K+QQ+  N  NL  N ++ L Q   ++    IL N   Q SP    + +   S QL Q     GL    L  +TGL    ++       VAA  A LL+P+  + Q               N  + A +T P  SN++ A A+            SAQ++N      SD     S Y +   G                  +P FG A     +P+     S  +     K +E      GPE CNLFIYHLP EF D DL   F PFG + SAKV++D+ T+ SKCFGFVS+ N   AQ AI+AMNGFQ+G KRLKVQLK+PK DS KPY
Sbjct:  147 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENR-NERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVT-TPILPNPPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAA--AGLLTPM--TVQ---------------NLAAIAAMTQPSLSNAAAAAAAATS-------PGSAQLTNTAALLWSDPNPMASAYMSTAAG------------------LPQFGSASALSTSPLASVALSAAAAAAAGKQIE------GPEGCNLFIYHLPQEFTDTDLASTFLPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPK-DS-KPY 604          

HSP 2 Score: 72.4034 bits (176), Expect = 8.101e-13
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query:  698 KEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQ-NGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ 1087
            ++E   +  K+FVG + K+  E  +R +F+ +G +    VLRD+  G SKGC FV F ++  AL A  ALH  +T+ G    I +K AD+E   + +    ++N     N    L ++ G I   T+L +Q
Sbjct:  143 EKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 273          

HSP 3 Score: 70.0922 bits (170), Expect = 3.944e-12
Identity = 36/98 (36.73%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  440 SKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSS-EACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            S++ +  KLFVG + + L E+D+R +FE +G I E ++LRD+  G  KGCAF+T+  + ++  A +  L   K + G   PL VK A  +++ E++K+
Sbjct:  232 SENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ-NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKI 328          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Match: celf4 (CUGBP, Elav-like family member 4 [Source:NCBI gene;Acc:436835])

HSP 1 Score: 431.795 bits (1109), Expect = 1.634e-143
Identity = 251/515 (48.74%), Postives = 322/515 (62.52%), Query Frame = 2
Query:  431 SVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+S+  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    + A T  ++ SP+  S   F   TG      N   P+ AM TN              H  PV         ++   L     SC  V   Q +C         S   +D    +Y  +  +  AFPA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   38 TIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSTHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPMTPTSGGSTPPGITAPTVTSIPSPI--SVNGF---TGLPPPQANGQAPAEAMFTN------------GIHPYPVLQEVVFREDSEKGGLGVAQRSCFGV---QGSCFLSSLSEAQSPTAADPLQQAYAGVQQYA-AFPAAYGQISQAFPQPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 520          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 425.246 bits (1092), Expect = 8.494e-141
Identity = 242/505 (47.92%), Postives = 315/505 (62.38%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KD DAIKLF+GQIPR+L+E DL+P+FE++G+I+E ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK QTEEDV RLF+ +G IEECTVLR  +GNSKGCAFVKFS+  EA +AISALHGSQTM GASSS+VVKFADT+KER  R++QQ++    + N ++AL     + Y   ++  Q           L+P      VA  + Q+ Q   L ++  +    + P +G+ +        A L SP        +I T A         PS       GF  +SI      H   V A++++      + S       Q A  G Q       AT+ +              PIGQ      SL  P + +++     GPE CNLFIYHLP EFGD++L+QMF PFG + S+KV++DRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   73 KDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAP-----SVAFPTTQIHQMGAL-NINSLPPTPMTPVSGEFH-----QTLAGLSSP------PANITTSAV--------PSIVTPIVNGF--TSIPHQPNGHPA-VEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPATTLT--------------PIGQ------SLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DASRPY 528          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Match: celf5a (cugbp, Elav-like family member 5a [Source:ZFIN;Acc:ZDB-GENE-050208-746])

HSP 1 Score: 414.461 bits (1064), Expect = 6.778e-137
Identity = 234/506 (46.25%), Postives = 308/506 (60.87%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLP--SLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKP 1921
            KD DAIKLF+GQIPR+L+E DL+P+FE++G+I+E ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + + RKLFVGMLNK QTEEDV RLF+ +G IEECTVLR  +GNSKGCAFVKFS+  EA +AISALHGSQTM GASSS+VVKFADT+KER  R++QQ++    + N ++AL     + Y   ++  Q           L+P   F             + LP   +  ++GLS  P N      P      ++++P++          G   +   PNG       +P                 V A++++      + S       Q A  G Q       AT+ +              PIGQ      SL  P + +++     GPE CNLFIYHLP EFGD++L+QMF PFG + S+KV++DRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +P
Sbjct:   61 KDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGD-RKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHAEAQSAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAIALPFSTYSTYAHALMQQQAALMAASHGGYLAPSVAFPTTQIHQMGALNINSLPPTPMTPVSGLSSPPANITTSAVP------SIVTPIV---------NGFTSIPHQPNG-------HPA----------------VEAVYTNGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPATTLT--------------PIGQ------SLPQPPQVIQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DASRP 506          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 407.142 bits (1045), Expect = 4.832e-135
Identity = 238/504 (47.22%), Postives = 311/504 (61.71%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNL-------MNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALL--SPLLGSAQAFHINTGANYLTQNPNG-PSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLF+GQIPR+L+E DL+P+FE+YG+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K Q++EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF S  EA +AI++LHGS+T+ GASSS+VVKFADTEKER  R++QQ+ + L +        N+  A  Q              LSP        A S Q+QQ + L + +GI    I P +G        ANT   L  +P+    Q   +N G ++L    NG P+  + TN         +       PV A+                   Q A  G Q           ++Y +  A+G+  P    QF Q      + Q+ L+++    GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFIGQIPRNLEEKDLKPIFEQYGKIYELTVIKDKYTGMHKGCAFLTYCARESAVKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKLFVGMLGKQQSDEDVRKIFEPFGGIDECTVLRGPDGTSKGCAFVKFQSHSEAQSAINSLHGSRTLPGASSSLVVKFADTEKERGVRRMQQVTSQLGVYTPVTLNFNAYNAYTQALVQQQALVAQAQYLSP--------AASMQIQQMAAL-NASGIIATPITPPSG--------ANTPPTLAATPVSALPQPIAVN-GYSHLPPTTNGQPASEIYTN--------GLHPYQAQSPVAALDP----------------LQQAYAGMQHYT--------AAYPT--AYGLVSP----QFLQQ--PTLISQQQLQRE----GPEGCNVFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 442          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Match: celf3a (cugbp, Elav-like family member 3a [Source:NCBI gene;Acc:57922])

HSP 1 Score: 396.741 bits (1018), Expect = 7.707e-131
Identity = 231/503 (45.92%), Postives = 311/503 (61.83%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ--LSPPRIFNPVAALS-FQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATS--DSSYHSIPAFGIAFPAPIGQFGQ----SGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K++DAIKLF+GQIPR+L+E DL+P+FE++G+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + + RKLFVGML K  ++ DVR++F+ FG IEECTVLR  +G SKGCAFVK+ S  EA AAISALHGS+T+ GASSS+VVKFADTEKER  R++QQ+ + L ++ S ++L     N Y Q ++  Q  ++     +PVA ++  Q+QQ +           ++NP++       + A   A ++P  G++                  P+ A    P      IA+   N   PV A  +    S         +LY N   G       S A      +Y  +  +   +PA  G  GQ        +    +  ++     GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEADAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSEGRGD-RKLFVGMLGKQLSDADVRKMFEPFGSIEECTVLRGPDGASKGCAFVKYQSNAEAQAAISALHGSRTLPGASSSLVVKFADTEKERGIRRMQQVASQLGVI-SPMSLHLGAYNAYTQALVQQQALVAQSAYLSPVATVAAVQMQQLA-----------ALNPSS-------IIATPIASITPSSGTS----------------TPPTIAATPVPALP-PPIAV---NSYPPVPAAPNGQSASE--------ALYTN---GVHPYQAQSPALDPLQQAYTGMQHYTATYPAAYGLVGQPFPHQPTLVAQQPQQPQQLQQREGPEGCNIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 452          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 424.091 bits (1089), Expect = 9.914e-141
Identity = 248/523 (47.42%), Postives = 322/523 (61.57%), Query Frame = 2
Query:  401 NGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAA--LLSPLLGSAQAFHINTGANYLTQNPNG-PSFAMITNPGFSNSSIAMASQNHNLPVTAIHSS-AQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            +GPE   + +  + KD DAIKLFVGQIPR+L+E DL+P+FE++G+IYE ++L+D+ TG+HKGCAFLTYC R S+   Q ALH+QK+LPGMARP+QVKPA  E +  +RKLFVGML+K Q+EE+V  +F++FG IEEC+VLR  +G+SKGCAFVKFSS  EA AAI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++  L +   SLAL     + Y Q ++  Q           LSP      VA  S  +QQ   + +L G+    I P +G  +  PV    A   L++PL           G   L   P+  P+   I    ++NS +   +Q+  L V ++H S   +   S      ++Y  A L                 HS P      P PI Q           Q++        GPE CNLFIYHLP EFGD++L QMF PFG I S+KV++DRATNQSKCFGFVS+ N + AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   29 SGPEPPAQQSDSM-KDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSP-----SVAFPSCHIQQIGAV-NLNGLPAAPITPASG-LHSPPVIGTAAVPGLVAPL---------TNGFPGLVPFPSSHPALDTI----YTNSIVPYPAQSPALTVESLHPSFTGVQQYS------AIYPTAAL-------------TPVTHSTPQ-----PPPILQ-----------QRE--------GPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK-DTTQPY 486          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 422.935 bits (1086), Expect = 4.038e-140
Identity = 246/526 (46.77%), Postives = 324/526 (61.60%), Query Frame = 2
Query:  401 NGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQ-AYIDPVAANTAALLSPLLGSAQ----AFHINTGANYLTQNPNG-PSFAMITNPGFSNSSIAMASQNHNLPVTAIHSS-AQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            +GPE   + +  + KD DAIKLFVGQIPR+L+E DL+P+FE++G+IYE ++L+D+ TG+HKGCAFLTYC R S+   Q ALH+QK+LPGMARP+QVKPA  E +  +RKLFVGML+K Q+EE+V  +F++FG IEEC+VLR  +G+SKGCAFVKFSS  EA AAI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++  L +   SLAL     + Y Q ++  Q           LSP      VA  S  +QQ   + +L G+    I P +G+  +   + A       P++G+A        +  G   L   P+  P+   I    ++NS +   +Q+  L V ++H S   +   S      ++Y  A L                 HS P      P PI Q           Q++        GPE CNLFIYHLP EFGD++L QMF PFG I S+KV++DRATNQSKCFGFVS+ N + AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   29 SGPEPPAQQSDSM-KDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSP-----SVAFPSCHIQQIGAV-NLNGLPAAPITPASGEFLWGCEIRAKIGLHSPPVIGTAAVPGLVAPLTNGFPGLVPFPSSHPALDTI----YTNSIVPYPAQSPALTVESLHPSFTGVQQYS------AIYPTAAL-------------TPVTHSTPQ-----PPPILQ-----------QRE--------GPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK-DTTQPY 499          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 374.785 bits (961), Expect = 1.105e-121
Identity = 234/531 (44.07%), Postives = 306/531 (57.63%), Query Frame = 2
Query:  401 NGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--------TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAA--LLSPLLGSAQAFHINTGANYLTQNPNG-PSFAMITNPGFSNSSIAMASQNHNLPVTAIHSS-AQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            +GPE   + +  + KD DAIKLFVGQIPR+L+E DL+P+FE++G+IYE ++L+D+ TG+HKGCAFLTYC R S+   Q ALH+QK+LPGMARP+QVKPA  E +          +RKLFVGML+K Q+EE+V  +F++FG IEEC+VLR  +G+SKGCAFVKFSS  EA AAI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++  L +   SLAL     + Y Q ++  Q           LSP      VA  S  +QQ   + +L G+    I P +G  +  PV    A   L++PL           G   L   P+  P+   I    ++NS +   +Q+  L V ++H S   +   S      ++Y  A L                 HS P      P PI Q           Q++        GPE CNLFIYHLP EFGD++L QMF PFG I S+KV                + N + AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   32 SGPEPPAQQSDSM-KDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGMYPVHLPSDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSP-----SVAFPSCHIQQIGAV-NLNGLPAAPITPASG-LHSPPVIGTAAVPGLVAPL---------TNGFPGLVPFPSSHPALDTI----YTNSIVPYPAQSPALTVESLHPSFTGVQQYS------AIYPTAAL-------------TPVTHSTPQ-----PPPILQ-----------QRE--------GPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKV----------------FDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK-DTTQPY 481          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 322.398 bits (825), Expect = 2.999e-101
Identity = 206/517 (39.85%), Postives = 288/517 (55.71%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTG--IHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYI-------------DPVAANTAAL---LSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEK-DMGGS---GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQIPRS  E +L+ +FE YG +Y+ ++LRD+       KGC F+T+  R+++   Q ALH+ K+LPGM  P+Q+KPA  E+    E+RKLF+GM++K   E D+R +F  FG+IEEC +LR  +G S+GCAFV FS++  A  AI A+H SQTM+G SS IVVKFADT+K+++ R+LQQ +       ++       GN+ G   L  Q          A  S  L   SG+  +AG+  L +      A               +P++  T+AL    SP+  S          N LT        ++ T  G + +++ + +      + A+  +  I+ +      +    N  LG   +   ++ T D+   +           I Q+  + L     Q  L++    GS   GPE  NLFIYHLP EFGD D+LQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQAMNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   31 DPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATW----GNLTGLGALTPQY---LALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATTTNANPLSTTTSALGALTSPVAASTANSSAGAAMNSLT--------SLGTLQGLAGATVGLNN------INALAGTVNIAQMLSGMAAL----NGGLGATGLTNGTAGTMDALTQAYSG--------IQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDS-KPY 513          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Match: celf2 (CUGBP, Elav-like family member 2 [Source:NCBI gene;Acc:100125022])

HSP 1 Score: 322.783 bits (826), Expect = 4.553e-101
Identity = 206/517 (39.85%), Postives = 288/517 (55.71%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYI-------------DPVAANTAAL---LSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEK-DMGGS---GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQIPRS  E +L+ +FE YG +Y+ ++LRD+       KGC F+T+  R+++   Q ALH+ K+LPGM  P+Q+KPA  E+    E+RKLF+GM++K   E D+R +F  FG+IEEC +LR  +G S+GCAFV FS++  A  AI A+H SQTM+G SS IVVKFADT+K+++ R+LQQ +       ++       GN+ G   L  Q          A  S  L   SG+  +AG+  L +      A               +P++  T+AL    SP+  S          N LT        ++ T  G + +++ + +      + A+  +  I+ +      +    N  LG   +   ++ T D+   +           I Q+  + L     Q  L++    GS   GPE  NLFIYHLP EFGD D+LQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQAMNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   54 DPDAIKMFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATW----GNLTGLGALTPQY---LALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATTTNANPLSTTTSALGALTSPVAASTANSSAGAAMNSLT--------SLGTLQGLAGATVGLNN------INALAGTVNIAQMLSGMAAL----NGGLGATGLTNGTAGTMDALTQAYSG--------IQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDS-KPY 536          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Match: Celf5 (CUGBP, Elav-like family member 5 [Source:MGI Symbol;Acc:MGI:2442333])

HSP 1 Score: 414.846 bits (1065), Expect = 6.742e-138
Identity = 246/512 (48.05%), Postives = 303/512 (59.18%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEE-RKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ----------LSPPRIFNPVAALSFQLQQTSGLPS--LAGITGLSINPTNGQAYID----PVAANTAALLSPLLGSAQAFHINTGANYLTQNP-NGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KD DAIKLFVGQIPR L E DL+P+FE++G+IYE ++L+D  TG+HKGCAFLTYC R S+   Q ALH+QK+LPGMARP+QVKPA  E R   +RKLFVGMLNK Q+EEDV RLF+ FG I+ECTVLR  +G+SKGCAFVKFSS  EA AAI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++  L ++  SL L     + Y Q ++  Q          LSP   F P           +GLP+  +A  +GL   P  G A +     P+      +L P  GS  A      AN L   P   P+ A   +P FS        Q +    TA++ +A I+ ++                               HS+P                      P   L++   G  PE CNLFIYHLP EFGD +L QMF PFG I S+KV++DRATNQSKCFGFVS+ + A AQAAIQAMNGFQ+G+KRLKVQLKRPK D   PY
Sbjct:    2 KDLDAIKLFVGQIPRHLHEQDLKPLFEQFGRIYELTVLKDPHTGVHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFPPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTAAVPGLMAPIPNGFPGVL-PFPGSHPALE-TVYANGLVPYPAQSPTVAETLHPAFSG------VQQY----TAMYPTAAIAPVA-------------------------------HSVPQ---------------------PPHLLQQQREG--PEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDHPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DPGHPY 446          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 407.142 bits (1045), Expect = 2.950e-134
Identity = 234/510 (45.88%), Postives = 318/510 (62.35%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG-NIYGQTILDNQ----LSPPRIFNPVAAL-SFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPG---FSNSSIAMASQNHNLPVTA-IHSS-AQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGG-----SGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLFVGQIPR L+E DL+P+FE++G+I+E ++++DK TG+HKGCAFLTYC R S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ LH S+T+ GASSS+VVKFADTEKER  R++QQ+   L  M S +AL Q G  + Y Q ++  Q     +     +P+A + + Q+Q  + + S  G+    I P++G +    +AA   + +   LG      +N  +   TQ    P+   +   G   + + +++       +P+ +  HS    +S        V   Q A  G Q    + +A   ++Y  +     AFP P     Q        Q+  ++          GP+ CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLG-MFSPIAL-QFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAI-SANGLIATPITPSSGTSTPPAIAATPVSAIPAALG------VNGYSPVPTQPTGQPAPDALYPNGVHPYPDEALSAERSAGGVPIMSQAHSWLVMLSAAQSPAAPVDPLQQAYAGMQ----HYTAAYPAAYSLV---APAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 494          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Match: Celf3 (CUGBP, Elav-like family member 3 [Source:MGI Symbol;Acc:MGI:1926034])

HSP 1 Score: 396.741 bits (1018), Expect = 1.477e-130
Identity = 230/505 (45.54%), Postives = 308/505 (60.99%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG-NIYGQTILDNQLS----PPRIFNPVAALS-FQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGG-----SGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLFVGQIPR L+E DL+P+FE++G+I+E ++++DK TG+HKGCAFLTYC R S+   Q ALH+QK+LPGM RP+QVKPA  E + + RKLFVGML K QT+EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ LH S+T+ GASSS+VVKFADTEKER  R++QQ+   L  M S +AL Q G  + Y Q ++  Q +         +P+A ++  Q+Q  + + S  G+    I P++G +    +AA   + +   L          G N  +  P  P+     +  + N      +Q+   PV  +                   Q A  G Q    + +A   ++Y  +     AFP P     Q        Q+  ++          GP+ CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGD-RKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLG-MFSPIAL-QFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAI-SANGLIATPITPSSGTSTPPAIAATPVSAIPAAL----------GVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPL-------------------QQAYAGMQ----HYTAAYPAAYSLV---APAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 465          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Match: Celf1 (CUGBP, Elav-like family member 1 [Source:MGI Symbol;Acc:MGI:1342295])

HSP 1 Score: 329.717 bits (844), Expect = 2.011e-104
Identity = 207/503 (41.15%), Postives = 296/503 (58.85%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS------GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQ+PR+  E DLR +FE+YG +YE +ILRD+       KGC F+T+  R+++   Q ALH+ K LPGM  P+Q+KPA  E+    E+RKLF+GM++K  TE D+R +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI A+H +QTM+G SS +VVKFADT+K+++ ++   +   L      ++ A + GN+ G     N L P  +     AL   LQQT+   +L  ++  S++P  G       A     L +    ++ A +  +G N LT + +  S         ++S+ +  S + +  V  I S   +  L+ +   +++   A +        SS  S+ +  ++ A   A+   I Q+  + L     Q  L +   G+      GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQ+MNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   12 DLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRTMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKR---MAQQLQQQMQQISAASVWGNLAGL----NTLGPQYL-----AL---LQQTASSGNLNTLS--SLHPMGGLN-----AMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSV-------LTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSG-IQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS-KPY 483          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Match: Celf1 (CUGBP, Elav-like family member 1 [Source:MGI Symbol;Acc:MGI:1342295])

HSP 1 Score: 329.717 bits (844), Expect = 2.011e-104
Identity = 207/503 (41.15%), Postives = 296/503 (58.85%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERK--TEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS------GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            D DAIK+FVGQ+PR+  E DLR +FE+YG +YE +ILRD+       KGC F+T+  R+++   Q ALH+ K LPGM  P+Q+KPA  E+    E+RKLF+GM++K  TE D+R +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI A+H +QTM+G SS +VVKFADT+K+++ ++   +   L      ++ A + GN+ G     N L P  +     AL   LQQT+   +L  ++  S++P  G       A     L +    ++ A +  +G N LT + +  S         ++S+ +  S + +  V  I S   +  L+ +   +++   A +        SS  S+ +  ++ A   A+   I Q+  + L     Q  L +   G+      GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQ+MNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   12 DLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRTMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKR---MAQQLQQQMQQISAASVWGNLAGL----NTLGPQYL-----AL---LQQTASSGNLNTLS--SLHPMGGLN-----AMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSV-------LTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSG-IQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDS-KPY 483          
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Match: sp|Q6DGV1|CELF4_DANRE (CUGBP Elav-like family member 4 OS=Danio rerio OX=7955 GN=celf4 PE=2 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 1.234e-142
Identity = 251/515 (48.74%), Postives = 322/515 (62.52%), Query Frame = 2
Query:  431 SVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+S+  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    + A T  ++ SP+  S   F   TG      N   P+ AM TN              H  PV         ++   L     SC  V   Q +C         S   +D    +Y  +  +  AFPA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   38 TIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSTHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPMTPTSGGSTPPGITAPTVTSIPSPI--SVNGF---TGLPPPQANGQAPAEAMFTN------------GIHPYPVLQEVVFREDSEKGGLGVAQRSCFGV---QGSCFLSSLSEAQSPTAADPLQQAYAGVQQYA-AFPAAYGQISQAFPQPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 520          
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Match: sp|A0JM51|CELF5_XENTR (CUGBP Elav-like family member 5 OS=Xenopus tropicalis OX=8364 GN=celf5 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 5.252e-140
Identity = 248/523 (47.42%), Postives = 322/523 (61.57%), Query Frame = 2
Query:  401 NGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ-----------LSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAA--LLSPLLGSAQAFHINTGANYLTQNPNG-PSFAMITNPGFSNSSIAMASQNHNLPVTAIHSS-AQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            +GPE   + +  + KD DAIKLFVGQIPR+L+E DL+P+FE++G+IYE ++L+D+ TG+HKGCAFLTYC R S+   Q ALH+QK+LPGMARP+QVKPA  E +  +RKLFVGML+K Q+EE+V  +F++FG IEEC+VLR  +G+SKGCAFVKFSS  EA AAI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++  L +   SLAL     + Y Q ++  Q           LSP      VA  S  +QQ   + +L G+    I P +G  +  PV    A   L++PL           G   L   P+  P+   I    ++NS +   +Q+  L V ++H S   +   S      ++Y  A L                 HS P      P PI Q           Q++        GPE CNLFIYHLP EFGD++L QMF PFG I S+KV++DRATNQSKCFGFVS+ N + AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   29 SGPEPPAQQSDSM-KDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGDRKLFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRGPDGSSKGCAFVKFSSHAEAQAAIQALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGIFTPSLALPISPYSAYAQALMQQQTTVLSTSHGSYLSP-----SVAFPSCHIQQIGAV-NLNGLPAAPITPASG-LHSPPVIGTAAVPGLVAPL---------TNGFPGLVPFPSSHPALDTI----YTNSIVPYPAQSPALTVESLHPSFTGVQQYS------AIYPTAAL-------------TPVTHSTPQ-----PPPILQ-----------QRE--------GPEGCNLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK-DTTQPY 486          
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Match: sp|Q91579|CEL3A_XENLA (CUGBP Elav-like family member 3-A OS=Xenopus laevis OX=8355 GN=tnrc4-a PE=2 SV=2)

HSP 1 Score: 409.838 bits (1052), Expect = 7.857e-135
Identity = 242/503 (48.11%), Postives = 310/503 (61.63%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQL--------SPPRIFNPVAAL-SFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLF+GQIPR+L E DL+P+FE++G+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVRR+F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ALHGS+T+ GASSS+VVKFADTEKER  R++QQ+ N L  M S +AL     + Y Q + D  +        +     NP+A + + Q+QQ + + +  GI    I        I+P+ +++     P L + Q   I       T   NG S A+ T      SS A+ + N   P  A    AQ+  L          Q A  G Q       A          A+G+  PA               Q+  E      GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N   AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRRMFEPFGNIDECTVLRGPDGTSKGCAFVKFQTHTEAQAAINALHGSRTLPGASSSLVVKFADTEKERGLRRMQQVANQLG-MFSPIALQFGAYSAYTQAVSDQLMQQQAALVAAHSAYLNPMATMAAVQMQQMATI-NPNGIIATPIT------QINPITSSSGTSTPPTLTATQVSAIPA-----TLGVNGYS-AVPTQSTVQPSSEAIYT-NGLHPYPAQSPVAQLDPL----------QQAYAGMQHYTAAYPA----------AYGLVSPAFTQPPAILQQQPPQQQQQRE------GPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 462          
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Match: sp|Q7ZWM3|CEL3B_XENLA (CUGBP Elav-like family member 3-B OS=Xenopus laevis OX=8355 GN=tnrc4-b PE=2 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 2.305e-134
Identity = 236/503 (46.92%), Postives = 305/503 (60.64%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQL--------SPPRIFNPVAAL-SFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLF+GQIPR+L E DL+P+FE++G+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVRR+F++FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ALHGS+T+ GASSS+VVKFADTEKER  R++QQ+ N L  M S +AL     + Y Q + D  +        +     NP+A + + Q+QQ + + +  GI    I   N        +       +P+        +N  +   TQ+   PS   I   G               P  A    AQ+  L          Q A  G Q       A          A+G+  PA    F Q    LT   +  ++     GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRRMFETFGNIDECTVLRGPDGTSKGCAFVKFQTHTEAQAAINALHGSRTLPGASSSLVVKFADTEKERGLRRMQQVANQLG-MFSPIALQFGAYSAYTQAVSDQLMQQQAALVAAQSAYLNPMATMAAVQMQQMATI-NPNGIIATPITQINSITSSSGTSTPPTLTATPVSAIPATLGVNGYSAVPTQSTVQPSSEAIYTNGLH-------------PYPAQSPVAQLDPL----------QQAYAGMQHYTAAYPA----------AYGLVSPA----FTQPPAILTQ--QPPQQQQQREGPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 462          
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Match: sp|Q08E07|CELF3_BOVIN (CUGBP Elav-like family member 3 OS=Bos taurus OX=9913 GN=CELF3 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 3.576e-132
Identity = 230/501 (45.91%), Postives = 305/501 (60.88%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGG-NIYGQTILDNQ----LSPPRIFNPVAAL-SFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGG-SGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLFVGQIPR L+E DL+P+FE++G+I+E ++++DK TG+HKGCAFLTYC R S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVR++F+ FG I+ECTVLR  +G SKGCAFVKF +  EA AAI+ LH S+T+ GASSS+VVKFADTEKER  R++QQ+   L  M S +AL Q G  + Y Q ++  Q     +     +P+A + + Q+Q  + + +  G+    I P++G +    +AA   + +   L          G N  +  P  P+     +  + N      +Q+   PV  +                   Q A  G Q      +A S            AFP P     Q        Q+  ++      GP+ CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLG-MFSPIAL-QFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAI-NANGLIATPITPSSGTSTPPAIAATPVSAIPAAL----------GVNGYSPVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPL-------------------QQAYAGMQHYTAYPAAYS--------LVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 461          
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Match: R7TIA4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183838 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 3.829e-145
Identity = 249/495 (50.30%), Postives = 315/495 (63.64%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAM-ITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KD+DAIKLFVGQIPR+L+E DLRP+FEE+GQIYE ++L+D+ TG+HKGCAFLTYC R S+   Q+ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+EE+VR++F  +G IEECT+LRDQNGNSKGCAFVKF++  +A AAI+ALHGSQTM GASSS+VVKFADTEKERQ RK+QQ+  PL L+ S  AL+Q G                  +          QQ + + + A     SINPT        ++A TA+ +   L  A    ++T A   T   + P+F   +T P   + + AM +     P+T  +  A    +  S +     Q    G       S     +   + PA    F   + Q   + +  T  QK+        GPE CNLFIYHLP EFGD +L QMF PFG + SAKVY+DRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   12 KDADAIKLFVGQIPRNLEEKDLRPIFEEFGQIYELTVLKDRFTGMHKGCAFLTYCARDSALKAQQALHEQKTLPGMNRPIQVKPADSESRAEDRKLFVGMLNKQQSEEEVRQMFSPYGSIEECTILRDQNGNSKGCAFVKFTTHADAQAAINALHGSQTMPGASSSLVVKFADTEKERQLRKMQQMTGPLGLL-SPFALSQFG-----------------TYGAYTQQQLVQQQAALMAAAAAQGSYSINPT--------MSALTASQVPHAL--AMQNGLSTAAITPTSGASNPAFLQELTPPTMLSPTAAMTA----FPMTQANGQA---VMDPSGIQQYQAQAMAAGDPLTQAYSGVQQYAGIATYPAAYGQFQQALAQHAATIIPTTTAQKE--------GPEGCNLFIYHLPQEFGDAELAQMFMPFGNVISAKVYIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 462          
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Match: A0A1A8HH89 (CUGBP, Elav-like family member 4 OS=Nothobranchius korthausae OX=1143690 GN=CELF4 PE=4 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 5.565e-140
Identity = 251/519 (48.36%), Postives = 326/519 (62.81%), Query Frame = 2
Query:  419 GKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            G   ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    ++A T  ++ SP+  S   F   TG      N   P+ A+ TN              H+ PV         ++ + L     SC  V   Q  C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   36 GCPATIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPLTPTSGGSTPPGISAPTVTSIPSPI--SVNGF---TGIPPPQANGQPPAEAVFTN------------GIHHYPVLQEVVFREDSEKNGLGVAPRSCFGV---QGGCFLSSLSEAQSPTAADPLQQAYTGVQQYA-AYPAAYGQISQAFPHPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 522          
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Match: I3KTQ3 (CUGBP, Elav-like family member 4 OS=Oreochromis niloticus OX=8128 GN=celf4 PE=4 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 5.687e-140
Identity = 251/519 (48.36%), Postives = 326/519 (62.81%), Query Frame = 2
Query:  419 GKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            G   ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    ++A T  ++ SP+  S   F   TG      N   P+ A+ TN              H+ PV         ++ + L     SC  V   Q  C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   38 GCPATIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPLTPTSGGSTPPGISAPTVTSIPSPI--SVNGF---TGMPPPQANGQPPAEAVFTN------------GIHHYPVLQEVVFREDSEKNGLGVAPRSCFGV---QGGCFLSSLSEAQSPTAADPLQQAYTGVQQYA-AYPAAYGQISQAFPHPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 524          
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Match: A0A1A8V734 (CUGBP, Elav-like family member 4 OS=Nothobranchius furzeri OX=105023 GN=CELF4 PE=4 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 5.810e-140
Identity = 251/519 (48.36%), Postives = 326/519 (62.81%), Query Frame = 2
Query:  419 GKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            G   ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    ++A T  ++ SP+  S   F   TG      N   P+ A+ TN              H+ PV         ++ + L     SC  V   Q  C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   36 GCPATIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPLTPTSGGSTPPGISAPTVTSIPSPI--SVNGF---TGIPPPQANGQPPAEAVFTN------------GIHHYPVLQEVVFREDSEKNGLGVAPRSCFGV---QGGCFLSSLSEAQSPTAADPLQQAYTGVQQYA-AYPAAYGQISQAFPHPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 522          
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Match: A0A1A8M1X6 (CUGBP, Elav-like family member 4 OS=Nothobranchius pienaari OX=704102 GN=CELF4 PE=4 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 5.810e-140
Identity = 251/519 (48.36%), Postives = 326/519 (62.81%), Query Frame = 2
Query:  419 GKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            G   ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    ++A T  ++ SP+  S   F   TG      N   P+ A+ TN              H+ PV         ++ + L     SC  V   Q  C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   36 GCPATIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPLTPTSGGSTPPGISAPTVTSIPSPI--SVNGF---TGIPPPQANGQPPAEAVFTN------------GIHHYPVLQEVVFREDSEKNGLGVAPRSCFGV---QGGCFLSSLSEAQSPTAADPLQQAYTGVQQYA-AYPAAYGQISQAFPHPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 522          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Match: celf4 (CUGBP Elav-like family member 4 [Source:NCBI gene;Acc:103032019])

HSP 1 Score: 421.394 bits (1082), Expect = 1.390e-139
Identity = 251/515 (48.74%), Postives = 322/515 (62.52%), Query Frame = 2
Query:  431 SVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            ++  KD DAIKLFVGQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    + A T  ++ SP+  S   F   TG      N   P+ A+ TN              H  PV         ++   L     SC  V   Q +C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   30 TIPMKDHDAIKLFVGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPMTPTSGGSTPPGITAPTVTSIPSPI--SVNGF---TGLPPPQANGQPPAEAVFTN------------GIHPYPVLQEVVFREDSEKGGLGVAQRSCFGV---QGSCFLSSLSEAQSPTAADPLQQAYAGVQQYAAAYPAAYGQISQAFPQPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 513          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Match: ENSAMXT00000012369.2 (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:103039850])

HSP 1 Score: 418.313 bits (1074), Expect = 1.006e-137
Identity = 230/516 (44.57%), Postives = 309/516 (59.88%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLAL--------------------AQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLP--SLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KD DAIKLF+GQIPR+L+E DL+P+FE++G+I+E ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK QTEEDV R+F+ +G IEECTVLR  +GNSKGCAFVKFS+  EA +AI  LHGSQTM GASSS+VVKFADT+KER  R++QQ++    + N ++AL                    A +    +G  +  +   P    + V AL+      +GLP   +  ++GLS  P N       +A++  ++++P++                                 N    +A Q +  PV A++++      + S       Q A  G Q        T+ +              PIGQ     L         ++     GPE CNLFIYHLP EFGD++L+QMF PFG++ S+KV++DRATNQSKCFGFVS+ N A A AAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:  105 KDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKLFVGMLNKQQTEEDVYRIFEPYGVIEECTVLRGPDGNSKGCAFVKFSTHTEAQSAIGGLHGSQTMPGASSSLVVKFADTDKERTIRRMQQMVGQFGIFNPAVALPFSTYSSTYSTYTHALMQQQAAIMAASHGAYLAPSMAFPATQIHQVGALNM-----NGLPPTPMTPVSGLSSPPAN-------LASSVPSIVTPIV---------------------------------NGFTGIAPQPNGHPVEAVYANGLPPYSTQSPTAADTLQQAFTGVQQYTAIYPTTTLT--------------PIGQ----TLPQPPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGSVISSKVFMDRATNQSKCFGFVSFDNPASAHAAIQAMNGFQIGMKRLKVQLKRPK-DASRPY 556          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Match: celf4 (CUGBP Elav-like family member 4 [Source:NCBI gene;Acc:103032019])

HSP 1 Score: 367.466 bits (942), Expect = 4.546e-119
Identity = 223/479 (46.56%), Postives = 289/479 (60.33%), Query Frame = 2
Query:  431 SVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITN-----PGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNV 1819
            ++  KD DAIKLFVGQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    + A T  ++ SP+  S   F   TG      N   P+ A+ TN     P          S+   L V              SC  V   Q +C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFV   ++
Sbjct:   30 TIPMKDHDAIKLFVGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPMTPTSGGSTPPGITAPTVTSIPSPI--SVNGF---TGLPPPQANGQPPAEAVFTNGIHPYPVLQEVVFREDSEKGGLGVA-----------QRSCFGV---QGSCFLSSLSEAQSPTAADPLQQAYAGVQQYAAAYPAAYGQISQAFPQPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVELEHM 479          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Match: celf4 (CUGBP Elav-like family member 4 [Source:NCBI gene;Acc:103032019])

HSP 1 Score: 293.893 bits (751), Expect = 1.415e-91
Identity = 134/198 (67.68%), Postives = 164/198 (82.83%), Query Frame = 2
Query:  431 SVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMN 1024
            ++  KD DAIKLFVGQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + + RKLFVGMLNK Q E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N
Sbjct:   34 TIPMKDHDAIKLFVGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQTALHEQKTLPGMNRPIQVKPADSESRGD-RKLFVGMLNKQQCEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN 230          

HSP 2 Score: 65.4698 bits (158), Expect = 9.609e-11
Identity = 31/43 (72.09%), Postives = 37/43 (86.05%), Query Frame = 2
Query: 1796 GFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:  390 GFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 431          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Match: celf3b (cugbp, Elav-like family member 3b [Source:ZFIN;Acc:ZDB-GENE-110408-50])

HSP 1 Score: 289.271 bits (739), Expect = 1.501e-90
Identity = 185/426 (43.43%), Postives = 242/426 (56.81%), Query Frame = 2
Query:  668 MARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ---LSPPRIFNPVAAL-SFQLQQTSGLPSLAGITG---LSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            M RP+QVKPA  E + E+RKLFVGML K Q ++DVR++F+ FG I+ECT+LR  +G SKGCAFVKF S  EA AAI++LHGS+T+ GASSS+VVKFADTEKER  R++QQ+ + L++  S + L     N Y Q ++  Q   ++     +P+A + + Q+QQ + L +  GI       I P++G      +AA     L P +       + T AN                 G S S     +  H  P  A  + A +  L          Q A  G Q              H   A+  A+      F Q      VPQ+  +++    GPE CN+FIYHLP EF D +LLQMF PFG + SAKV+VDRATNQSKCFGFVS+ N   AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    1 MNRPIQVKPADSEGRGEDRKLFVGMLGKQQEDDDVRKMFELFGRIDECTILRAPDGTSKGCAFVKFQSHAEAQAAINSLHGSRTLPGASSSLVVKFADTEKERGLRRMQQVASQLSVF-SPMTLNLGAYNAYAQALVQQQQTLVAQSAYLSPIATVATVQMQQMAAL-NANGIIATPITPITPSSGTNTPPSIAATPVPALPPPIALNGYSPVPTAAN-----------------GQSASETIYTNGIH--PFQAQSAVAVLDPL----------QQAYTGMQ--------------HYTAAYPAAYGLVSSPFPQQ--PTLVPQQQQQRE----GPEGCNIFIYHLPQEFTDSELLQMFVPFGNVISAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 374          

HSP 2 Score: 65.4698 bits (158), Expect = 7.764e-11
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            KLFVG + +  ++ D+R MFE +G+I E +ILR    G  KGCAF+ +     ++A   +LH  ++LPG +  L VK A  E++   R++
Sbjct:   20 KLFVGMLGKQQEDDDVRKMFELFGRIDECTILRAP-DGTSKGCAFVKFQSHAEAQAAINSLHGSRTLPGASSSLVVKFADTEKERGLRRM 108          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002852.1 (pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-1 gene:ENSPMAG00000002591.1 transcript:ENSPMAT00000002852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.956 bits (463), Expect = 7.207e-53
Identity = 86/188 (45.74%), Postives = 133/188 (70.74%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGI--HKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKT--EERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQ 997
            D DAIK+FVGQIPRS  E +LR +FE++G +YE +I+RD+       +GC F+T+  R+++   Q ALH+ K+LPG+  P ++ P+     +  EERKLF+GM++K  +E D+R +F  FG++EEC VLR  +G SKGCAF+ ++++  A  AI  +H SQTM+G ++ + VKFADT+K+++ ++LQQ
Sbjct:   48 DLDAIKMFVGQIPRSWSEKELRDLFEQFGPVYEINIVRDRTQKPPQSRGCCFVTFYTRKAALEAQNALHNIKTLPGLHAPTELVPSTTSSSSSLEERKLFIGMISKKCSENDIRAMFSPFGQMEECRVLRGPDGQSKGCAFITYTARAMAQNAIKGMHQSQTMEGCAAPL-VKFADTQKDKEQKRLQQ 234          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007375.1 (pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 gene:ENSPMAG00000006638.1 transcript:ENSPMAT00000007375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 1.590e-52
Identity = 90/191 (47.12%), Postives = 131/191 (68.59%), Query Frame = 2
Query:  446 DSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVT--GIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKT--EERKLFVGMLNKNQTEEDVRRLFKSF------GEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRK 988
            D DAIK+FVGQIPRS  ES+LR +FE++G ++E ++LRD+     + +GC F+TYC R+++   Q +LH+ K+LPGM  P+Q+KPA  E+ +  EERKLF+GML+K  +E DVR +F  F      G     TVL       K C F+ F++++ A  AI ++H SQTM+G SS++VVKFADT+K+++ RK
Sbjct:   13 DPDAIKMFVGQIPRSWGESELRELFEQFGAVHEVNVLRDRTQTPAVSRGCCFVTYCTRKAALEAQSSLHNIKTLPGMYHPIQMKPADSEKSSGMEERKLFIGMLSKQLSEADVRVIFSPFVGENPLGGAPLDTVL-------KWCGFITFATRMMAQNAIKSMHHSQTMEGCSSAVVVKFADTQKDKEQRK 196          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008846.1 (pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1 gene:ENSPMAG00000008007.1 transcript:ENSPMAT00000008846.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 1.147e-39
Identity = 67/91 (73.63%), Postives = 75/91 (82.42%), Query Frame = 2
Query: 1652 GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            GPE  NLFIYHLP EFGD DL+Q F PFG++ S+KV+VD+ TN SKCFGFVSY N   AQAAIQAMNGFQ+G KRLKVQLKR K+DS KPY
Sbjct:    1 GPEGANLFIYHLPQEFGDQDLMQTFMPFGSVVSSKVFVDKQTNLSKCFGFVSYDNPISAQAAIQAMNGFQIGTKRLKVQLKRSKNDS-KPY 90          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Match: rbm45 (RNA binding motif protein 45 [Source:ZFIN;Acc:ZDB-GENE-070122-4])

HSP 1 Score: 86.6557 bits (213), Expect = 4.093e-18
Identity = 53/155 (34.19%), Postives = 89/155 (57.42%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLP--GMARPL-----QVKPAKEERKTEERKL--FVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQN-GNSKGCAFVKFSSQVEALAAI 895
            +LF+  + ++  E+D+R  F  +G++ +  I++DK T  HKG AF+ Y   ++SEAC RA+ +    P  G  +P+     Q + +   R  E+  L     M+ K  TEED+R  F+ +G+IE C++L+D+N  +SKG  +V+F    +A  AI
Sbjct:   19 RLFL-VVSKTTSEADIREKFSRFGELQDLWIVKDKHTKEHKGIAFIKYA--RASEAC-RAMEEMNGQPLSGDGKPIKAMVAQSRASNNHRDLEDEDLTRIFLMIPKTYTEEDLRENFQEYGDIEYCSILKDKNTKDSKGFGYVRFLKPSQAALAI 169          

HSP 2 Score: 47.3654 bits (111), Expect = 9.285e-6
Identity = 26/91 (28.57%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  725 KLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNS-KGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQ 994
            +LF+ +++K  +E D+R  F  FGE+++  +++D++    KG AF+K++   EA  A+  ++G Q + G    I    A +      R L+
Sbjct:   19 RLFL-VVSKTTSEADIREKFSRFGELQDLWIVKDKHTKEHKGIAFIKYARASEACRAMEEMNG-QPLSGDGKPIKAMVAQSRASNNHRDLE 107          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 69.3218 bits (168), Expect = 1.240e-12
Identity = 50/190 (26.32%), Postives = 90/190 (47.37%), Query Frame = 2
Query:  434 VLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGS-----QTMQGASSSIVVKFAD-TEKERQTR 985
            +L+       L++  +P    + DL  + + YG+I     + DK T   KG  F+   H  S  A Q+A+   K     A  +Q + AK++ + +   L++  L  +  E+++  + K FG++    +LRD NG S+G  F +  S  +  A I   +G        +   S  ++ KFAD  +K+RQ++
Sbjct:   50 ILADHLSKTNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFV---HFDSPAAAQKAVTALK-----ANGVQAQMAKQQEQ-DPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDANGTSRGVGFARMESTEKCEAVIQHFNGKFIQIPPGVPAPSEPLLCKFADGGQKKRQSQ 230          

HSP 2 Score: 60.4622 bits (145), Expect = 6.499e-10
Identity = 31/76 (40.79%), Postives = 45/76 (59.21%), Query Frame = 2
Query: 1667 NLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAM--NGFQLGLKRLKVQ 1888
            NL+I  LPP   D DL ++  P+G I S K  +D+ TNQ K +GFV + + A AQ A+ A+  NG Q  + + + Q
Sbjct:   59 NLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTALKANGVQAQMAKQQEQ 134          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 66.2402 bits (160), Expect = 1.016e-11
Identity = 44/153 (28.76%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  422 KSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALH--DQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQN-GNSKGCAFVKFSS 871
            +S + LSK+S   K+F+G +     E +LR  F +YG + +  I++D  TG  +G  FL++    S +   +  H  D K +     P +  P  E+ KT   K+FVG +  +   ++    F  +G I +  ++ D++ G S+G  FV + S
Sbjct:  149 RSKADLSKES--CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVI----DPKRAIPRDEQDKT--GKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDS 293          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 60.077 bits (144), Expect = 8.382e-10
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  464 LFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEE---RKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHG 910
            L+VG +  S+ E+ L  +F   G +    + RD +T    G A++ +      EA ++A+      P   R  ++  ++ +   RK     +F+  L+ +   + +   F  FG+I    +  D+NG SKG  FV F  +  A  AI AL+G
Sbjct:   40 LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNF---NDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNG 188          

HSP 2 Score: 52.7582 bits (125), Expect = 1.675e-7
Identity = 37/100 (37.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 1619 QKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKV--QLKRPKSDS 1912
            Q+D      GSG    N+FI +L P+  +  L   FS FG I S+K+  D    +SK FGFV +     A+ AI A+NG  L  + + V   L R + DS
Sbjct:  115 QRDPSLRKKGSG----NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDS 209          

HSP 3 Score: 51.9878 bits (123), Expect = 2.488e-7
Identity = 53/195 (27.18%), Postives = 85/195 (43.59%), Query Frame = 2
Query:  464 LFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHD-----QKSLPGMA-----RPLQVKPAKEERKTEER------KLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQL 1000
            L+V  I     +   + +F ++G I   S+ +D   G  KG  F+ Y   + +     AL+D     +K   G A     R   +K   E  + E+        LFV  L+ +  +E +   F  +G I    V+R +NG SKG  FV FS+  EA  AI+     Q + G    + V  A  +  R+++  QQ+
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITE-KNQQIVAG--KPLYVAIAQRKDVRRSQLAQQI 411          

HSP 4 Score: 51.2174 bits (121), Expect = 4.950e-7
Identity = 45/163 (27.61%), Postives = 76/163 (46.63%), Query Frame = 2
Query:  464 LFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGM---ARPLQVKP--AKEERKT--EERK-----LFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQ 916
            +F+  +   +    L   F  +G I    I  D+  G  KG  F+   H +   A + A+    +L GM    + + V P  +++ER +  EE K     L+V  +N   T+E  + LF  FG I   ++ +D +G  KG  FV +    +A+ A+ AL+ S+
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFV---HFEEEGAAKEAID---ALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSE 283          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 50.8322 bits (120), Expect = 4.752e-7
Identity = 21/69 (30.43%), Postives = 38/69 (55.07%), Query Frame = 2
Query: 1658 EDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQL 1864
            E   +F+  L     D  L + F   G +  A+V  +R T++S+ +G+V + N ++A+ AIQ M G ++
Sbjct:  166 EPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEI 234          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Match: NGR1 (RNA binding protein that negatively regulates growth rate; interacts with the 3' UTR of the mitochondrial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; interacts with Dhh1p to mediate POR1 mRNA decay; expressed in stationary phase [Source:SGD;Acc:S000000416])

HSP 1 Score: 48.9062 bits (115), Expect = 2.336e-6
Identity = 31/116 (26.72%), Postives = 53/116 (45.69%), Query Frame = 2
Query: 1571 APIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIK 1918
            AP     + G+S       L  +   + P +  +F+  L P+  +  L  +F PFG I + ++      N   C GFV +     A+A+IQ + GF +G   +++   RP S + K
Sbjct:  329 APPMHLNEGGISNMRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI-----PNGKNC-GFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAK 438          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 47.7506 bits (112), Expect = 2.824e-6
Identity = 26/84 (30.95%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  443 KDSDAIK-LFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVK 691
            KD+D  + +F+G++P  L E +L+  F ++G+I +  I++DK+T   KG AF+ +    SS+   + +       G+ R +Q+K
Sbjct:  101 KDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI-------GVHRGIQIK 177          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Match: EDO30576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0E1])

HSP 1 Score: 256.914 bits (655), Expect = 9.377e-78
Identity = 114/196 (58.16%), Postives = 156/196 (79.59%), Query Frame = 2
Query:  413 SNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQL 1000
            +NG +TSV  +DS+++KLFVGQ+PR+ +E DLRP+FE YGQIYE +IL+DK TG HKGCAFLT+C R +  A Q+ LH++K+LPGM  P+QVKPA  E K+++RKLFVGM++K+  EED+R +F  FG IEE TVLR+ +  SKGCAF+KF+++++A  AI+ +H S TM+G SS +VVKFADTEKE+  +K+Q L
Sbjct:    7 TNGGTTSV--RDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGCAFLTFCSRDACNAAQKHLHEKKTLPGMHHPIQVKPADSETKSDDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTMEGCSSPLVVKFADTEKEKLQKKMQHL 200          

HSP 2 Score: 141.354 bits (355), Expect = 5.647e-36
Identity = 73/135 (54.07%), Postives = 87/135 (64.44%), Query Frame = 2
Query: 1520 TSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            T   +Y  I  +  AFP     + Q+    T  Q   E+     GP+  NLFIYHLP EF D DL+Q F PFG + SAKV++D+ TN SKCFGFVSY NV  AQ AIQ MNGFQ+G KRLKVQLKRPK D+ +PY
Sbjct:  325 TISQAYSGIQPYSAAFPT---VYNQALYQQTARQPQKEESHYTPGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK-DANRPY 455          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Match: EDO35559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL64])

HSP 1 Score: 172.555 bits (436), Expect = 1.888e-47
Identity = 83/171 (48.54%), Postives = 118/171 (69.01%), Query Frame = 2
Query:  413 SNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQ 925
            +NG +TSV  +DS+++KLFVGQ+PR+ +E DLRP+FE YGQIYE +IL+DK TG HKG          +  A Q+ LH++K+LPGM               ++RKLFVGM++K+  EED+R +F  FG IEE TVLR+ +  SKGCAF+KF+++++A  AI+ +H S TM+
Sbjct:    7 TNGGTTSV--RDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHKGW--------DACNAAQKHLHEKKTLPGM---------------DDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTME 152          

HSP 2 Score: 140.198 bits (352), Expect = 3.485e-36
Identity = 75/140 (53.57%), Postives = 89/140 (63.57%), Query Frame = 2
Query: 1511 SSATSDSSYHSIPAFGIAFPAPIGQ--FGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            S  T   +Y  I  +  AFP    Q  + Q+      PQK+        GP+  NLFIYHLP EF D DL+Q F PFG + SAKV++D+ TN SKCFGFVSY NV  AQ AIQ MNGFQ+G KRLKVQLKRPK D+ +PY
Sbjct:  256 SMDTISQAYSGIQPYSAAFPTVYNQALYQQTARQ---PQKE--------GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK-DANRPY 383          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 137.887 bits (346), Expect = 8.588e-38
Identity = 75/140 (53.57%), Postives = 89/140 (63.57%), Query Frame = 2
Query: 1511 SSATSDSSYHSIPAFGIAFPAPIGQ--FGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            S  T   +Y  I  +  AFP    Q  + Q+      PQK+        GP+  NLFIYHLP EF D DL+Q F PFG + SAKV++D+ TN SKCFGFVSY NV  AQ AIQ MNGFQ+G KRLKVQLKRPK D+ +PY
Sbjct:   32 SMDTISQAYSGIQPYSAAFPTVYNQALYQQTARQ---PQKE--------GPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPK-DANRPY 159          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Match: EDO35562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL69])

HSP 1 Score: 84.7297 bits (208), Expect = 2.855e-20
Identity = 37/68 (54.41%), Postives = 53/68 (77.94%), Query Frame = 2
Query:  719 ERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTM 922
            +RKLFVGM++K+  EED+R +F  FG IEE TVLR+ +  SKGCAF+KF+++++A  AI+ +H S TM
Sbjct:    1 DRKLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRNADSTSKGCAFIKFANRMQAQNAIATMHNSTTM 68          

HSP 2 Score: 54.299 bits (129), Expect = 1.611e-9
Identity = 24/67 (35.82%), Postives = 39/67 (58.21%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSL 661
            KLFVG I +  +E DLR MF  +G I E ++LR+      KGCAF+ + +R  ++     +H+  ++
Sbjct:    3 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRN-ADSTSKGCAFIKFANRMQAQNAIATMHNSTTM 68          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 89.3521 bits (220), Expect = 2.863e-19
Identity = 51/172 (29.65%), Postives = 88/172 (51.16%), Query Frame = 2
Query:  464 LFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQ 979
            L +  +P S+ + D++ +F   G +    ++RD+ TG   G AF+ Y +   +    R ++  +      +    +P+  E K     L++  L K+  EE+V  LFK FG+I    VL+D +G  +G  FV+F  + EA  AI  L+ ++T+ G +  + VKFA+    RQ
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNAN--LYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLN-NKTLPGTNVKLTVKFANPPNSRQ 180          

HSP 2 Score: 72.4034 bits (176), Expect = 1.106e-13
Identity = 38/91 (41.76%), Postives = 51/91 (56.04%), Query Frame = 2
Query: 1646 GSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIK 1918
            G+  E  NL I ++PP     D+ ++F   G +TS K+  DRAT QS  + FV+Y N   A  A++ MNG +L  K LKV   RP S  IK
Sbjct:    4 GTSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIK 94          

HSP 3 Score: 51.9878 bits (123), Expect = 4.936e-7
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 2
Query: 1646 GSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSD 1909
            G  P+   +F+Y LP E     L ++FSP+GAIT+ ++ +D+       +GFV+ +N   A  AI  +NG     K L+V  K PK++
Sbjct:  249 GLTPQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKG------YGFVNMSNYEEACHAICCLNGTPQHGKILQVSFKTPKNN 330          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Match: celf4 (CUGBP Elav-like family member 4 [Source:NCBI gene;Acc:101170176])

HSP 1 Score: 431.409 bits (1108), Expect = 2.259e-143
Identity = 251/519 (48.36%), Postives = 326/519 (62.81%), Query Frame = 2
Query:  419 GKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYG-------QTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTA-ALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPV---TAIHSSAQISNLS---DSCVNVSLYQNACLGGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            G   ++  KD DAIKLF+GQIPR+L E DLRP+FEE+G+IYE ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK Q+E+DVRRLF+SFG IEECT+LR  +GNSKGCAFVK+SS  EA AAISALHGSQTM GASSS+VVKFADT+KER  R++QQ+   + + N  +AL Q G   YG       Q  L   +      +P+AA +    Q   + ++ G+ G  + PT+G +    ++A T  ++ SP+  S   F   TG      N   P+ A+ TN              H+ PV         ++ + L     SC  V   Q  C         S   +D    +Y  +  +  A+PA  GQ  Q+           +++    GPE CNLFIYHLP EFGD +L+QMF PFG + S+KV+VDRATNQSKCFGFVS+ N   AQAAIQ+MNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   38 GCPATIPMKDHDAIKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKAQNALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFESFGSIEECTILRGPDGNSKGCAFVKYSSHAEAQAAISALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMAGQMGIFN-PMAL-QFGA--YGAYAQVQQQAALMASVGQGGYLSPMAAFA--AAQMQHMATINGLPGAPLTPTSGGSTPPGISAPTVTSIPSPI--SVNGF---TGMPPPQANGQPPAEAVFTN------------GIHHYPVLQEVVFREDSEKNGLGVAPRSCFGV---QGGCFLSSLSEAQSPTAADPLQQAYTGVQQYA-AYPAAYGQISQAFPHPPPIIPQQQRE----GPEGCNLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQSMNGFQIGMKRLKVQLKRPK-DANRPY 524          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Match: celf5b (CUGBP Elav-like family member 5 [Source:NCBI gene;Acc:101171069])

HSP 1 Score: 418.313 bits (1074), Expect = 2.440e-138
Identity = 238/503 (47.32%), Postives = 312/503 (62.03%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNV-SLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPA----PIGQFGQSGLSLTVPQKD----LEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KD DAIKLF+GQIPR+L+E DL+P+FE++G+I+E ++L+D+ TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGMLNK QTEEDV RLF+ +G IEECTVLR  +GNSKGCAFVKFS+  EA +AI ALHGSQTM GASSS+VVKFADT+KER  R++QQ++             Q G                 IFNP  AL F     S   S A     +I   +   Y+ P  A  A  +       Q   +N   N L   P  P  A +++P  + ++ A+ S    +    ++    I +  +    V ++Y N        + N++ T   ++  +  +   +PA    PI Q        T+PQ       ++     GPE CNLFIYHLP EFGD++L+QMF PFG + S+KV++DRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   72 KDQDAIKLFIGQIPRNLEEKDLKPLFEQFGKIHELTVLKDRYTGMHKGCAFLTYCARESAIKAQNALHEQKTLPGMTRPIQVKPADSESRGEDRKLFVGMLNKQQTEEDVYRLFEPYGVIEECTVLRGPDGNSKGCAFVKFSAHTEAQSAIGALHGSQTMPGASSSLVVKFADTDKERTIRRMQQMV------------GQFG-----------------IFNPAIALPF-----STYSSYAHAQQAAIMAASHGGYLTPSVAFPATQIH------QMGPLNI--NSLPPTPMTPVSAGLSSPPANITTSAVPS----IVTPIVNGFTGIPHQPNGHPAVETVYTNGLPPYSTQSPNAADTLQQAFTGVQQYTAIYPATTLTPISQ--------TLPQAPQVIQQQQQQQREGPEGCNLFIYHLPQEFGDNELMQMFLPFGTVISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DASRPY 519          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Match: celf3b (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101160192])

HSP 1 Score: 412.535 bits (1059), Expect = 1.862e-136
Identity = 244/512 (47.66%), Postives = 312/512 (60.94%), Query Frame = 2
Query:  434 VLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACL---GGQFVNTNSSATSD---SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKD---------LEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            VL K++DAIKLFVGQIPR+L+E DL+P+FE++G+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPGM RP+QVKPA  E + E+RKLFVGML K QT+EDVRRLF+ FG I+ECTVLR  +G SKGCAFVKF    EA AAI++LHGS+TM GASSS+VVKFADTEKER  R++QQ+ + L +  S + L     N Y Q                 A++ QL Q   L + +             AY+ PVA   A  +       Q   +N  AN +   P  P    IT    +N+  A+A+     PV A+     ++  S      +  Q   L   G       S A  D    +Y  +  +  A+PA  G  GQ       PQ+           ++     GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N A AQAAIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:   32 VLMKEADAIKLFVGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQSALHEQKTLPGMNRPIQVKPADSEGRGEDRKLFVGMLGKQQTDEDVRRLFEPFGTIDECTVLRGPDGTSKGCAFVKFQGHAEAQAAINSLHGSRTMPGASSSLVVKFADTEKERGLRRMQQVASQLGIF-SPMTLNFPAYNAYTQ-----------------AVNAQLVQHQALVAQS-------------AYLSPVATVAAVQMQ------QMAALN--ANGIIATPITP----ITPSSGTNTPPAIAA----TPVPALPPPIGMNGYSSVPAPTNGQQTETLYTNGVHQYQAQSPAALDPLQQAYAGMQHYTAAYPAAYGLVGQP-----FPQQQTLVAQQHQQPQQQQQREGPEGCNIFIYHLPQEFSDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 490          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Match: celf3a (CUGBP Elav-like family member 3 [Source:NCBI gene;Acc:101163095])

HSP 1 Score: 389.037 bits (998), Expect = 6.139e-128
Identity = 231/501 (46.11%), Postives = 307/501 (61.28%), Query Frame = 2
Query:  443 KDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAK--EERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQ--LSPPRIFNPVAAL-SFQLQQTSGL-P-SLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            K+ DAIKLF+GQIPR+L+E DL+P+FE++G+IYE ++++DK TG+HKGCAFLTYC R+S+   Q ALH+QK+LPG++    V P+   E R  E+RKLFVGML K QT+ DVR++F+ FG IEECTVLR  +G SKGCAFVKF S  EA AAI+ALHGS+T+ GASSS+VVKFAD+EKER  R++QQ+ + L ++ S + L     N Y Q ++  Q  ++     +PVA + + Q+QQ + L P S+      SI P++G +    +AA     L P +            N     P  PS    T   ++N   A     HN                   + V L Q+             AT  ++Y  +   G  FP       Q  L    PQ+  +++    GPE CN+FIYHLP EF D ++LQMF PFG + SAKV+VDRATNQSKCFGFVS+ N + AQ AIQAMNGFQ+G+KRLKVQLKRPK D+ +PY
Sbjct:    2 KEPDAIKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKAQNALHEQKTLPGVS----VSPSSCGEGRGDEDRKLFVGMLGKQQTDADVRKMFEPFGSIEECTVLRGPDGTSKGCAFVKFQSNAEAQAAINALHGSRTLPGASSSLVVKFADSEKERGLRRMQQVASQLGVI-SPMTLHLGAYNAYTQALMQQQALVAQSAYLSPVATVAAVQMQQLAALNPNSIIATPIASITPSSGTSTPPSIAATPVPALPPPI----------AVNSYPSVPAPPSGQSATEALYTNGVHAYQGAKHNF-----------------LLVVKLLQSML-----------ATYPAAYSLV---GQPFPH------QPTLVAQQPQQLQQRE----GPEGCNIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPSSAQTAIQAMNGFQIGMKRLKVQLKRPK-DANRPY 445          
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Match: ENSORLT00000004865.2 (CUGBP Elav-like family member 2 [Source:NCBI gene;Acc:101175076])

HSP 1 Score: 324.324 bits (830), Expect = 4.626e-102
Identity = 217/519 (41.81%), Postives = 297/519 (57.23%), Query Frame = 2
Query:  401 NGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTG--IHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKT--EERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGIT--GLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLY--QNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS---GPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            N  + NG    +   D DAIK+FVGQIPRS  E++L+ +FE +G +Y+ +ILRD+       KGC F+T+  R+++   Q ALH+ K+L GM  P+Q+KPA  E+ T  E+RKLF+GM++K   E +VR +F SFG+IEEC +LR  +G S+GCAFV F+++  A  AI  +H SQTM+G SS +VVKFADT+++++ R+LQQ +       ++   A   GN+ G   L  Q           AL  Q   TS   S   I   G  +NP   Q      AA  AA  S    S  A   N+GA     +P G      +  G S +   +AS      +T   +S  ++NL+    +VS     N  LG    N +++++ D+   +           + Q+  S L     Q  +++ + GS   GPE  NLFIYHLP EFGD DLLQMF PFG + SAKV++D+ TN SKCFGFVSY N   AQAAIQAMNGFQ+G+KRLKVQLKR K+DS KPY
Sbjct:   27 NSNKMNGSLEHMDQPDPDAIKMFVGQIPRSWTETELKELFEPFGAVYQINILRDRAQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLSGMHHPIQMKPADSEKTTAVEDRKLFIGMVSKKYGENEVRMMFSSFGQIEECRILRGPDGQSRGCAFVTFATRAMAQNAIKTMHHSQTMEGCSSPLVVKFADTQRDKEQRRLQQQLVQQIQQLNN---ASTWGNLAGLGTLTPQ---------YLALLQQATSTSNQGSFNSIQRLGAGVNPLQLQNLATLAAAAAAAQSSASPASTSALSTNSGALGALASPAG------STAGTSAAMNTLASLGTLQGLTG--NSVGLNNLNALTSSVSGMGAMNGGLGASMANGSAASSMDALTQAYSG--------MQQYTASALPSLYSQTLIQQSIAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDS-KPY 516          
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 1096.26 bits (2834), Expect = 0.000e+0
Identity = 532/532 (100.00%), Postives = 532/532 (100.00%), Query Frame = 2
Query:  329 MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY
Sbjct:    1 MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 532          
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = 2
Query:  329 MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS 1651
            MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS
Sbjct:    1 MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS 441          

HSP 2 Score: 70.8626 bits (172), Expect = 1.791e-12
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 1
Query: 1654 TGRLQPVHISPTSGVWRPRSAADVQSLWSHH 1746
            TGRLQPVHISPTSGVWRPRSAADVQSLWSHH
Sbjct:  450 TGRLQPVHISPTSGVWRPRSAADVQSLWSHH 480          
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Match: SMESG000026947.1 (SMESG000026947.1)

HSP 1 Score: 894.034 bits (2309), Expect = 0.000e+0
Identity = 437/437 (100.00%), Postives = 437/437 (100.00%), Query Frame = 2
Query:  341 MSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS 1651
            MSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS
Sbjct:    1 MSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGS 437          

HSP 2 Score: 70.4774 bits (171), Expect = 1.915e-12
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 1
Query: 1654 TGRLQPVHISPTSGVWRPRSAADVQSLWSHH 1746
            TGRLQPVHISPTSGVWRPRSAADVQSLWSHH
Sbjct:  446 TGRLQPVHISPTSGVWRPRSAADVQSLWSHH 476          
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Match: SMESG000046617.1 (SMESG000046617.1)

HSP 1 Score: 368.237 bits (944), Expect = 5.722e-120
Identity = 227/508 (44.69%), Postives = 294/508 (57.87%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAK----------------EERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNL--SDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPI-GQFGQSGL-SLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY 1924
            KLFVGQIPR+  + ++R +FE +G I+EF ILRDK TG HKGCAF+T+ H+ S+E CQ+ALHD+K L GM RPLQVKPAK                E+  ++ERKLFVGML+KNQT+E+V+ +F  FG+IEECTVL+DQNGNSKGCAFVKF +  +A AAI+ALH SQ M+GASSS+VVKFADT+K++Q RKLQQ I  L+++NS + +     + YG            I NP        +  S +PS   I        N   YI                +AQ   IN  +N  +  P             SNS ++M S +   PV  I  S  I+N   +D      +     +  + V  + +  +  S  S P   +  P      F    L S T    D++     +GPE CNLFIYHLP E GD  L Q+F  FG + S+KVYVDRATNQSKCFGFVSY + A A AAI++MNG+ +G KRLKVQLK+PK  S +PY
Sbjct:    6 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPIHIPYYSQYG-----------TIINP--------EYNSTIPSNQYI-------RNCNEYI---------------LAAQIQQINLFSNLSSVYP-------------SNSIVSMPSSH---PVPMIDYSVPINNFPQTDQITMKPIVDMQPIPPEAV--HRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPKGFS-RPY 453          

HSP 2 Score: 61.2326 bits (147), Expect = 1.598e-9
Identity = 35/113 (30.97%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  392 KISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            K++     NG++ +     SD  KLFVG + ++  + +++ MF ++G+I E ++L+D+  G  KGCAF+ + +   + A   ALH  + + G +  L VK A  +++ + RKL
Sbjct:   87 KLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 198          
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Match: SMESG000046617.1 (SMESG000046617.1)

HSP 1 Score: 367.466 bits (942), Expect = 2.053e-119
Identity = 224/501 (44.71%), Postives = 290/501 (57.88%), Query Frame = 2
Query:  461 KLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAK----------------EERKTEERKLFVGMLNKNQTEEDVRRLFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQGASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTILDNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVAANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAMASQNHNLPVTAIHSSAQISNL--SDSCVNVSLYQNACLGGQFVNTNSSATSDSSYHSIPAFGIAFPAPI-GQFGQSGL-SLTVPQKDLEKDMGGSGPEDCNLFIYHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFAQAAIQAMNGFQLGLKRLKVQLKRPK 1903
            KLFVGQIPR+  + ++R +FE +G I+EF ILRDK TG HKGCAF+T+ H+ S+E CQ+ALHD+K L GM RPLQVKPAK                E+  ++ERKLFVGML+KNQT+E+V+ +F  FG+IEECTVL+DQNGNSKGCAFVKF +  +A AAI+ALH SQ M+GASSS+VVKFADT+K++Q RKLQQ I  L+++NS + +     + YG            I NP        +  S +PS   I        N   YI                +AQ   IN  +N  +  P             SNS ++M S +   PV  I  S  I+N   +D      +     +  + V  + +  +  S  S P   +  P      F    L S T    D++     +GPE CNLFIYHLP E GD  L Q+F  FG + S+KVYVDRATNQSKCFGFVSY + A A AAI++MNG+ +G KRLKVQLK+PK
Sbjct:    6 KLFVGQIPRNTPDKEIRLIFEAFGPIFEFLILRDKKTGFHKGCAFVTFYHKDSAENCQKALHDKKILNGMNRPLQVKPAKNKLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQNGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKLQQYIPDLSILNSRIPIHIPYYSQYG-----------TIINP--------EYNSTIPSNQYI-------RNCNEYI---------------LAAQIQQINLFSNLSSVYP-------------SNSIVSMPSSH---PVPMIDYSVPINNFPQTDQITMKPIVDMQPIPPEAV--HRTIVTPGSLLSYPFLNVQIPTVYPNAFSNGNLTSTTQSSTDVKTTPLPTGPEGCNLFIYHLPQEIGDLQLYQIFMHFGNVISSKVYVDRATNQSKCFGFVSYDDPACANAAIKSMNGYHIGTKRLKVQLKKPK 447          

HSP 2 Score: 61.6178 bits (148), Expect = 1.268e-9
Identity = 35/113 (30.97%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  392 KISNGPESNGKSTSVLSKDSDAIKLFVGQIPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEACQRALHDQKSLPGMARPLQVKPAKEERKTEERKL 730
            K++     NG++ +     SD  KLFVG + ++  + +++ MF ++G+I E ++L+D+  G  KGCAF+ + +   + A   ALH  + + G +  L VK A  +++ + RKL
Sbjct:   87 KLAKNSSLNGENQTEEQVFSDERKLFVGMLSKNQTDENVQNMFTKFGKIEECTVLKDQ-NGNSKGCAFVKFVNHTDACAAINALHASQKMEGASSSLVVKFADTDKQKQIRKL 198          
The following BLAST results are available for this feature:
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELF31.210e-13245.63CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF37.727e-12344.62CUGBP Elav-like family member 3 [Source:HGNC Symbo... [more]
CELF14.836e-10441.95CUGBP Elav-like family member 1 [Source:HGNC Symbo... [more]
CELF15.907e-10440.95CUGBP Elav-like family member 1 [Source:HGNC Symbo... [more]
CELF15.907e-10440.95CUGBP Elav-like family member 1 [Source:HGNC Symbo... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-752.400e-8458.41Putative RNA-binding protein [Source:UniProtKB/Tr... [more]
etr-12.692e-5850.00ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-12.692e-5850.00ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-12.692e-5850.00ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-12.692e-5850.00ELAV-Type RNA binding-protein family [Source:UniP... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bru14.852e-10443.16gene:FBgn0000114 transcript:FBtr0331646[more]
bru14.852e-10443.16gene:FBgn0000114 transcript:FBtr0331998[more]
bru14.852e-10443.16gene:FBgn0000114 transcript:FBtr0331648[more]
bru14.852e-10443.16gene:FBgn0000114 transcript:FBtr0331647[more]
bru11.913e-10343.16gene:FBgn0000114 transcript:FBtr0080345[more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf41.634e-14348.74CUGBP, Elav-like family member 4 [Source:NCBI gene... [more]
celf5a8.494e-14147.92cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf5a6.778e-13746.25cugbp, Elav-like family member 5a [Source:ZFIN;Acc... [more]
celf3b4.832e-13547.22cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
celf3a7.707e-13145.92cugbp, Elav-like family member 3a [Source:NCBI gen... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tada2a9.914e-14147.42transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tada2a4.038e-14046.77transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
tada2a1.105e-12144.07transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
celf22.999e-10139.85CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
celf24.553e-10139.85CUGBP, Elav-like family member 2 [Source:NCBI gene... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Celf56.742e-13848.05CUGBP, Elav-like family member 5 [Source:MGI Symbo... [more]
Celf32.950e-13445.88CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf31.477e-13045.54CUGBP, Elav-like family member 3 [Source:MGI Symbo... [more]
Celf12.011e-10441.15CUGBP, Elav-like family member 1 [Source:MGI Symbo... [more]
Celf12.011e-10441.15CUGBP, Elav-like family member 1 [Source:MGI Symbo... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DGV1|CELF4_DANRE1.234e-14248.74CUGBP Elav-like family member 4 OS=Danio rerio OX=... [more]
sp|A0JM51|CELF5_XENTR5.252e-14047.42CUGBP Elav-like family member 5 OS=Xenopus tropica... [more]
sp|Q91579|CEL3A_XENLA7.857e-13548.11CUGBP Elav-like family member 3-A OS=Xenopus laevi... [more]
sp|Q7ZWM3|CEL3B_XENLA2.305e-13446.92CUGBP Elav-like family member 3-B OS=Xenopus laevi... [more]
sp|Q08E07|CELF3_BOVIN3.576e-13245.91CUGBP Elav-like family member 3 OS=Bos taurus OX=9... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TIA43.829e-14550.30Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1A8HH895.565e-14048.36CUGBP, Elav-like family member 4 OS=Nothobranchius... [more]
I3KTQ35.687e-14048.36CUGBP, Elav-like family member 4 OS=Oreochromis ni... [more]
A0A1A8V7345.810e-14048.36CUGBP, Elav-like family member 4 OS=Nothobranchius... [more]
A0A1A8M1X65.810e-14048.36CUGBP, Elav-like family member 4 OS=Nothobranchius... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf41.390e-13948.74CUGBP Elav-like family member 4 [Source:NCBI gene;... [more]
ENSAMXT00000012369.21.006e-13744.57CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf44.546e-11946.56CUGBP Elav-like family member 4 [Source:NCBI gene;... [more]
celf41.415e-9167.68CUGBP Elav-like family member 4 [Source:NCBI gene;... [more]
celf3b1.501e-9043.43cugbp, Elav-like family member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002852.17.207e-5345.74pep scaffold:Pmarinus_7.0:GL477021:232626:260651:-... [more]
ENSPMAT00000007375.11.590e-5247.12pep scaffold:Pmarinus_7.0:GL478911:2009:38506:1 ge... [more]
ENSPMAT00000008846.11.147e-3973.63pep scaffold:Pmarinus_7.0:GL480623:147895:156346:1... [more]
rbm454.093e-1834.19RNA binding motif protein 45 [Source:ZFIN;Acc:ZDB-... [more]
RBMS21.240e-1226.32RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP11.016e-1128.76Subunit of cleavage factor I; cleavage factor I is... [more]
PAB18.382e-1026.97Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR14.752e-730.43Nucleolar protein that binds nuclear localization ... [more]
NGR12.336e-626.72RNA binding protein that negatively regulates grow... [more]
SNP12.824e-630.95Component of U1 snRNP required for mRNA splicing v... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO305769.377e-7858.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355591.888e-4748.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295198.588e-3853.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355622.855e-2054.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348792.863e-1929.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf42.259e-14348.36CUGBP Elav-like family member 4 [Source:NCBI gene;... [more]
celf5b2.440e-13847.32CUGBP Elav-like family member 5 [Source:NCBI gene;... [more]
celf3b1.862e-13647.66CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
celf3a6.139e-12846.11CUGBP Elav-like family member 3 [Source:NCBI gene;... [more]
ENSORLT00000004865.24.626e-10241.81CUGBP Elav-like family member 2 [Source:NCBI gene;... [more]
back to top
BLAST of CUGBP, Elav-like family member 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026947.10.000e+0100.00SMESG000026947.1[more]
SMESG000026947.11.791e-12100.00SMESG000026947.1[more]
SMESG000026947.11.915e-12100.00SMESG000026947.1[more]
SMESG000046617.15.722e-12044.69SMESG000046617.1[more]
SMESG000046617.12.053e-11944.71SMESG000046617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018441 ID=SMED30018441|Name=CUGBP, Elav-like family member 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2249bp
TGTCGCCTCTACTCATAGCAGATGGCCTATCATTCAGATATCTTGATGCT
AAATTCAGTTCTGGTATATGCAGGCTAAGAAGTTCTAAGAGAGTCTGTCA
TTTTAATAAAAAAAAAGATTCCAGAATTTTATTGTAACATCTTAAAACTT
AGCTGCTGCTGCTGTTGCCGTTTCTGCTGCCGTTTTTGCTATTTCGTTAT
TGTTGTTGTTGTTATTGTTGTTGTTGTTGTCTTTACTGATTTTTTATTTG
GTGAAAAAAAAAACTTCTCAATTGCATCTATTGCATATATGAATCGTGAT
CTTTCTCTAATCGTCGGTGATTCTCGCTATGGAATATAGGATGTCTTTGG
CTAACAATCTCTCAAACCAAATCAACAGTAAAACAATGGGAAAAATTTCT
AACGGACCCGAATCCAATGGAAAATCAACTTCGGTTCTGTCGAAAGATTC
TGACGCTATTAAATTGTTTGTCGGTCAAATTCCTCGATCTCTTCAAGAAT
CAGACCTGAGACCGATGTTTGAAGAGTATGGACAGATCTATGAGTTTTCT
ATTCTTCGAGACAAAGTCACTGGAATACATAAAGGTTGCGCTTTTCTAAC
GTACTGCCATCGACAATCCAGTGAAGCATGCCAGCGAGCTCTACATGACC
AAAAGTCACTTCCAGGAATGGCCAGACCATTGCAAGTGAAACCCGCCAAA
GAGGAACGAAAAACAGAAGAAAGAAAATTATTTGTGGGCATGCTCAACAA
AAATCAAACAGAAGAAGACGTCAGACGACTCTTCAAATCATTTGGTGAAA
TAGAAGAATGCACTGTTCTTCGGGACCAAAACGGAAATAGCAAAGGATGC
GCCTTTGTGAAATTTTCTTCTCAAGTGGAAGCCTTGGCGGCGATATCAGC
ACTTCATGGCAGTCAAACAATGCAGGGGGCCTCTTCTAGCATCGTAGTGA
AATTTGCAGACACAGAAAAAGAAAGACAGACTAGAAAACTCCAGCAGCTC
ATTAATCCTCTTAATCTAATGAATTCTTCCCTTGCATTAGCTCAACTTGG
TGGAAATATCTACGGCCAAACGATACTTGATAATCAACTTTCGCCACCTC
GTATTTTCAATCCGGTTGCAGCTCTTTCGTTCCAACTTCAGCAGACCAGT
GGTTTACCGTCACTGGCAGGAATAACTGGACTTTCAATAAACCCTACCAA
TGGTCAAGCATATATAGACCCTGTAGCTGCCAATACTGCTGCTCTTCTTT
CTCCTCTTCTTGGATCAGCTCAGGCCTTTCACATTAATACAGGAGCAAAC
TACCTCACCCAAAACCCAAATGGTCCATCATTTGCTATGATTACTAATCC
CGGGTTCTCAAATTCCAGTATCGCGATGGCAAGTCAAAACCATAATTTAC
CGGTTACTGCTATTCATTCCTCGGCCCAGATATCGAATCTTTCCGATTCG
TGTGTTAATGTGTCTCTATATCAGAATGCTTGCCTCGGGGGCCAATTTGT
AAATACTAATTCGTCTGCCACATCTGATTCCTCCTACCACTCCATTCCTG
CATTTGGTATTGCTTTTCCTGCTCCAATCGGCCAGTTTGGTCAATCAGGT
CTTTCTCTAACTGTTCCACAAAAGGATCTGGAGAAGGATATGGGAGGATC
GGGACCGGAAGACTGCAACCTGTTCATATATCACCTACCTCCGGAGTTTG
GAGACCACGATCTGCTGCAGATGTTCAGTCCCTTTGGAGCCATCACTAGC
GCCAAAGTGTATGTAGATAGAGCTACAAACCAAAGCAAATGTTTCGGTTT
CGTTAGTTATACAAATGTAGCTTTTGCACAAGCTGCAATTCAGGCTATGA
ATGGCTTTCAACTTGGCCTAAAGCGATTGAAAGTCCAACTGAAGCGACCA
AAATCAGATTCAATTAAACCTTATTAAGATATTTCAAATCCTCAGATCGG
TTTTATACAGTAAAGAACTACATTTTATCAAATTATGAATATTATTATTA
TTATTATAATTATAATTATAAATAATTTCAAATGCTGAAAGTGAAATTGA
TATTGTTGTAAAAGTGCAAAATATTCGAGTGCAAATATTGATTTGTGGTA
GGCACCATTTTAGATAATTTTCAAAATATAATGATCTAAAATCAAATTAA
TTATTTCAATAATTTCTTTAAAAGGACAAATGTTAAAATTGTTGATTTTA
GGCAGATTTCGTTGTTTAAAATATTTTCGTGTCTGTTAATGTGTCCACG
back to top

protein sequence of SMED30018441-orf-1

>SMED30018441-orf-1 ID=SMED30018441-orf-1|Name=SMED30018441-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=533bp
MEYRMSLANNLSNQINSKTMGKISNGPESNGKSTSVLSKDSDAIKLFVGQ
IPRSLQESDLRPMFEEYGQIYEFSILRDKVTGIHKGCAFLTYCHRQSSEA
CQRALHDQKSLPGMARPLQVKPAKEERKTEERKLFVGMLNKNQTEEDVRR
LFKSFGEIEECTVLRDQNGNSKGCAFVKFSSQVEALAAISALHGSQTMQG
ASSSIVVKFADTEKERQTRKLQQLINPLNLMNSSLALAQLGGNIYGQTIL
DNQLSPPRIFNPVAALSFQLQQTSGLPSLAGITGLSINPTNGQAYIDPVA
ANTAALLSPLLGSAQAFHINTGANYLTQNPNGPSFAMITNPGFSNSSIAM
ASQNHNLPVTAIHSSAQISNLSDSCVNVSLYQNACLGGQFVNTNSSATSD
SSYHSIPAFGIAFPAPIGQFGQSGLSLTVPQKDLEKDMGGSGPEDCNLFI
YHLPPEFGDHDLLQMFSPFGAITSAKVYVDRATNQSKCFGFVSYTNVAFA
QAAIQAMNGFQLGLKRLKVQLKRPKSDSIKPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR034648CELF3/4/5/6_RRM1
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0048026positive regulation of mRNA splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 45..121
e-value: 2.7E-16
score: 70.1
coord: 447..520
e-value: 1.6E-22
score: 90.8
coord: 133..208
e-value: 2.3E-20
score: 83.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 448..518
e-value: 6.2E-19
score: 67.6
coord: 46..109
e-value: 3.8E-12
score: 45.8
coord: 134..198
e-value: 5.4E-19
score: 67.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 44..125
score: 14.556
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 132..212
score: 17.95
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 446..524
score: 16.023
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 427..530
e-value: 1.2E-26
score: 94.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 128..220
e-value: 4.2E-30
score: 105.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 31..127
e-value: 7.1E-23
score: 82.7
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 313..527
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 40..278
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 313..527
NoneNo IPR availablePANTHERPTHR24012:SF716CUGBP ELAV-LIKE FAMILY MEMBER 6coord: 40..278
NoneNo IPR availableCDDcd12635RRM2_CELF3_4_5_6coord: 131..211
e-value: 1.52994E-51
score: 168.382
IPR034648CELF-3/4/5/6, RNA recognition motif 1CDDcd12632RRM1_CELF3_4_5_6coord: 39..123
e-value: 5.20291E-55
score: 177.593
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 130..526
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 21..129