Alpha-int-2

Overview
NameAlpha-int-2
Smed IDSMED30018435
Length (bp)3343
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-int-2 (SMED30018435) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-int-2 (SMED30018435) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-int-2 (SMED30018435) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-int-2 (SMED30018435) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018435

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018435SMESG000021746.1 dd_Smed_v4_3365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30018435SMESG000021746.1 dd_Smed_v4_3365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018435SMESG000021746.1 dd_Smed_v4_3365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018435SMESG000021746.1 dd_Smed_v6_3365_0_1dd_Smed_v6PMID:28126842
Bonar et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30018435SMESG000021746.1 dd_Smed_v6_3365_0_1dd_Smed_v6PMID:28126842
Bonar et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30018435SMESG000021746.1 KU961519smed_ncbi_20200123PMID:28137894
Seebeck et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-int-2 vs. Ensembl Human
Match: ITGA5 (integrin subunit alpha 5 [Source:HGNC Symbol;Acc:HGNC:6141])

HSP 1 Score: 72.7886 bits (177), Expect = 3.548e-12
Identity = 102/406 (25.12%), Postives = 158/406 (38.92%), Query Frame = 3
Query:  435 QSGIIILC--SSNINNASPLGFDLKCKNLEEQR---------LDSSSGKYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDK-------FKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPE-------------NKGTYFN---YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKFRP----TDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL----VNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            Q G + LC   ++    +P+ FD K   L E           ++  S ++FG+ VR+        + + C PL  W      L+   G C L+        + +EY  C            C GGFS +       V    G  F     LS   E       PE                + ++    GYSVA   FSGD ++   A  P  N  + YVT +NG   R     +  +   Y G+  +   VN G  L  +++GAP    +        VG V++        +  PT  + G + +  FG ++  LGD+D +G  +  +GAP     + G +++F       +  KP QV Q  +        FG A+  G D++ NG PD  V S G  K  ++
Sbjct:   92 QGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATVRA-----HGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDN---FTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVN-GDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGG-LGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVY 487          
BLAST of Alpha-int-2 vs. Ensembl Human
Match: ITGA2B (integrin subunit alpha 2b [Source:HGNC Symbol;Acc:HGNC:6138])

HSP 1 Score: 70.0922 bits (170), Expect = 2.121e-11
Identity = 61/216 (28.24%), Postives = 105/216 (48.61%), Query Frame = 3
Query:  882 YFN--YGYSVA---FSGD--GSQYA-SSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGG-FGTSMDTVNLGGN-LYAVVIGAPY----QSKQNLVNVGAVFLACK-------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            YF+  +GYSVA   F GD   ++Y   +P  +     V  ++    R   L+ ++    FG S+   ++ G+  + +++GAP     ++ + L  VG V+L  +       G P+ ++ G   Y  FG AIA LGD+D +G  +  V AP       G++ +F   +S  +  +P QV  S F   + FG ++    D++ NG PD  V + G+ +
Sbjct:  261 YFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVF-LGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQ 475          
BLAST of Alpha-int-2 vs. Ensembl Human
Match: ITGA2B (integrin subunit alpha 2b [Source:HGNC Symbol;Acc:HGNC:6138])

HSP 1 Score: 69.707 bits (169), Expect = 2.848e-11
Identity = 61/216 (28.24%), Postives = 105/216 (48.61%), Query Frame = 3
Query:  882 YFN--YGYSVA---FSGD--GSQYA-SSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGG-FGTSMDTVNLGGN-LYAVVIGAPY----QSKQNLVNVGAVFLACK-------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            YF+  +GYSVA   F GD   ++Y   +P  +     V  ++    R   L+ ++    FG S+   ++ G+  + +++GAP     ++ + L  VG V+L  +       G P+ ++ G   Y  FG AIA LGD+D +G  +  V AP       G++ +F   +S  +  +P QV  S F   + FG ++    D++ NG PD  V + G+ +
Sbjct:   72 YFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVF-LGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQ 286          
BLAST of Alpha-int-2 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 67.781 bits (164), Expect = 1.042e-10
Identity = 107/400 (26.75%), Postives = 157/400 (39.25%), Query Frame = 3
Query:  435 QSGIIILCS-SNINNASPLGFDLKCKN--LEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-------DKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPENKGTYFN----------------YGYSVA---FSGDGSQYASSPVDNGDFPYVTRVNGEKF-----RPTDL----KTQRYGGFGTSMDTVNLGGNLYA-VVIGAPY----QSKQNLVNVGAVFLACKGKPTDV----IYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            + G ++ C  S+     P+ FD        ++  L+  S ++FG+ VRS   K D I  + C PL  W           G C L   +D    KT+EY  C       D    C GGFS+D    D  +    G  +     +S+ V     +  P      +N                 GYSVA   F+GDG     S V     P   R  G  +       + L      Q    FG S+   ++ G+ YA V IGAP      S   L  VG V ++ +    D     + G   +  FG AIA LGD+D +G  +  + AP    DK G +YIF    S  +   P Q+ + ++        FG ++    D++ NG PD  V + G  +  L+
Sbjct:   36 EGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRS---KQDKI--LACAPLYHWRTEMKQEREPVGTCFL---QDG--TKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGV-----PRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIF-NGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILY 419          
BLAST of Alpha-int-2 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 67.3958 bits (163), Expect = 1.462e-10
Identity = 107/400 (26.75%), Postives = 157/400 (39.25%), Query Frame = 3
Query:  435 QSGIIILCS-SNINNASPLGFDLKCKN--LEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-------DKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPENKGTYFN----------------YGYSVA---FSGDGSQYASSPVDNGDFPYVTRVNGEKF-----RPTDL----KTQRYGGFGTSMDTVNLGGNLYA-VVIGAPY----QSKQNLVNVGAVFLACKGKPTDV----IYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            + G ++ C  S+     P+ FD        ++  L+  S ++FG+ VRS   K D I  + C PL  W           G C L   +D    KT+EY  C       D    C GGFS+D    D  +    G  +     +S+ V     +  P      +N                 GYSVA   F+GDG     S V     P   R  G  +       + L      Q    FG S+   ++ G+ YA V IGAP      S   L  VG V ++ +    D     + G   +  FG AIA LGD+D +G  +  + AP    DK G +YIF    S  +   P Q+ + ++        FG ++    D++ NG PD  V + G  +  L+
Sbjct:   82 EGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRS---KQDKI--LACAPLYHWRTEMKQEREPVGTCFL---QDG--TKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGV-----PRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIF-NGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILY 465          
BLAST of Alpha-int-2 vs. Ensembl Celegans
Match: ina-1 (Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03600])

HSP 1 Score: 63.929 bits (154), Expect = 6.420e-10
Identity = 47/166 (28.31%), Postives = 82/166 (49.40%), Query Frame = 3
Query: 1029 GFGTSMDTVNLGGNLYA-VVIGAPYQSKQNL-VNVGAVFLA--CKG------------KPTDVIYGENAYDNFGYAIARLGDIDSNGSE--EFVVGAPSLNLDKPGKIYIFKTTESCQIF-KKPLQVYQSK---------FTGFGIAISRGFDVNFNGKPDFFVTS 1442
             FG S++ V+L G+ +  +++GAP++ +  +  N G +      +G             P  ++   + Y  FG +I +LG++D + S+  +F VGAP    D  G +YI+  T++ + F KKP QV +              FG ++S G D++ NG PD  + S
Sbjct:  320 AFGYSIEVVDLNGDGFDDLIVGAPFEHRSGIDGNFGGIVYVYFSQGVQRKQHESHLVFHPPKILKNPDFYSQFGLSITKLGNVDGDKSKLNDFAVGAP-FAFDGAGAVYIYLGTKNIEKFRKKPAQVIKGNDLPNLPPGGMRSFGFSLSGGSDMDENGYPDLLIGS 484          
BLAST of Alpha-int-2 vs. Ensembl Celegans
Match: pat-2 (Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot;Acc:P34446])

HSP 1 Score: 54.299 bits (129), Expect = 6.635e-7
Identity = 44/164 (26.83%), Postives = 74/164 (45.12%), Query Frame = 3
Query: 1074 YAVVIGAPYQSKQNLVNVGAVFLACKGKP-----TDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGF------DVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCT-WIEPSTGFI 1529
            Y  V  A  Q ++   +VG V +  +  P        + G++ +  FG+A+A  GD++ +G  + +VGAP    +K G +Y+   ++   + + P Q  +    G G   S GF      DV+ NG PD  V +  S    + +   +  VT T   EP +  I
Sbjct:  330 YGSVKDAKTQERKPQYDVGKVIVMLQTAPGVFGKQIAVVGDDQWGRFGHAVAAAGDLNLDGYNDVIVGAPYAGKNKQGAVYVIHGSKDG-VRELPTQKIEGANIGHGNIKSFGFSLTGNEDVDGNGMPDIAVGAWKSGNAAVLLT--KPVVTVTGQTEPESALI 490          
BLAST of Alpha-int-2 vs. Ensembl Fly
Match: if (gene:FBgn0001250 transcript:FBtr0301352)

HSP 1 Score: 59.3066 bits (142), Expect = 2.244e-8
Identity = 40/132 (30.30%), Postives = 66/132 (50.00%), Query Frame = 3
Query: 1122 NVGAVFLACKGKPTD--------VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF--------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            +VG V++  +G PT+        +  G ++   FG A+  LGD++ +G  +F VGAP    +  G +YIF  +    +  KP Q+ +S+           FG A+S G D++ N  PD  V +  S + F+F
Sbjct:  342 DVGRVYILLQGGPTEEKRWTTEHIRDGYHSKGRFGLALTTLGDVNGDGYGDFAVGAPYDGPEGRGVVYIFHGSPMGPL-AKPSQIIKSEQLVEGAPYPRTFGFALSGGLDMDGNTYPDLAVGAYSSDQVFIF 472          
BLAST of Alpha-int-2 vs. Ensembl Fly
Match: if (gene:FBgn0001250 transcript:FBtr0074357)

HSP 1 Score: 59.3066 bits (142), Expect = 2.536e-8
Identity = 40/132 (30.30%), Postives = 66/132 (50.00%), Query Frame = 3
Query: 1122 NVGAVFLACKGKPTD--------VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF--------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            +VG V++  +G PT+        +  G ++   FG A+  LGD++ +G  +F VGAP    +  G +YIF  +    +  KP Q+ +S+           FG A+S G D++ N  PD  V +  S + F+F
Sbjct:  367 DVGRVYILLQGGPTEEKRWTTEHIRDGYHSKGRFGLALTTLGDVNGDGYGDFAVGAPYDGPEGRGVVYIFHGSPMGPL-AKPSQIIKSEQLVEGAPYPRTFGFALSGGLDMDGNTYPDLAVGAYSSDQVFIF 497          
BLAST of Alpha-int-2 vs. Ensembl Fly
Match: if (gene:FBgn0001250 transcript:FBtr0301354)

HSP 1 Score: 59.3066 bits (142), Expect = 2.536e-8
Identity = 40/132 (30.30%), Postives = 66/132 (50.00%), Query Frame = 3
Query: 1122 NVGAVFLACKGKPTD--------VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF--------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            +VG V++  +G PT+        +  G ++   FG A+  LGD++ +G  +F VGAP    +  G +YIF  +    +  KP Q+ +S+           FG A+S G D++ N  PD  V +  S + F+F
Sbjct:  367 DVGRVYILLQGGPTEEKRWTTEHIRDGYHSKGRFGLALTTLGDVNGDGYGDFAVGAPYDGPEGRGVVYIFHGSPMGPL-AKPSQIIKSEQLVEGAPYPRTFGFALSGGLDMDGNTYPDLAVGAYSSDQVFIF 497          
BLAST of Alpha-int-2 vs. Ensembl Fly
Match: if (gene:FBgn0001250 transcript:FBtr0301353)

HSP 1 Score: 59.3066 bits (142), Expect = 2.536e-8
Identity = 40/132 (30.30%), Postives = 66/132 (50.00%), Query Frame = 3
Query: 1122 NVGAVFLACKGKPTD--------VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF--------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            +VG V++  +G PT+        +  G ++   FG A+  LGD++ +G  +F VGAP    +  G +YIF  +    +  KP Q+ +S+           FG A+S G D++ N  PD  V +  S + F+F
Sbjct:  367 DVGRVYILLQGGPTEEKRWTTEHIRDGYHSKGRFGLALTTLGDVNGDGYGDFAVGAPYDGPEGRGVVYIFHGSPMGPL-AKPSQIIKSEQLVEGAPYPRTFGFALSGGLDMDGNTYPDLAVGAYSSDQVFIF 497          
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 67.781 bits (164), Expect = 7.681e-11
Identity = 64/213 (30.05%), Postives = 98/213 (46.01%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGE--KFRPTDLKTQRYGGFGTSMDTVNLGGN-LYAVVIGAP------YQSKQNLVNVGAVFLACKG-----KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGF------DVNFNGKPDFFVTSLGSQK 1457
            GYSVA   F+GD  Q   A  P    +F YVT +N     F       Q    FG ++   +L G+ L  V++GAP      ++SK     VG V+L  +       P   + G + +  +G AIA LGDI+ +G  +  +GAP    D+ G+++I+   +S  + +   QV +  +   GI    GF      D++ N  PD  V + G  K
Sbjct:  268 GYSVAVGEFTGDSEQELVAGVPRGAHNFGYVTVINATNLTFIQNFTGEQMASYFGYTIAVTDLNGDGLDDVLVGAPLYMDREFESKPR--EVGRVYLYLQEDVLLFSPPITLTGMHLFGRYGSAIAPLGDINQDGYLDVAIGAPFAGEDRGGRVFIYNGQKSGLMLQAS-QVLKGDWASSGIPAGFGFTLRGDSDLDNNQYPDLLVGAFGVSK 477          
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Match: itga3a (integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090805-3])

HSP 1 Score: 66.6254 bits (161), Expect = 1.499e-10
Identity = 49/161 (30.43%), Postives = 79/161 (49.07%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLYA-VVIGAPYQSKQNLVNVGAVFLACKGK-----PTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            FG S+  V+L  + +  +++GAP+   + +   GAV++           +DV+        FG ++  +GD++ +G ++F VGAP       G++ I+ T     I ++P QV   K      F  FG +ISRG DV+ NG PD  V SL  +   L   P
Sbjct:  307 FGNSVAVVDLNNDGWKDLIVGAPFYFDRKMDKGGAVYVYMNQNGSFRNKSDVVLTGPKDSGFGMSVVAIGDVNQDGFQDFAVGAP---YHSTGRVSIW-TGSKTGISQEPSQVIDGKDIPGGGFQTFGYSISRGLDVDRNGYPDIAVGSLDDRVVLLRSRP 463          
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 65.4698 bits (158), Expect = 2.723e-10
Identity = 64/213 (30.05%), Postives = 98/213 (46.01%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGE--KFRPTDLKTQRYGGFGTSMDTVNLGGN-LYAVVIGAP------YQSKQNLVNVGAVFLACKG-----KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGF------DVNFNGKPDFFVTSLGSQK 1457
            GYSVA   F+GD  Q   A  P    +F YVT +N     F       Q    FG ++   +L G+ L  V++GAP      ++SK     VG V+L  +       P   + G + +  +G AIA LGDI+ +G  +  +GAP    D+ G+++I+   +S  + +   QV +  +   GI    GF      D++ N  PD  V + G  K
Sbjct:  268 GYSVAVGEFTGDSEQELVAGVPRGAHNFGYVTVINATNLTFIQNFTGEQMASYFGYTIAVTDLNGDGLDDVLVGAPLYMDREFESKPR--EVGRVYLYLQEDVLLFSPPITLTGMHLFGRYGSAIAPLGDINQDGYLDVAIGAPFAGEDRGGRVFIYNGQKSGLMLQAS-QVLKGDWASSGIPAGFGFTLRGDSDLDNNQYPDLLVGAFGVSK 477          
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Match: itga2b (integrin, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-051031-1])

HSP 1 Score: 65.0846 bits (157), Expect = 4.811e-10
Identity = 52/166 (31.33%), Postives = 84/166 (50.60%), Query Frame = 3
Query: 1014 TQRYGGFGTSMDTVNLGGNLYA-VVIGAPY----QSKQNLVNVGAVFLACK-------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            TQ    FG S+   ++  + +  ++IGAP      S Q    VG V++  +        +P  ++ G  AY  FG AIA LGD+D +G  +  VGAP  ++D  GK++I+   +S  +  + +QV +S F        FG +I  G D++ NG PD  + + G+ K
Sbjct:  307 TQIASYFGHSVAVTDINRDGWDDILIGAPLFMEQLSTQKFREVGQVYVYLQRNDFSFASRPNQILAGTYAYGRFGSAIAPLGDLDHDGFNDVAVGAPG-SVDG-GKVFIY-LGKSGGLSTQYVQVIESPFRSLIDPPMFGFSIRGGTDIDDNGYPDLIIGAWGASK 469          
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Match: itga3b (integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-050411-55])

HSP 1 Score: 65.0846 bits (157), Expect = 5.112e-10
Identity = 48/162 (29.63%), Postives = 84/162 (51.85%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLY-AVVIGAPYQSKQNLVNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            FG+ +   +L  + +  +++GAP+   +     GAV++      + + K + V+ G+     FG+A+A +GD++ +G ++  VGAP       GK+YI+  ++S  I K+P QV + K      F  FG ++S G D++ N  PD  V SL  +   L   P
Sbjct:  302 FGSCLAVTDLNNDDWNDLIVGAPFYFDRYKEEGGAVYIFMNENGSFQKKASLVLKGKKG-SGFGFAVAAVGDVNQDGFQDIAVGAP---FQDSGKVYIWMGSKS-GITKEPSQVIEGKSLGPSGFQTFGYSLSGGMDMDGNDYPDILVGSLDDRIALLRSRP 458          
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Match: ITGA5 (integrin subunit alpha 5 [Source:NCBI gene;Acc:100492002])

HSP 1 Score: 80.1073 bits (196), Expect = 1.866e-14
Identity = 102/408 (25.00%), Postives = 169/408 (41.42%), Query Frame = 3
Query:  435 QSGIIILCSSNIN--NASPLGFDLKCKNLEE-------QRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLW---MDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-----DKFKK--CLGGFSXXXXXXXXXXXXXFGLPFENSTKLSN--------------LVEYSKIRDGPENKGTYFN--YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKFRPTDLKT-------QRYGGFGTSMDTVNLGGN-LYAVVIGAPYQSKQN----LVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            + G +  C    N  N + + FD +     E       + ++S S ++FG+ VRS          + C P +      +   +   G C L++   +     +EY  C     D   +  C GGFS +       +    G  F     ++               ++EY K     +   +Y +  +GYSVA   FSGD ++      P  N  + YVT +NG     TDL++       Q    FG S+   +L G+ L  ++IGAP    +     +  VG V++       +G P  ++ G   Y  FG +IA LGD+D +G  +  +GAP     + G ++IF   +   +  KP QV Q ++        FG++   G D++ NG PD  V + G  K  ++
Sbjct:   79 EGGAVFYCPWQRNGINCTEISFDSQGDRQRELHDSPQPEHMESKSEQWFGATVRS-----HGKTILACAPRYSWRTKKDEKHSDPVGTCYLSVNNFTTF---VEYSPCRTDFSDAAGQGYCQGGFSAEFTKSGRVLLGGPGSYFWQGQVITATQDEIQEAYYPEYFVLEYKKQMQTRQAASSYDDSYFGYSVAVGEFSGDDTEDFVVGVPKGNMTYGYVTILNG-----TDLRSLYNFSGEQMASYFGYSVSATDLNGDGLDDLLIGAPLLMDRTHDGRVQEVGRVYIYLQGDRMEGTPNLILTGTEEYGRFGSSIASLGDLDQDGFNDVAIGAPFGGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGQDLDGNGYPDLIVGAFGVDKTLVY 472          
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 71.2478 bits (173), Expect = 1.015e-11
Identity = 62/216 (28.70%), Postives = 101/216 (46.76%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQYASSPVDNG--DFPYVTRVNGEKF----RPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFK------TTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            GYSVA   F+ D  Q   + V  G  +F YV+ +N          T  +   Y G+  ++  VN  G L  +++GAP     + + N   VG V+L     A + +   V+ G   +  FG AIA LGD++ +G  +  VG+P    D+ G+++I+        T++ QI +      QS   GFG  +    D++ N  PD  V + G+ K  ++
Sbjct:  286 GYSVAVGEFTDDSVQEVVAGVPRGAQNFGYVSIINSTDMTFIQNFTGDQMASYFGYTVAVSDVNNDG-LDDILVGAPLFMDREFESNPREVGKVYLYMQESALEFRDPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNSNGLNTDTSQILEGAW-ASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVY 499          
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Match: ITGA3 (integrin subunit alpha 3 [Source:NCBI gene;Acc:100494331])

HSP 1 Score: 68.9366 bits (167), Expect = 4.081e-11
Identity = 139/694 (20.03%), Postives = 275/694 (39.63%), Query Frame = 3
Query: 1008 LKTQRYGG-FGTSMDTVNLGGNLYA-VVIGAPYQSKQNLVNVGAVFLA------CKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP-----NQEKVTCTWIEPS-------------------TGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKG---EPRFKLNNTELIE-DSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCY-LSKTSQVEWNHCEKIIKLPQQSCFLRN-CKSELSI-------NSVIDTKGNIIYYGDRTDYLRTIRIVISN-----NGPDSLHRISMSIAMNPDIRIDNIK-CSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFL---FPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDAR 2927
            L  Q+ G  FG+++   +L  + +  +V+GAPY   +     GAV++          K   V++G +++  FG+A+A +GDI+ +G  +  VGAP    D  GK+YI+ +          L ++     G  +    G DV+ N  PD  V SL  +   L   P        KVT T ++PS                   TG     ++  L+   ++ +        +Q A   + +G    P  K  N +L+  D+   KL P+         S+ + I  +  R      + D + +    Q  +   E  I   Q+ C   N C+S L +       N+ +     I++Y    + +  + ++++N     +  D  H   ++I + P++   +++  S T   ++T       +     E    + +S     +DL    +K  +++T+                  K+ F P           ++I +      + +    +VQD+G+ + +S+ + N G  L ++   F+   +P+++   K++LY  + +              +N   G  K C+ + +++NPLN+      K+   R +R  +E     ++++   R  SE           +++KC+      G   C    C L+ + + +  +   R W    TF + +
Sbjct:  291 LNGQQVGSYFGSAIALADLNNDGWQDIVVGAPYYFDRKEEIGGAVYVYNNVAGFFNDKAAMVLHG-SSFSGFGFALANIGDINQDGFTDLAVGAP---FDGLGKVYIYNSNAD----GPNLCIHN----GISLIPIGGLDVDDNAYPDLLVGSLTDRIALLRSRPVINISKDFKVTPTLVDPSKCSNTSCIDVLVCFSYTLSTGNAAYRKNITLQYTLEADHDRRPPRVKFQGASGAVYQGLFSMPDTKCQNVQLLLLDNIRDKLHPI-------SISLKYSILEREARGRSAVRSLDNFPVLSEDQSNFQELEVSIHF-QKECGSDNVCRSNLQMQYEYVVGNAPLVNGSQILHYDSSVNKV-NLNVIVTNFPSATSPADDAHEAVLNITIPPELFFSSVRPVSATSPAEITIVFEVVGISLKTREVVAGLQLSTLSKQDDLHEEYAKLLVDYTL------------------KISFSP-----------SHIQTYFSGNVMGESAMKTVQDVGSPVEFSFTVINYGEPLTSLATLFIAFNWPHEVANGKWLLYPTEVL--------------VN--TGTEKACHPSGDVINPLNLNV----KTLVKRRRRQIDETP-DVRTLAAVRRESSE-----------AVLKCSG-----GGATCVHFSCPLNDMQSRATISMRGRVW--NSTFLEVK 895          
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Match: selenbp1 (selenium binding protein 1 [Source:Xenbase;Acc:XB-GENE-959074])

HSP 1 Score: 67.781 bits (164), Expect = 1.039e-10
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 1167 VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            V+ G   Y  FG +IA LGDID +G  +  VGAP       G +YI++ + +  +F +P Q+ +S     T FG A+  G D++ NG PD  V +  + K F+F
Sbjct:  284 VLTGSRVYGRFGSSIAPLGDIDQDGFNDVAVGAPFGGESGGGCVYIYRGS-TAGLFPQPSQILESPLPPPTQFGFALRGGTDIDNNGYPDLLVGAFEADKVFIF 386          
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Match: selenbp1 (selenium binding protein 1 [Source:Xenbase;Acc:XB-GENE-959074])

HSP 1 Score: 67.781 bits (164), Expect = 1.068e-10
Identity = 38/104 (36.54%), Postives = 57/104 (54.81%), Query Frame = 3
Query: 1167 VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            V+ G   Y  FG +IA LGDID +G  +  VGAP       G +YI++ + +  +F +P Q+ +S     T FG A+  G D++ NG PD  V +  + K F+F
Sbjct:  333 VLTGSRVYGRFGSSIAPLGDIDQDGFNDVAVGAPFGGESGGGCVYIYRGS-TAGLFPQPSQILESPLPPPTQFGFALRGGTDIDNNGYPDLLVGAFEADKVFIF 435          
BLAST of Alpha-int-2 vs. Ensembl Mouse
Match: Itga5 (integrin alpha 5 (fibronectin receptor alpha) [Source:MGI Symbol;Acc:MGI:96604])

HSP 1 Score: 73.1738 bits (178), Expect = 1.956e-12
Identity = 101/406 (24.88%), Postives = 158/406 (38.92%), Query Frame = 3
Query:  435 QSGIIILCSSNIN--NASPLGFDLKCKNLEEQRLDSSSG---------KYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-DKFKK------CLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPE-------------NKGTYFN---YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEK----FRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL----VNVGAVFLACK------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            Q G + +C    +    + + FD K   + E  L S+ G         ++FG+ VR+        + + C PL  W       N   G C L+        + +EY  C   F        C GGFS +       V    G  F     LS   E       PE                + ++    GYSVA   FSGD ++   A  P  N  + YVT +NG      +  +  +   Y G+  +    N G  L  +++GAP   ++        VG V++  +        PT  + G++ +  FG ++  LGD+D +G  +  +GAP     + G ++IF       +  KP QV Q  +        FG A+  G D++ NG PD  V S G  K  ++
Sbjct:   95 QGGAVYVCPWGTSPIQCTTIQFDSKGSRILESSLYSAKGEEPVEYKSLQWFGATVRA-----HGSSILACAPLYSWRTEKDPQNDPVGTCYLSTEN---FTRILEYAPCRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTN-GDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGGPGG-LSTKPSQVLQPLWAAGRTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKALVY 490          
BLAST of Alpha-int-2 vs. Ensembl Mouse
Match: Itga2b (integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601])

HSP 1 Score: 71.2478 bits (173), Expect = 7.491e-12
Identity = 53/177 (29.94%), Postives = 86/177 (48.59%), Query Frame = 3
Query:  969 VTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKGK-------PTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            + R++GE+          Y G   ++  VN G   + +++GAP     ++ + L  VG V+L  + K       PT ++ G   Y  FG AIA LGD++ +G  +  V AP       G++ IF   +S  +  +P QV  S F   +GFG ++    D++ NG PD  V + G+ K
Sbjct:  307 LHRLHGEQM-------ASYFGHSVAVTDVN-GDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVLIF-LGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASK 474          
BLAST of Alpha-int-2 vs. Ensembl Mouse
Match: Itgav (integrin alpha V [Source:MGI Symbol;Acc:MGI:96608])

HSP 1 Score: 67.781 bits (164), Expect = 7.576e-11
Identity = 106/395 (26.84%), Postives = 157/395 (39.75%), Query Frame = 3
Query:  435 QSGIIILCS-SNINNASPLGFDLKCKN--LEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-------DKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPENKGTYFN----------------YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKFRPTDLKT--QRYGGFGTSMDTVNLGGNLYA-VVIGAPY----QSKQNLVNVGAVFLACKGKPTDV----IYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            + G ++ C  S+     P+ FD        ++  L+  S ++FG+ VRS   K D I  + C PL  W           G C L   +D    KT+EY  C       D    C GGFS+D    D  +    G  +     +S+ V     +  P      +N                 GYSVA   F+GDG +   +  P        V   +G+        T  Q    FG S+   ++ G+ YA V IGAP      S   L  VG V ++ +    D     + G   +  FG AIA LGD+D +G  +  + AP    DK G +YIF    S  +   P Q+ + ++        FG ++    DV+ NG PD  V + G  +  L+
Sbjct:   82 EGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKSHQWFGASVRS---KQDKI--LACAPLYHWRTEMKQEREPVGTCFL---QDG--TKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIF-NGRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLY 465          
BLAST of Alpha-int-2 vs. Ensembl Mouse
Match: Itga8 (integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442])

HSP 1 Score: 65.855 bits (159), Expect = 3.227e-10
Identity = 59/212 (27.83%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKF----RPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKG-----KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF------TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            GYSVA   F+GD  Q   A  P    +F YV+ +N          T  +   Y G+   +  VN  G +  +++GAP     + + N   VG V+L  +      +   V+ G   +  FG ++A LGD++ +G  +  +G P    D+ GK+ I+       +  KP QV Q  +      +GFG ++    D++ N  PD  V + G  K
Sbjct:  267 GYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDG-MDDILVGAPLFMEREFESNPREVGQVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLIYNGNPR-GLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGKGK 476          
BLAST of Alpha-int-2 vs. Ensembl Mouse
Match: Itga7 (integrin alpha 7 [Source:MGI Symbol;Acc:MGI:102700])

HSP 1 Score: 65.4698 bits (158), Expect = 4.475e-10
Identity = 50/160 (31.25%), Postives = 80/160 (50.00%), Query Frame = 3
Query: 1029 GFGTSMDTVNLGGNLYA-VVIGAPY--QSKQNLVNVGAVFLACKGKPTDV----IYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG---FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            GFG S+   +L  + +A +++GAPY  + ++ L     V++   G   D+    I G +    FG ++A LGD++ +G  +  VGAP    D  GK++I+  + S  +  KP QV + +  G   FG ++S G DV+ N  PD  V SL          P
Sbjct:  319 GFGYSLAVTDLNNDGWADLIVGAPYFFERQEELGGAVYVYMNQGGHWADISPLRICG-SPDSMFGISLAVLGDLNQDGFPDIAVGAP---FDGDGKVFIYHGS-SLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARP 473          
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Match: sp|P11688|ITA5_MOUSE (Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.368e-11
Identity = 101/406 (24.88%), Postives = 158/406 (38.92%), Query Frame = 3
Query:  435 QSGIIILCSSNIN--NASPLGFDLKCKNLEEQRLDSSSG---------KYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-DKFKK------CLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPE-------------NKGTYFN---YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEK----FRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL----VNVGAVFLACK------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            Q G + +C    +    + + FD K   + E  L S+ G         ++FG+ VR+        + + C PL  W       N   G C L+        + +EY  C   F        C GGFS +       V    G  F     LS   E       PE                + ++    GYSVA   FSGD ++   A  P  N  + YVT +NG      +  +  +   Y G+  +    N G  L  +++GAP   ++        VG V++  +        PT  + G++ +  FG ++  LGD+D +G  +  +GAP     + G ++IF       +  KP QV Q  +        FG A+  G D++ NG PD  V S G  K  ++
Sbjct:   95 QGGAVYVCPWGTSPIQCTTIQFDSKGSRILESSLYSAKGEEPVEYKSLQWFGATVRA-----HGSSILACAPLYSWRTEKDPQNDPVGTCYLSTEN---FTRILEYAPCRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPEYLINPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTVLNGSDIHSLYNVSGEQMASYFGYAVAATDTN-GDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEFSRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGGPGG-LSTKPSQVLQPLWAAGRTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKALVY 490          
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Match: sp|Q06274|ITA5_XENLA (Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga5 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.390e-11
Identity = 67/231 (29.00%), Postives = 106/231 (45.89%), Query Frame = 3
Query:  834 LVEYSKIRDGPENKGTYFN--YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKFRP----TDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKG-----KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLG 1448
            ++EY K     +   +Y +  +GYSVA   FS D ++      P  N  + YVT +NG   R     +  +   Y G+  S   +N  G L  ++IGAP          +  VG V++  +G      P  ++ G   Y  FG +IA LGD+D +G  +  +GAP     + G ++IF   +   +  KP QV Q ++        FG++   G D++ NG PD  V + G
Sbjct:  241 VLEYKKQMQTRQAASSYDDSYFGYSVAVGEFSEDATEDFVVGVPKGNITYGYVTILNGTDLRSLYNFSGEQMASYFGYSVSATDLNSDG-LDDLLIGAPLFMDRTHDGRVQEVGRVYVYLQGDHMESTPHLILTGMEEYGRFGSSIASLGDLDQDGFNDIAIGAPFGGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGHDLDGNGYPDLIVGAFG 469          
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Match: sp|P08648|ITA5_HUMAN (Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.704e-11
Identity = 102/406 (25.12%), Postives = 158/406 (38.92%), Query Frame = 3
Query:  435 QSGIIILC--SSNINNASPLGFDLKCKNLEEQR---------LDSSSGKYFGSVVRSVKLKNDAIAFIYCDPL--WMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDK-------FKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPE-------------NKGTYFN---YGYSVA---FSGDGSQ--YASSPVDNGDFPYVTRVNGEKFRP----TDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL----VNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            Q G + LC   ++    +P+ FD K   L E           ++  S ++FG+ VR+        + + C PL  W      L+   G C L+        + +EY  C            C GGFS +       V    G  F     LS   E       PE                + ++    GYSVA   FSGD ++   A  P  N  + YVT +NG   R     +  +   Y G+  +   VN G  L  +++GAP    +        VG V++        +  PT  + G + +  FG ++  LGD+D +G  +  +GAP     + G +++F       +  KP QV Q  +        FG A+  G D++ NG PD  V S G  K  ++
Sbjct:   92 QGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATVRA-----HGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDN---FTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVN-GDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGG-LGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVY 487          
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Match: sp|Q9QUM0|ITA2B_MOUSE (Integrin alpha-IIb OS=Mus musculus OX=10090 GN=Itga2b PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 5.240e-11
Identity = 53/177 (29.94%), Postives = 86/177 (48.59%), Query Frame = 3
Query:  969 VTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKGK-------PTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            + R++GE+          Y G   ++  VN G   + +++GAP     ++ + L  VG V+L  + K       PT ++ G   Y  FG AIA LGD++ +G  +  V AP       G++ IF   +S  +  +P QV  S F   +GFG ++    D++ NG PD  V + G+ K
Sbjct:  307 LHRLHGEQM-------ASYFGHSVAVTDVN-GDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVLIF-LGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASK 474          
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Match: sp|P08514|ITA2B_HUMAN (Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA2B PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 1.019e-10
Identity = 61/216 (28.24%), Postives = 105/216 (48.61%), Query Frame = 3
Query:  882 YFN--YGYSVA---FSGD--GSQYA-SSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGG-FGTSMDTVNLGGN-LYAVVIGAPY----QSKQNLVNVGAVFLACK-------GKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF---TGFGIAISRGFDVNFNGKPDFFVTSLGSQK 1457
            YF+  +GYSVA   F GD   ++Y   +P  +     V  ++    R   L+ ++    FG S+   ++ G+  + +++GAP     ++ + L  VG V+L  +       G P+ ++ G   Y  FG AIA LGD+D +G  +  V AP       G++ +F   +S  +  +P QV  S F   + FG ++    D++ NG PD  V + G+ +
Sbjct:  261 YFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVF-LGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQ 475          
BLAST of Alpha-int-2 vs. TrEMBL
Match: A0A1P8CUZ0 (Alpha-int-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1384.78 bits (3583), Expect = 0.000e+0
Identity = 709/710 (99.86%), Postives = 710/710 (100.00%), Query Frame = 3
Query:  624 MDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKGEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNV 2753
            MDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSVDIIAIDDDVKIIFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILN+GEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSINDDDNVANNNFNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNV
Sbjct:    1 MDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSVDIIAIDDDVKIIFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNQGEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSINDDDNVANNNFNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNV 710          
BLAST of Alpha-int-2 vs. TrEMBL
Match: A0A1P8CUU5 (Alpha-int-4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.948e-69
Identity = 236/836 (28.23%), Postives = 412/836 (49.28%), Query Frame = 3
Query:  876 GTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNL-GGNLYAVVIGAPYQSKQNLVNVGAVFLAC-----KGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQS---KFTG-FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTW-----IEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDIL-------NKGEPRFKLNNTELIED-------SYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSC---FLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKL--TAGRHASVLVKNL-IEAKDSVTISVDILYNDLE----IMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSI--NDKNGLVKY-CNVAKEMLNPLNVIAHDYKKSET-------------YRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSL--IKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANL-ELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPXXXXXXXXXXXXXXXXXXXXXXXXFKR-KRLRKERQK 3200
            G Y+N+GYSVA + +   Y SSP+ +   P VT +  E  + T      +  FG ++ T+++  G  YAVVIGAP+ S +++ NVG V++ C     +  P+D ++G+   + FGY +A +GDI+ +G+++  + +P L  D+  G + ++   E+C++ + P Q+ +S   K  G FGIAI+ G D++FNG PD  V+S  S    ++         C +     +E    ++ +  +  L +  +    N+Y +  +   + +L       N    RFKL    +  +       S    +  L +V+DM+  +IP  I  + V  C+   N+ C       + W  C  II + +  C   F+  C ++++   ++D  GN + YG    Y RT+ + I N GP     I+  I    ++RI+ I  + +    L  T    A+  ++N  I+A + + I +D+ + D +    ++     +   ++S   D N+ NN   + Y  +++P + +S+ + ++  IDSR +   +    RV++  +G  LS +++I+N G   + N+ ++   P + + + YILYL DKIR     + ++   SI  +   G  KY C++  E +NPL +I  +  +S               +  KRSAN+  F N S + N        + L  + R  +  I+CN S   L  PICG++ C +  +P N +      AW++  TFF  +I  L V +T+  +   +PKG+  ++    + P    Q  +FN +K++     PLWPIIV I+IG  +L I+I+  Y CGFFKR KR R  R K
Sbjct:   53 GKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIR-EDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNL-TIPVTIGYRFVENCE---NRKCNNLLFPLINWEKCTTIIPIKKYICSNIFI--CNADIAA-ELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISIPLQTKENLYILYLFDKIRGVN--QSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQ-PFINASANAN-------KMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVK-LRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSK 869          
BLAST of Alpha-int-2 vs. TrEMBL
Match: A0A564XVQ4 (Integrin_alpha2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS338 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.545e-50
Identity = 276/1166 (23.67%), Postives = 480/1166 (41.17%), Query Frame = 3
Query:  162 MFQLLLFYFLANGVLTDQIKNWIP----NYENENTFNEPYDFVD------DKF---LPNFQNFGSGYD-----WISIAGSSIINQKQAHIAFTGTRXXXXXXXXXXXTKQSGIIILCSSNINNASPLGFDL-KCKNLE----EQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKK---CLGGFSXXXXXXXXXXXXXF--GLPFENSTKLSNLVE------YSKIRDGPENKGTYFNYGYSVAFS--GDGSQYA----SSPVDNGDFPYVTRVNGE-KFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL-VNVGAVFLACKGKP---TDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQSK--FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPF-LFVMPNQEKVTCT------------------WIEPSTGFI--INEQSFELKVLFQSSN---------------LNEYQNYGYQVAIDILNK------------GEPRFKLNNTELIE------DSYNLKLQPLLDVQDMDFKSIPFKIALKGV---RKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLR-NCKSEL--SINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSI--------AMNPDIRI----DNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVD------------ILYN-----------------DLEIMSSKTS--INFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSV-QDLGTELSYSYLIENKGP-ELKNVTLKFLFPYKIQPDKYILYLMDKIRL----STSVKEEISLPSINDKNGL-VKYCNVAKEMLNPLNVIAHDYKKSETYRS------KRSANELNFSNKSVSQNDRS------QSEGNVALSSLG-RTSLIKCNESNPNLGAP-----------ICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQA--NLELPKGLSVVKENQI---IGPIF--ASQNVLFNKMKVDEDKPLPLWP 3092
            +++L++F+  A          W P      + +     P +F D       KF   LP+  N+ SG D     W S+      N + + +   GT +   +   + +T   G ++ C  ++    P GFD+  C+ L        L+ +     G  ++S+ L    +  ++CDPL   +  +     G+C +    +      +    C  + +   C GGFS+D+   DD        GLPF         V+        +IRD    + ++   GYSVA+S    G + A     SP  N     VTR+  +   +   +    +GG G +++T  +G  L AV+ GAPY+    +  N G V++  +         + G    + FGYAIAR+GD+D +G  E  + AP+L ++  PG++YI +     ++ ++P+Q+ ++    TGFG+++SR  D++ +G P+  VT+L  + PF L+ +P + +  C                    +  +  FI  I+ + F     F+S +               LN+Y N     A D LN+             +PRF L     I        S + KLQ   D Q M+  +IP  +A + +    +C     + C  S    ++W+ C   +  P   C     C ++L  SIN   D+  + + +G R D  +T+  V+ NNGP     + + +           P IR+      ++ + T     T+ R +S    NL     +  IS              I+ N                 DL+ M   TS  I   + S+ +D  +  N     + V++KP++ I+        +D R +PP+L    ++ +  D+G  L + YL+EN G  +L ++  +   P +      +LYL DK RL     +  +   +LP +   NG  V +C + +E +NPLN+   +   S+  +S      +R + E N ++K +  +  +       +  +V     G R + I C  ++PN  A            +C  ++CRL  +P           W++T TFF  ++P +  +T L      E PK L    E ++     P F    Q V+F  +       +PLWP
Sbjct:    3 LYRLIVFFLSAASA------QWFPPILIQSDPQKQLFRPVNFPDLHEGFLSKFTQQLPHVPNYISGLDPSNFHWTSVTMFRESNSQISWLIAAGT-SPKRNQSGTAFTTSFGAVVGCRIDVLAEKPGGFDIVSCEILGLDTGTPSLNHTDAGLLGKGLQSLNLPTGGVV-VFCDPLSHSDRGSW-FPGGRCNIMGRSNGRWWSGVPIEFCSAYGRTQPCAGGFSIDLRPSDDGENAQLLSGLPFALQNPRVRTVDDILGRAEQRIRDIGSQEDSF---GYSVAWSPYSPGRREALAIVGSPPSNVQGFEVTRLGDDIDNQVLTVNGSNFGGLGFAVETSIVGSGL-AVIGGAPYEDVGKVGANTGRVYVQFRDNEKLRNFTLEGSRPGEMFGYAIARIGDVDGDGIGEVAISAPALGIENIPGRVYIHRILADYRLEREPIQILEAPNNATGFGVSLSRSIDIDSDGGPELVVTTLDPKVPFLLYSLPLRLRAKCVSRFRPRVTANQIRKGDIITVRFTVNFIDSISGKPFPAPSSFKSRSYQVNPDILWLERYDFLNKYPN-----ASDFLNELLFTKESFKLDPAKPRFSLEEISDIRVGISGSVSADAKLQAQEDAQFMELDTIPLHVAFRSILADSQCD-RYTQSCPKSVQPLIDWSDCVWKLPPPTYLCPPHPKCSADLQVSINGGSDSH-SPVQFGRREDANQTLTFVLRNNGPTGSEGVRVLLKALGWPKNETQPGIRVLINKVELRDAATGVLLATSDRPSSQWSINLPSIGAAALISSQQGTAIDPYQELFIIVNTFLSGLAPVRYEEEKSGDLDEMRKITSPGILANVSSVMEDPTMVTNVAVSIFDVIYKPQVRINPGAAPPALVDERKEPPHLTSSTKIVLGNDVGPRLEHVYLVENFGATDLNDLAFQLEIPVRFDEGDTLLYLTDKARLLDNGISDYRWVDTLPKMISANGSEVGFCEIEEEFVNPLNLTIREAGYSKPSQSDQPTIRRRRSVEANENSKELKPSRVTFTSPFGDNRVDVYFKRAGQRQTTISC--ASPNSPASSNYGNDLHFNIVCARIVCRLSKLPRADTIRVSLTGWLWTPTFFKNQLPDVKFVTRLSILDWGEPPKILLAYPEARLDFPDNPPFYELPQAVVFRGVTGKYRSRIPLWP 1146          
BLAST of Alpha-int-2 vs. TrEMBL
Match: A0A158R9S2 (Integrin_alpha2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7722 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.002e-43
Identity = 248/1063 (23.33%), Postives = 433/1063 (40.73%), Query Frame = 3
Query:  432 KQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYP-VCDKFKK----CLGGFSXXXXXXXXXXXXXFGL------------------------PFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDG---SQYASSPVD------NGDFPYVTRVNGEKFRPTDL--KTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLAC------------KGKPTD----VIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSL-NLDKPGKIYIFKTTESCQIFKKPLQVYQS--KFTGFGIAISR-GFDVNFNGKPDFF--VTSLGSQKPFLFVMPNQEKVTCTWIEP----STGFIINEQ-SFELKV---------------LFQSSNLNEYQNYGYQVAIDILNK--GEPRFKLNNTELIE-----DSYNLK--LQPLLDVQDMDFKSIP---FKIALKGVRKC-----KISGNKDCYLSKTSQ---VEWNHCEKIIKLPQQSCFLRN-CKSELSINSVIDTKG-------------NIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKC-------------STTCKTKLTAGRHASVLVKNLIEAKDSVT-----ISVDILY--------NDLEIMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNI-DSRIKP-PYLEKLH-RVSVQDLGTELSYSYLIENKGP--ELKNVTLKFLFPYKIQ-PDKYILYLMDKIRLSTS------------VKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSA---NELNFSNKSVSQNDRSQSEGNVALS----------SLGRT--SLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANL-ELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWP 3092
            ++ GI+ LC   + ++  L F   C++L E  L+S+S  Y G+   S+++  +     YCDPLW D +   +   G+C L ++ +  I    E    C    K    C+ GFSVD+++       I                           PF      +     S     PE+   Y   G  V+  GDG   +Q +S+  +       GD   +    G +F       +T  + GFGTSM  +        +V+G+PY  K      G V+  C            +  PTD     +     ++ FGY++  LGDI+ +G E+ VVGAP L +  K G+++I     +C   ++P+QV     K   FG  + R G D++FNG  DF   V    S  P ++   +  +  C + +P    S     N +   +LKV               L Q++N++  Q+  +QV  D+  K  G  R +L+    ++     D  +LK  L P +DV+DM     P    +I  +    C      +   K C          ++W+ C   ++L +  C  +  C+S++S+    +  G              ++ YGDR   + T+ + I N GP     + +++A   ++R    +              ST C   L      +  +  L   +++V+     I V   Y        ND  + S    +N ++ S   D     N+    YK+L  PK +I+      +++ D+R KP  ++   H R+ V+++G  + +++ +E+ GP  +++NVTL+   P ++    K ++YL +++R  +S            V ++I   + +   G   + N  + ++NP   I  D   +E  R +R     +ELN +       + S + G  A            S  R    +I+C       G P+C E+IC L  +            W++  TFF      + ++T+L  +   +PKG  V++  + IG     Q   F K+K      +P+WP
Sbjct:  124 REDGIVQLCKFTLTSSGQLTFTSPCQDLSEG-LNSTS--YLGAASASLQISQNMGLVAYCDPLWRDES---HFPAGRCYLQLLHNENIRPRHELASFCRTGGKVTEPCMTGFSVDLMSKGRANSGILEFLKSIHVIVGQPLAIGCGRVQILADPFYYPRTFTVYRPSSLETTLPESYFGYSVAGDYVSVVGDGFGQTQESSNASELIQVFKVGDLQSIRTTGGVEFDWQGRVDRTGSFAGFGTSMVRLKNVDGQDIIVVGSPYAPKG-----GRVYAYCVPANLAIESSNRQAVPTDSYRDFVSAPTGFEAFGYSLTALGDINGDGQEDIVVGAPQLRDKSKSGRVFILSILNNCTFDRRPIQVISGPEKAAYFGSILPRKGMDLDFNGWSDFALPVPYCTSCLPMVYTSRSHYQAACRFYQPNWLGSVRIRRNARIPIKLKVRLTPSSKNKGKNLEQLLQAANVS-VQDLVHQVIPDLWAKEIGAQRVRLSAFHSVKLNPYYDMLSLKFDLLPQMDVEDMPSLEQPDGGIRIQYRFNIPCPDGAKAVEDTKTCLGGAWVHRPIIDWSGCNFQLRLTKYVCLPKGRCESDVSLLVTDEKSGKFANSVHSNPSGETVLIYGDREGAMSTLTVNIYNQGPTFAGGVWINMAFFGNLRFSAFEVARRSNHNGNYEFKSTVCSHPLNNDTWVTCRLGRLEFNQENVSSPVQRIRVTTFYAAYSGTGNNDFSLPS---YMNISVSSQTYDPQAHKNHVIWRYKLLHAPKYLITPAGHAPSSVLDNRTKPTSWVPGFHQRIRVEEMGPRIQHTFQVEHMGPIKQVENVTLRLQVPVRLANKAKPLVYLFNEVRAPSSSGIDMDWVPLRPVVQQIGTSASDASGGSSCWYN-DESLINPNGWIGIDMSSAEVRRVRRDTPNPSELNGTELMRWNYNSSDTLGQAAGRFGNGTHPQKVSFRRVPKEVIQCGRVGQKFGKPLCLEIICHLRQLKKKHPVQISVTGWLYAPTFFQYSTSDIEIVTSLTVDQGAVPKG--VLRSPEPIGSFNMPQIFYFTKIKPTIFHQIPIWP 1168          
BLAST of Alpha-int-2 vs. TrEMBL
Match: A0A0R3SC97 (Integrin_alpha2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2179 PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 8.443e-42
Identity = 237/983 (24.11%), Postives = 411/983 (41.81%), Query Frame = 3
Query:  162 MFQLLLFYFLANGVLTDQIKNWIP----NYENENTFNEPYDFVD------DKF---LPNFQNFGSGYD-----WISIAGSSIINQKQAHIAFTGTRXXXXXXXXXXXTKQSGIIILCSSNINNASPLGFDL-KCKNLE----EQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKK---CLGGFSXXXXXXXXXXXXXF--GLPFENSTKLSNLVE------YSKIRDGPENKGTYFNYGYSVAFS--GDGSQYA----SSPVDNGDFPYVTRVNGE-KFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNL-VNVGAVFLACKGKP---TDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQSK--FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPF-LFVMPNQEKVTCT------------------WIEPSTGFI--INEQSFELKVLFQSSN---------------LNEYQNYGYQVAIDILNK------------GEPRFKLNNTELIE------DSYNLKLQPLLDVQDMDFKSIPFKIALKGV---RKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLR-NCKSEL--SINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSI--------AMNPDIRI----DNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTIS------VD------ILYN-----------------DLEIMSSKTS--INFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSV-QDLGTELSYSYLIENKGP-ELKNVTLKFLFPYKIQPDKYILYLMDKIRLS----TSVKEEISLPSINDKNGL-VKYCNVAKEMLNPLNV 2636
            ++ L++F+      L+     W P      + +     P +F D       KF   LP+  N+ SG D     W SI      N + + +   GT +   +   + +T   G ++ C  ++    P GFD+  C+ L        L+ +     G  ++S+ L    +  ++CDPL   +  +     G+C +    +      +    C  + +   C GGFS+D+   DD        GLPF         V+        +IRD    + ++   GYSVA+S    G + A     SP  N     VTR+  +   +   +    +GG G +++T  +G  L AV+ GAPY+    +  N G V++  +         + G    + FGYAIAR+GD+D +G  E  + AP+L ++  PG++YI +     ++ ++P+Q+ ++    TGFG+++SR  D++ +G P+  VT+L  + PF L+ +P + +  C                    +  +  FI  I+ + F     F+S +               LN+Y N     A D LN+             +PRF L     I        S + KLQ   D Q M+  +IP  +A + +    +C     + C  S    ++W+ C   +  P   C     C ++L  SIN   D+  + + +G R D  +T+  V+ NNGP     + + +           P IR+      ++ + T     T+ R +S    NL     +  IS      +D      I+ N                 DL+ M   TS  I   + S+ +D  +  N     + V++KP++ I+        +D R +PP+L    ++ +  D+G  L + YL+EN G  +L ++  +   P +      +LYL DK RL     +  +   +LP +   NG  V +C + +E +NPLN+
Sbjct:    3 LYGLIVFF------LSAASAQWFPPILIQSDPQKQLFRPVNFPDLHEGFLSKFTQQLPHVPNYISGLDPSNFHWTSITMFRESNSQISWLIAAGT-SPKRNQSGTAFTTSFGAVVGCRIDVLAEKPGGFDIVSCEILGLDTGTPSLNHTDAGLLGKGLQSLNLPTGGVV-VFCDPLSHSDRGSW-FPGGRCNIMGRSNGRWWSGVPIEFCSAYGRTQPCAGGFSIDLRPSDDGENAQLLSGLPFALQNPRVRTVDDILGRAEQRIRDIGSQEDSF---GYSVAWSPYSPGRREALAIVGSPPSNVQGFEVTRLGDDIDNQVLTVNGSNFGGLGFAVETSIVGSGL-AVIGGAPYEDVGKVGANTGRVYVQFRDNEKLRNFTLEGSRPGEMFGYAIARIGDVDGDGIGEVAISAPALGIENIPGRVYIHRILADYRLEREPIQILEAPNNATGFGVSLSRSIDIDSDGGPELVVTTLDPKVPFLLYSLPLRLRAKCVSRFRPRVTANQIRKGDIITVRFTVNFIDSISGKPFPAPSSFKSRSYQVNPDILWLERYDFLNKYPN-----ASDFLNELLFTKESFKLDPAKPRFSLEEISDIRVGISGSVSADAKLQAQEDAQFMELDTIPLHVAFRSILADSQCD-RYTQSCPKSVQPLIDWSDCVWKLPPPTYLCPPHPKCSADLQVSINGGSDSH-SPVQFGRREDANQTLTFVLRNNGPTGSEGVRVLLKALGWPKNETQPGIRVLINKVELRDAATGVLLATSDRPSSQWSINLPSIGAAALISSQQGTAIDPYQELFIIVNTFLSGLAPVRYEEEKSGDLDEMRKITSPGILANVSSVMEDPTMVTNVAVSIFDVIYKPQVRINPGAAPPALVDERKEPPHLTSSTKIVLGNDVGPRLEHVYLVENFGATDLNDLAFQLEIPVRFDEGDTLLYLTDKARLLDNGISDYRWVDTLPKMISANGSEVGFCEIEEEFVNPLNL 965          
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Match: itga3a (integrin alpha-3 [Source:NCBI gene;Acc:103032002])

HSP 1 Score: 72.4034 bits (176), Expect = 2.498e-12
Identity = 68/231 (29.44%), Postives = 106/231 (45.89%), Query Frame = 3
Query: 1008 LKTQRYGG-FGTSMDTVNLGGNLY-AVVIGAPYQSKQNLVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQS----FELKVLFQ------SSNLNEYQNYGYQVAIDILNK 1631
            L+ Q+ G  FG S+  V++  + +  +++GAP+   +     GAV+L           TD+ +       FG A+A +GD++ +G ++F VGAP       G++YI+  ++   + KKP QV + K      F  FG +IS G DV+ N  PD  V SL  +   L   P         + P    IIN QS     E+KV F        SN  +     + V  D+L +
Sbjct:  309 LRGQQVGSYFGNSIAIVDINNDGWKELIVGAPFYFDRRKEEGGAVYLFMNENGSFQDKTDLFFTGPKQSGFGMAVAAIGDVNQDGFQDFAVGAP---YHSSGRVYIWMGSKD-GLSKKPSQVIEGKDITNGGFQTFGYSISGGLDVDDNKYPDMVVGSLDDRVVLLRSRPVIHLKKSFTVTP---LIINPQSCDSCIEVKVCFSYTVSTGDSNYKKNITVKFTVEADLLQR 532          
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Match: itga3a (integrin alpha-3 [Source:NCBI gene;Acc:103032002])

HSP 1 Score: 72.0182 bits (175), Expect = 2.888e-12
Identity = 68/231 (29.44%), Postives = 106/231 (45.89%), Query Frame = 3
Query: 1008 LKTQRYGG-FGTSMDTVNLGGNLY-AVVIGAPYQSKQNLVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQS----FELKVLFQ------SSNLNEYQNYGYQVAIDILNK 1631
            L+ Q+ G  FG S+  V++  + +  +++GAP+   +     GAV+L           TD+ +       FG A+A +GD++ +G ++F VGAP       G++YI+  ++   + KKP QV + K      F  FG +IS G DV+ N  PD  V SL  +   L   P         + P    IIN QS     E+KV F        SN  +     + V  D+L +
Sbjct:  309 LRGQQVGSYFGNSIAIVDINNDGWKELIVGAPFYFDRRKEEGGAVYLFMNENGSFQDKTDLFFTGPKQSGFGMAVAAIGDVNQDGFQDFAVGAP---YHSSGRVYIWMGSKD-GLSKKPSQVIEGKDITNGGFQTFGYSISGGLDVDDNKYPDMVVGSLDDRVVLLRSRPVIHLKKSFTVTP---LIINPQSCDSCIEVKVCFSYTVSTGDSNYKKNITVKFTVEADLLQR 532          
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Match: itga8 (integrin subunit alpha 8 [Source:NCBI gene;Acc:103045927])

HSP 1 Score: 65.855 bits (159), Expect = 2.203e-10
Identity = 65/217 (29.95%), Postives = 100/217 (46.08%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQYASSPVDNG--DFPYVTRVNGE--KFRPTDLKTQRYGGFGTSMDTVNLGGN-LYAVVIGAP------YQSKQNLVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGF------DVNFNGKPDFFVTSLGSQKPFLF 1469
            GYSVA   F+GD  Q   + V  G  +F YV  +N     F       Q    FG ++   +L G+ L  V++GAP      ++SK     VG V+L     A    P   + G + +  +G AIA LGDI+ +G  +  VGAP    D+ G+++I+    S  +  +  QV +  +   GI    GF      D++ N  PD  V + G+ K  ++
Sbjct:  258 GYSVAVGEFTGDSQQELVAGVPRGAQNFGYVAVINSTNLTFIQNFTGEQMASYFGYTVAVTDLNGDGLDDVLVGAPLYMDREFESKPR--EVGRVYLYLQEDALLFSPAIKLTGTHVFGRYGSAIAPLGDINQDGYLDVAVGAPFAGDDRGGRVFIYNGQHS-GLRMEASQVLRGAWASSGIPAGFGFTLRGDSDLDNNQYPDLIVGAFGAGKVVVY 471          
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Match: itga3b (integrin alpha-3-like [Source:NCBI gene;Acc:103040573])

HSP 1 Score: 62.7734 bits (151), Expect = 1.849e-9
Identity = 52/173 (30.06%), Postives = 81/173 (46.82%), Query Frame = 3
Query: 1032 FGTSMDTVNLGG-NLYAVVIGAPYQSKQNLVNVGAVFL-----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEP 1514
            FG+S+   +L   N   +++GAP+   +     GAV++        G    V+ G      FG A+A +GDI+ +G ++F VGAP       GK+YI+  ++   I K P QV +        F  FG ++S G D++ N  PD  V SL  +   L   P  +      +EP
Sbjct:  300 FGSSIAVTDLNNDNWNDLIVGAPFYFDRYKEQGGAVYVFMNENGSFGGKKMVLKGMKG-SGFGIAVAAIGDINQDGFQDFAVGAP---FHGSGKVYIWTGSKE-GIMKDPSQVIEGNSVGSGGFQTFGYSLSGGMDMDGNKYPDILVGSLDDRIALLRARPVIQLSRTFTVEP 467          
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Match: itgav (integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616-382])

HSP 1 Score: 61.6178 bits (148), Expect = 5.249e-9
Identity = 84/340 (24.71%), Postives = 142/340 (41.76%), Query Frame = 3
Query: 1080 VVIGAPY----QSKQNLVNVGAVFLACKGK------PTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFT------GFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF-VMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKGEPRFKLNNTELIEDS-YNLKLQPLLDVQD--MDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNP 2039
            +++GAP      S   L  VG V++   GK      P   + G   Y  FG AI  LGD+D +G  +  + AP     + G IYI     S     +P QV + ++        FG +++   D++ NG PD  V   G+ K  L+   P+ ++     +   T   + ++    +VLF  + L +Y  +       + N   P  +     LI+DS +  K+ P+    +  +D++S   K  LK +       N    L+K + +  +  E  I           CK +L ++ V D K   IY GD  D   T+ +   N+G +  +   + + M P
Sbjct:  306 LLVGAPLFMERGSDGKLREVGQVYVYL-GKDGFAFLPPIKLTGSEIYARFGSAITSLGDLDMDGFNDVAIAAPYGGSSRQGLIYIHNGRPSGPD-TQPSQVLEGRWASASMPPSFGYSMNGATDIDENGYPDLLVGVFGADKAVLYRYAPSLKQHVLVDL---TLDRLKQKGAIKRVLFLHTRLPQYTKF-----TTVSNGQGPSCEEQQAYLIDDSEFRDKITPISVFMEYSLDYQSAADKSGLKPILDQSTPAN----LTKQAHILLDCGEDNI-----------CKPDLKLSVVSDQKQ--IYIGD--DNPLTLEVTAMNDG-EGAYEAELHVIMPP 615          
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 77.7962 bits (190), Expect = 9.251e-15
Identity = 85/301 (28.24%), Postives = 133/301 (44.19%), Query Frame = 3
Query:  864 PENKGTYFNYGYSVA-FSGDGSQYASSPVDNG--DFPYVTRVNGEKFRP----TDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKGKPTDV-----IYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTG------FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF-VMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKGEPRFKLNNTELIEDSYNLKLQ 1697
            P    +Y  Y  +V  F+GD  Q   + V  G     YV  ++GE        +  +   Y GF  ++  VN G  L  V++GAP      S   L  VG V+L  + +           GE  Y  FG A+A LGD+D +G  +  VG P    ++ G +YI+   +   +   P QV +S++ G      FG A+    DV+ NG PD  V + G+ K  ++   P         +EP    IIN +S + K   Q+ + + +  +     + ++ KG     L++TEL     NL+LQ
Sbjct:  246 PSYDDSYLGYSVTVGEFTGDNQQDFVTGVPKGFRTLGYVGILDGENMTSLYNFSGEQMASYFGFSVAVTDVN-GDKLEDVLVGAPLFMDRGSDGKLREVGRVYLFLQERTLSFREPQRFTGEEMYSRFGSALAPLGDVDQDGFNDVAVGIPFGGENRQGLVYIYNGDKDG-LKPAPSQVLESQWPGTSMPSSFGYALRGTVDVDKNGYPDLVVGAFGASKAIVYRARPVVTVEAELQLEPQ---IINLESKDCK---QAGSTSSFACFTVNYCVQVVGKG----ALSSTEL-----NLELQ 529          
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 69.3218 bits (168), Expect = 3.322e-12
Identity = 48/149 (32.21%), Postives = 78/149 (52.35%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLYA-VVIGAPY---QSKQNLVNVGAVFL----ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQ 1454
            +G ++   +L G+ +  +++GAPY   QSK+++     V+L        +   V     A   FG  IA +GD+D +G ++  VGAP    ++ G++YI+    S  +  KP QV+ +   GFG ++S G DV+ N  PD  V SL  Q
Sbjct:  258 YGYAVCLADLNGDGWMDLLVGAPYFFDQSKKSVGGAVYVYLNDNDGGGERKKRVRLEGTAGSGFGLTIAAIGDVDLDGFQDVAVGAP---FEESGRVYIYSGGPS-GVITKPAQVWHASQPGFGYSLSGGLDVDGNLYPDLLVGSLSDQ 402          
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 65.0846 bits (157), Expect = 7.811e-11
Identity = 59/216 (27.31%), Postives = 96/216 (44.44%), Query Frame = 3
Query:  894 GYSVA---FSGDGSQYASSPVDNGD--FPYVTRVNGEKFRP----TDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPY----QSKQNLVNVGAVFLACKGKP-----TDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            GYSVA   F+GD  Q   + V  G   F YV  +N          T  +   Y G+  ++  VN  G L  +++GAP      S+  L  +G V+L  +  P        + G + Y  +G AI  +GD+D +G  +  VG P    D  G ++++   ++  +   P Q  + ++        FG A+  G D++ NG PD  V + G  K  ++
Sbjct:   35 GYSVAVGEFTGDSVQEFVTGVPKGSSTFGYVLILNTTDMSTLMNVTGEQLASYFGYTVAVTDVNNDG-LDDLLVGAPLYMERGSQGRLEELGRVYLYLQQAPLSLGAAQTLSGRDVYGRYGSAITPVGDLDQDGYNDVAVGMPFGGEDGTGVVFVYNGRDT-GLMAIPSQTLRGRWASQGLPASFGFALRGGTDLDSNGYPDLIVGAFGVDKAIVY 248          
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001557.1 (pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-1 gene:ENSPMAG00000001371.1 transcript:ENSPMAT00000001557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 5.139e-9
Identity = 47/157 (29.94%), Postives = 80/157 (50.96%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGN-LYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVI-----YGENAYD-NFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVY----QSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            FG+++  V+L  + L  +++GAP  S     + G V +       D++      G NAY+ +FG  IA LGDID +G  +  VGAP    ++ G +YI+  +++    K   +++    +S  + FG +IS   D++ NG PD  + +  S    LF
Sbjct:  243 FGSALCAVDLNSDGLSDLLVGAPTHSASR--DEGRVHVYVNHGNGDLVEQEPLVGLNAYNAHFGAVIAALGDIDDDGFPDVAVGAP--QEEEFGAVYIYHGSQNGITHKHSQRIFGKSIESGISMFGQSISGQVDLDGNGYPDVVIGAFTSDVAVLF 395          
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 56.6102 bits (135), Expect = 3.340e-8
Identity = 46/155 (29.68%), Postives = 75/155 (48.39%), Query Frame = 3
Query: 1029 GFGTSMDTVNLGGNLYAVVIGAP--YQSKQNLVNVGAVFLACKG--KPTDVIYGENAYDN-FGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            G+  ++  +N  G L  +V+GAP  +  ++++     V++  +G     + I      D+ FG A+A +GDI+ +G E+  VGAP    D  GK++I+       I  K  QV       FG +I+ G DV+ N  PD  + SL  +   L   P
Sbjct:  318 GYDVTLADLNNDGWL-DLVVGAPQYFDRREDIGGAVYVYMNQRGGFDEHNFIRLNGTKDSMFGLAVANIGDINQDGFEDIAVGAP---YDGSGKVFIYHGGR-MGINPKASQVIVRTVEKFGYSITGGMDVDGNTYPDLLIGSLSDKIALLRARP 467          

HSP 2 Score: 51.2174 bits (121), Expect = 1.278e-6
Identity = 50/179 (27.93%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  957 DFPYVT---RVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSL---NLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSL--GSQKPFLF 1469
            D PY T   R   EK  P    +  Y GF        +  N  + V GAP  +    V V          P   IYGE    +FGY +  L D++++G  + VVGAP       D  G +Y++            +++  +K + FG+A++   D+N +G  D  V +   GS K F++
Sbjct:  236 DGPYETGDERWKNEKLVPVAYNS--YLGFSMDSGKSVMARNRLSFVAGAPRANHTGAVVVLKKDSLSSLTPEQTIYGEELASSFGYDVT-LADLNNDGWLDLVVGAPQYFDRREDIGGAVYVYMNQRGGFDEHNFIRLNGTKDSMFGLAVANIGDINQDGFEDIAVGAPYDGSGKVFIY 411          
BLAST of Alpha-int-2 vs. Ensembl Nematostella
Match: EDO48984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH6])

HSP 1 Score: 69.707 bits (169), Expect = 6.183e-12
Identity = 57/166 (34.34%), Postives = 83/166 (50.00%), Query Frame = 3
Query: 1017 QRYGGFGTSMDTVNLGGNLYA-VVIGAPYQSKQNLVNVGAVFLACKG---------KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFK-----KPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            Q   GFG S+  V++ G+ +  VVIGAP+ S +N  N G VF+             +    I  + AY  FG+A+A LGD+D +G E+F VGAP    +  G +YIF  +E+    K     KP  + Q   T FG +I+   D++ NG PD  + +  S    L 
Sbjct:  321 QPGSGFGFSVAGVDVNGDGWTDVVIGAPFYSTKNSPNEGRVFVYTNNGDGTFSKTRELAPSIARKGAY--FGHAVANLGDLDQDGYEDFAVGAPY--EEGTGVVYIFNGSETGVSQKAGQLIKPTDINQDLKT-FGSSIAGKLDMDGNGYPDLLIGAYTSDSVVLL 481          
BLAST of Alpha-int-2 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 67.0106 bits (162), Expect = 1.123e-10
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLY-AVVIGAP-YQSKQNLVNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            FG+S+   +L  + +  +++GAP Y  +QN +  GAV++      + +   T V+ G  AY  FG+A+A +GD++ +G ++F VGAP     + G++YI+  ++   I  K  Q+ + K      F  FG +I  G D++ N  PD  V SL  +   +   P
Sbjct:  300 FGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-GAVYIFMNENGSFQNVSTKVLKGP-AYSGFGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKK-GISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSLDDRIALIRARP 456          
BLAST of Alpha-int-2 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 66.6254 bits (161), Expect = 1.187e-10
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLY-AVVIGAP-YQSKQNLVNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            FG+S+   +L  + +  +++GAP Y  +QN +  GAV++      + +   T V+ G  AY  FG+A+A +GD++ +G ++F VGAP     + G++YI+  ++   I  K  Q+ + K      F  FG +I  G D++ N  PD  V SL  +   +   P
Sbjct:  300 FGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-GAVYIFMNENGSFQNVSTKVLKGP-AYSGFGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKK-GISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSLDDRIALIRARP 456          
BLAST of Alpha-int-2 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 66.6254 bits (161), Expect = 1.261e-10
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 3
Query: 1032 FGTSMDTVNLGGNLY-AVVIGAP-YQSKQNLVNVGAVFL------ACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMP 1478
            FG+S+   +L  + +  +++GAP Y  +QN +  GAV++      + +   T V+ G  AY  FG+A+A +GD++ +G ++F VGAP     + G++YI+  ++   I  K  Q+ + K      F  FG +I  G D++ N  PD  V SL  +   +   P
Sbjct:  300 FGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-GAVYIFMNENGSFQNVSTKVLKGP-AYSGFGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKKG-ISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSLDDRIALIRARP 456          
BLAST of Alpha-int-2 vs. Ensembl Medaka
Match: itga5 (integrin alpha-5-like [Source:NCBI gene;Acc:101158275])

HSP 1 Score: 66.2402 bits (160), Expect = 1.844e-10
Identity = 98/375 (26.13%), Postives = 156/375 (41.60%), Query Frame = 3
Query:  510 NLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLW---MDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVC-------DKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVE----------YSKIRDGP-ENKGTYFNY-----GYSVA---FSGDGSQYASSPVDNGDFPY--VTRVNGEKFRPTDLKTQ-RYGG------FGTSMDTVNLGGN-LYAVVIGAPY----QSKQNLVNVGAVFLACKGKPTDVIY------GENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGF------DVNFNGKPDFFVTSLGSQKPFLF 1469
            N  + ++D  S ++FG+ VRS     D +  + C PL+    + +   +   G C L++       K +EY  C       D    C GGFS D       V    G  F     +S   E          + +  DG  + K    ++     GYSVA   FSGD  +   + V  G   Y  V+ +NG     TDL T   Y G      FG ++ T ++  + +  +++GAP      S  +L  +G V++  +  P  +        G   Y  FG +IA LGD++ +G  +  +  P    D+ G +YIF    S  + +K  QV + ++    +  S GF      D++ NG PD  V + G  K  L+
Sbjct:  129 NETKHKIDFKSHQWFGATVRS---HGDTV--LACAPLYSWRTEKDTPRSDVTGTCYLSVQN---FTKFVEYAPCRTEISDADGQGYCQGGFSADFTMNGKVVLGGPGSYFWQGQVISAAKENIIRAYYPGYFMQAVDGQMQTKQGQSDHDDNYQGYSVAVGEFSGDEVEDFVTGVQKGRLLYGSVSILNG-----TDLTTMVEYTGEQMGSYFGYALATTDINNDGMTDLLVGAPMFIVRGSDGHLEEMGRVYVYLQRSPLKLELRLPHPTGTQMYGRFGSSIAALGDLNQDGFNDVAISCPFGGEDQKGLVYIFNGF-SEGLREKTSQVIKGQWAAGAVPPSFGFSLRGAKDLDMNGYPDLIVGAFGVDKAVLY 489          
BLAST of Alpha-int-2 vs. Ensembl Medaka
Match: itgav (integrin subunit alpha V [Source:NCBI gene;Acc:101174307])

HSP 1 Score: 61.6178 bits (148), Expect = 4.373e-9
Identity = 72/251 (28.69%), Postives = 104/251 (41.43%), Query Frame = 3
Query:  822 KLSNLVEYSKIR---DGPENKGTYFNYGYSVAF--------SGDGSQYASSPVDNGDFPYV-TRVNGEKF--RPTDLKTQRYGG----------FGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVG--AVFLACKG---KPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKF------TGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLF 1469
            K + +VEYS  R   + PE +G +   G+SV F         G GS Y    + + D   + TR N E F      L T+  G            G       LG   Y   +     S  NL  VG  +V+L   G   +P  ++ G   Y  +G AIA LGD++ +G  +  + AP    D+ G +YI     S      P QV Q K+        FG +++   D++ NG PD  V   G+ K  L+
Sbjct:  149 KGARIVEYSPCRSNANSPEGQG-FCQAGFSVDFLKNNKVVVGGPGSYYWQGQLISDDVSEIFTRFNTEYFISYTNTLATKSAGAQYDDSYLDYVTGVPRGEKALG---YVTPLFMDRGSDGNLREVGQVSVYLGKGGFSFRPAQMLTGVEVYARYGSAIAALGDLNRDGYNDVAISAPYGGTDRYGLVYI-HNGRSEGPNPSPSQVLQGKWASSYMPASFGYSMTGNTDIDQNGYPDLIVGVFGADKAILY 394          
BLAST of Alpha-int-2 vs. Planmine SMEST
Match: SMESG000021746.1 (SMESG000021746.1)

HSP 1 Score: 1967.2 bits (5095), Expect = 0.000e+0
Identity = 1032/1034 (99.81%), Postives = 1034/1034 (100.00%), Query Frame = 3
Query:  162 MFQLLLFYFLANGVLTDQIKNWIPNYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRXXXXXXXXXXXTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSXXXXXXXXXXXXXFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKGEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPXXXXXXXXXXXXXXXXXXXXXXXXFKRKRLRKERQKNRENATKNQDNADNAPLNSNC 3263
            MFQLLLFYFLANGVLTDQIKNWIPNYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRNNNVSNYNSVYTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSVDIIAIDDDVKIIFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILN+GEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSINDDDNVANNNFNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSIN+KNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPIIVAIIIGIFLLVIIIIIAYYCGFFKRKRLRKERQKNRENATKNQDNADNAPLNSNC
Sbjct:    1 MFQLLLFYFLANGVLTDQIKNWIPNYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRNNNVSNYNSVYTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSVDIIAIDDDVKIIFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNLGGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSKFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNQGEPRFKLNNTELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHASVLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSINDDDNVANNNFNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSINNKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPIIVAIIIGIFLLVIIIIIAYYCGFFKRKRLRKERQKNRENATKNQDNADNAPLNSNC 1034          
BLAST of Alpha-int-2 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 311.227 bits (796), Expect = 4.473e-89
Identity = 293/1075 (27.26%), Postives = 524/1075 (48.74%), Query Frame = 3
Query:  225 WIP-----------NYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRXXXXXXXXXXXTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCD----KFKKCLGGFSXXXXXXXXXX---XXXFGLPFE---NSTKLSNLVEYSKIRDGPENK-GTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNL-GGNLYAVVIGAPYQSKQNLVNVGAVFLAC-----KGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQS---KFTG-FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTW-----IEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILN--KGEPRFKLNNTELIED------------SYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSC---FLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKL--TAGRHASVLVKNL-IEAKDSVTISVDILYNDLE----IMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSI--NDKNGLVKY-CNVAKEMLNPLNVIAHDYKKSET-------------YRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSL--IKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANL-ELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPXXXXXXXXXXXXXXXXXXXXXXXXFKR-KRLRKERQK 3200
            WIP            Y   ++F++ Y   D  F  NF+       W SIA +++ +   + + F G+++ +  + ++ Y ++S  +ILC   +N+ S +   + C  L+      ++ +Y G+ V+++ L ++ I  +YCDPLW   +      NG+C L +  D   +       C      +  C+GGFSVD++++++ V   +++ G+P        K+ N      I   P N  G Y+N+GYSVA + +   Y SSP+ +   P VT +  E  + T      +  FG ++ T+++  G  YAVVIGAP+ S +++ NVG V++ C     +  P+D ++G+   + FGY +A +GDI+ +G+++  + +P L  D+  G + ++   E+C++ + P Q+ +S   K  G FGIAI+ G D++FNG PD  V+S  S    ++         C +     +E    ++ +  +  L +  +    N+Y +  +   + +L+  K     +LN  +LI +            S    +  L +V+DM+  +IP  I  + V  C+   N+ C       + W  C  II + +  C   F+  C ++++   ++D  GN + YG    Y RT+ + I N GP     I+  I    ++RI+ I  + +    L  T    A+  ++N  I+A + + I +D+ + D +    ++     +   ++S   D N+ NN   + Y  +++P + +S+ + ++  IDSR +   +    RV++  +G  LS +++I+N G   + N+ ++   P + + + YILYL DKIR     + ++   SI  +   G  KY C++  E +NPL +I  +  +S               +  KRSAN+  F N S + N        + L  + R  +  I+CN S   L  PICG++ C +  +P N +      AW++  TFF  +I  L V +T+  +   +PKG+  ++    + P    Q  +FN +K++     PLWPIIV I+IG  +L I+I+  Y CGFFKR KR R  R K
Sbjct:   20 WIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFE-------WQSIASTTLKSTNSSFVVFGGSKHISEDSTSAFY-RESSTVILCELKLNSTSTILDKVICSPLKAD----NNSRYLGATVKAISLSSNEIVIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIR-EDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFLKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITIEFDSATGISVTFTIMSLQNVKDMNL-TIPVTIGYRFVENCE---NRKCNNLLFPLINWEKCTTIIPIKKYICSNIFI--CNADIAA-ELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVN--QSQVGWMSIVPHAVVGTEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQ-PFINASANAN-------KMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVK-LRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSK 1063          
BLAST of Alpha-int-2 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 254.988 bits (650), Expect = 2.138e-69
Identity = 228/879 (25.94%), Postives = 428/879 (48.69%), Query Frame = 3
Query:  225 WIP-----------NYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRXXXXXXXXXXXTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCD----KFKKCLGGFSXXXXXXXXXX---XXXFGLPFE---NSTKLSNLVEYSKIRDGPENK-GTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNL-GGNLYAVVIGAPYQSKQNLVNVGAVFLAC-----KGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQS---KFTG-FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTW-----IEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILN--KGEPRFKLNNTELIED------------SYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSC---FLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKL--TAGRHASVLVKNL-IEAKDSVTISVDILYNDL----EIMSSKTSINFTIWSIXXXXXXXXXXXXMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSI--NDKNGLVKY-CNVAKEMLNPLNVIAHDYKKSE 2663
            WIP            Y   ++F++ Y   D  F  NF+       W SIA +++ +   + + F G+++ +  + ++ Y ++S  +ILC   +N+ S +   + C  L+      ++ +Y G+ V+++ L ++ I  +YCDPLW   +      NG+C L +  D   +       C      +  C+GGFSVD++++++ V   +++ G+P        K+ N      I   P N  G Y+N+GYSVA + +   Y SSP+ +   P VT +  E  + T      +  FG ++ T+++  G  YAVVIGAP+ S +++ NVG V++ C     +  P+D ++G+   + FGY +A +GDI+ +G+++  + +P L  D+  G + ++   E+C++ + P Q+ +S   K  G FGIAI+ G D++FNG PD  V+S  S    ++         C +     +E    ++ +  +  L +  +    N+Y +  +   + +L+  K     +LN  +LI +            S    +  L +V+DM+  +IP  I  + V  C+   N+ C       + W  C  II + +  C   F+  C ++++   ++D  GN + YG    Y RT+ + I N GP     I+  I    ++RI+ I  + +    L  T    A+  ++N  I+A + + I +D+ + D     +++     +   ++S   D N+ NN   + Y  +++P + +S+ + ++  IDSR +   +    RV++  +G  LS +++I+N G   + N+ ++   P + + + YILYL DKIR     + ++   SI  +   G  KY C++  E +NPL +I  +  +S 
Sbjct:   20 WIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFE-------WQSIASTTLKSTNSSFVVFGGSKHISEDSTSAFY-RESSTVILCELKLNSTSTILDKVICSPLKAD----NNSRYLGATVKAISLSSNEIVIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIR-EDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFLKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITIEFDSATGISVTFTIMSLQNVKDMNL-TIPVTIGYRFVENCE---NRKCNNLLFPLINWEKCTTIIPIKKYICSNIFI--CNADIAA-ELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVN--QSQVGWMSIVPHAVVGTEKYPCSLPSEFVNPLKIIGFETHESH 876          

HSP 2 Score: 70.8626 bits (172), Expect = 5.394e-12
Identity = 65/179 (36.31%), Postives = 95/179 (53.07%), Query Frame = 3
Query: 2676 KRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSL--IKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLE-LPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPXXXXXXXXXXXXXXXXXXXXXXXXFKR-KRLRKERQK 3200
            KRSAN+  F N S + N        + L  + R  +  I+CN S   L  PICG++ C +  +P N +      AW++  TFF  +I  L V +T+  +   +PKG+  ++    + P    Q  +FN +K++     PLWPIIV I+IG  +L I+I+  Y CGFFKR KR R  R K
Sbjct: 1056 KRSANQ-PFINASANAN-------KMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVK-LRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSK 1225          
BLAST of Alpha-int-2 vs. Planmine SMEST
Match: SMESG000022733.1 (SMESG000022733.1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.107e-14
Identity = 69/280 (24.64%), Postives = 123/280 (43.93%), Query Frame = 3
Query: 2268 MEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEIS---LPSINDKNGLVK-YCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWP 3092
            ++Y +     + +S +N +   +DSR     +  L RV  + LG     ++ I N GP  L+ + L    P+K    + ILY + +I    S    IS   LP I    G     C + ++ ++PLN+ A +    + YR+KRS   +    ++ S   +S S   V         ++ CN S    G+  C  + C +  +   SE   + +A  + +TFF  ++    + T++  N+     +  V  +  I P+  S NV+F  ++      LP+WP
Sbjct:  818 IDYFLRLAGFVHVSPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQAAFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQIISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIEKVVETKSNPVKSASI--VPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWP 1095          

HSP 2 Score: 52.373 bits (124), Expect = 2.082e-6
Identity = 55/220 (25.00%), Postives = 93/220 (42.27%), Query Frame = 3
Query: 1005 DLKTQRYGGFGTSMDTVNLGGN-LYAVVIGAP-----YQSKQNLVNVGAVFL-----ACKGKPT-----DVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK----------------------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFE 1550
            D+       FG S+   +  G+ +  +++GAP     + S + LV++GA+++     + K K T     DV+ G N    FG +IA LGDID +  ++F VG P+   D  G +YI+         K P+QV + +                      F  FG +++  FD++ N  PD  +    S +  +    N       W+E     +   +S E
Sbjct:  308 DMSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVLKGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGS-----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKN-----LIWLENPVWLLPTSKSIE 517          
The following BLAST results are available for this feature:
BLAST of Alpha-int-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA53.548e-1225.12integrin subunit alpha 5 [Source:HGNC Symbol;Acc:H... [more]
ITGA2B2.121e-1128.24integrin subunit alpha 2b [Source:HGNC Symbol;Acc:... [more]
ITGA2B2.848e-1128.24integrin subunit alpha 2b [Source:HGNC Symbol;Acc:... [more]
ITGAV1.042e-1026.75integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
ITGAV1.462e-1026.75integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ina-16.420e-1028.31Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot... [more]
pat-26.635e-726.83Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
if2.244e-830.30gene:FBgn0001250 transcript:FBtr0301352[more]
if2.536e-830.30gene:FBgn0001250 transcript:FBtr0074357[more]
if2.536e-830.30gene:FBgn0001250 transcript:FBtr0301354[more]
if2.536e-830.30gene:FBgn0001250 transcript:FBtr0301353[more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga87.681e-1130.05integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itga3a1.499e-1030.43integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-09080... [more]
itga82.723e-1030.05integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itga2b4.811e-1031.33integrin, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-05103... [more]
itga3b5.112e-1029.63integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-05041... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA51.866e-1425.00integrin subunit alpha 5 [Source:NCBI gene;Acc:100... [more]
pycr11.015e-1128.70pyrroline-5-carboxylate reductase family, member 1... [more]
ITGA34.081e-1120.03integrin subunit alpha 3 [Source:NCBI gene;Acc:100... [more]
selenbp11.039e-1036.54selenium binding protein 1 [Source:Xenbase;Acc:XB-... [more]
selenbp11.068e-1036.54selenium binding protein 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itga51.956e-1224.88integrin alpha 5 (fibronectin receptor alpha) [Sou... [more]
Itga2b7.491e-1229.94integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601... [more]
Itgav7.576e-1126.84integrin alpha V [Source:MGI Symbol;Acc:MGI:96608][more]
Itga83.227e-1027.83integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442... [more]
Itga74.475e-1031.25integrin alpha 7 [Source:MGI Symbol;Acc:MGI:102700... [more]
back to top
BLAST of Alpha-int-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11688|ITA5_MOUSE1.368e-1124.88Integrin alpha-5 OS=Mus musculus OX=10090 GN=Itga5... [more]
sp|Q06274|ITA5_XENLA1.390e-1129.00Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga... [more]
sp|P08648|ITA5_HUMAN1.704e-1125.12Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 ... [more]
sp|Q9QUM0|ITA2B_MOUSE5.240e-1129.94Integrin alpha-IIb OS=Mus musculus OX=10090 GN=Itg... [more]
sp|P08514|ITA2B_HUMAN1.019e-1028.24Integrin alpha-IIb OS=Homo sapiens OX=9606 GN=ITGA... [more]
back to top
BLAST of Alpha-int-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8CUZ00.000e+099.86Alpha-int-2 (Fragment) OS=Schmidtea mediterranea O... [more]
A0A1P8CUU51.948e-6928.23Alpha-int-4 (Fragment) OS=Schmidtea mediterranea O... [more]
A0A564XVQ45.545e-5023.67Integrin_alpha2 domain-containing protein OS=Hymen... [more]
A0A158R9S21.002e-4323.33Integrin_alpha2 domain-containing protein OS=Taeni... [more]
A0A0R3SC978.443e-4224.11Integrin_alpha2 domain-containing protein OS=Hymen... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3a2.498e-1229.44integrin alpha-3 [Source:NCBI gene;Acc:103032002][more]
itga3a2.888e-1229.44integrin alpha-3 [Source:NCBI gene;Acc:103032002][more]
itga82.203e-1029.95integrin subunit alpha 8 [Source:NCBI gene;Acc:103... [more]
itga3b1.849e-930.06integrin alpha-3-like [Source:NCBI gene;Acc:103040... [more]
itgav5.249e-924.71integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga89.251e-1528.24integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
ITGA63.322e-1232.21integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
itga87.811e-1127.31integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
ENSPMAT00000001557.15.139e-929.94pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-... [more]
ITGA63.340e-829.68integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-int-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489846.183e-1234.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-int-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3b1.123e-1030.67integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga3b1.187e-1030.67integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga3b1.261e-1030.67integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga51.844e-1026.13integrin alpha-5-like [Source:NCBI gene;Acc:101158... [more]
itgav4.373e-928.69integrin subunit alpha V [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Alpha-int-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000021746.10.000e+099.81SMESG000021746.1[more]
SMESG000018926.14.473e-8927.26SMESG000018926.1[more]
SMESG000018926.12.138e-6925.94SMESG000018926.1[more]
SMESG000022733.12.107e-1424.64SMESG000022733.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018435 ID=SMED30018435|Name=Alpha-int-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3343bp
TTTCAAGCTTCAAAAATAGACAACCAATCATAAATAAATGACGTCATCGT
TTACAAACATCGTTATGACTCATTAGGTTAAGTTAAATGTAATTTTAACA
TACATTTCAGCATGTGCATTTTTGAAATATGAAATCTTTGTGAAATTTTG
GATTTTCTGTAATGTTTCAGCTGTTACTTTTCTATTTTCTAGCGAACGGA
GTATTAACCGATCAGATTAAGAATTGGATTCCCAATTATGAAAACGAAAA
TACCTTCAATGAACCTTATGATTTTGTCGATGATAAATTTCTACCAAATT
TTCAAAATTTCGGAAGTGGTTATGACTGGATCAGTATTGCTGGATCGTCT
ATAATAAATCAAAAGCAAGCTCATATAGCTTTTACAGGCACAAGAAATAA
CAACGTCTCAAATTATAATTCTGTTTATACAAAACAATCTGGAATAATTA
TTCTATGCTCGAGCAATATAAATAATGCTAGCCCCTTAGGATTTGATCTC
AAATGCAAAAATTTAGAAGAGCAAAGATTAGATTCTAGTAGTGGAAAATA
TTTTGGATCTGTTGTAAGATCTGTGAAATTAAAAAATGATGCAATTGCAT
TTATATATTGTGATCCTTTATGGATGGATAATAATTTAAATTTGAATATA
TCAAATGGACAATGTAAACTTACAATTGTCAAAGACTCTTTGATTGAAAA
GACCATTGAATATCCTGTCTGTGATAAGTTTAAAAAATGTTTAGGTGGTT
TTTCTGTAGATATTATTGCTATTGATGATGATGTGAAAATTATTTTTGGA
CTTCCATTTGAAAATTCTACCAAATTGTCAAATCTTGTGGAATATTCCAA
AATTAGGGATGGTCCTGAAAATAAAGGTACATATTTTAACTATGGATATT
CAGTTGCATTTTCTGGAGATGGCTCACAATATGCATCTTCTCCAGTAGAT
AACGGGGATTTCCCATACGTAACAAGGGTAAATGGCGAAAAATTTAGACC
AACAGATTTAAAGACACAGCGTTATGGAGGCTTTGGTACGAGTATGGATA
CTGTAAATTTAGGAGGCAATTTGTATGCGGTTGTTATTGGTGCTCCTTAT
CAAAGTAAACAAAATTTAGTTAATGTGGGTGCCGTGTTTTTAGCATGCAA
AGGAAAACCTACTGATGTTATATATGGTGAAAATGCTTATGATAATTTTG
GATATGCTATTGCCCGTCTAGGGGATATCGATTCTAATGGTTCTGAAGAA
TTTGTTGTTGGAGCTCCAAGTCTCAACCTTGATAAACCAGGGAAAATTTA
CATATTTAAAACAACTGAAAGTTGTCAAATATTCAAAAAACCATTGCAAG
TATATCAAAGTAAATTTACTGGTTTTGGTATAGCTATATCTAGAGGATTT
GACGTTAATTTTAACGGGAAACCAGATTTTTTCGTTACTTCTCTAGGATC
ACAAAAACCATTTTTATTTGTTATGCCAAATCAAGAAAAAGTAACTTGCA
CTTGGATTGAACCAAGTACTGGTTTTATTATTAACGAACAATCTTTTGAA
CTGAAAGTATTATTTCAGTCTTCCAATTTGAATGAATATCAAAACTATGG
TTATCAAGTCGCAATCGATATTTTAAATAAAGGTGAACCTCGTTTCAAAT
TGAATAATACCGAGCTAATAGAGGACAGCTACAATTTAAAGCTTCAACCG
TTATTGGATGTGCAAGATATGGATTTTAAAAGTATTCCTTTTAAAATCGC
TTTAAAGGGTGTTCGAAAATGTAAAATCTCTGGTAATAAGGATTGTTATC
TTTCGAAAACTTCTCAAGTAGAATGGAATCATTGTGAAAAAATTATTAAA
TTACCCCAACAATCTTGTTTTTTAAGGAATTGTAAGTCGGAATTGAGTAT
AAATAGTGTAATTGATACAAAAGGTAACATAATTTATTATGGGGATCGAA
CCGATTATCTACGAACAATAAGGATTGTTATTTCTAATAATGGTCCTGAT
TCTTTGCATAGAATCTCTATGTCAATTGCTATGAATCCTGATATTCGCAT
TGACAATATCAAATGCTCAACTACTTGCAAAACCAAACTTACAGCCGGTA
GACATGCCAGTGTACTCGTGAAAAATCTAATTGAAGCGAAAGATAGTGTT
ACAATTTCTGTTGACATACTTTATAATGACCTGGAAATTATGAGCAGTAA
AACTTCTATTAATTTTACAATTTGGAGTATCAATGATGACGATAATGTGG
CAAACAATAACTTCAATATGGAGTACAAGGTTTTATTCAAACCCAAATTA
ATGATTTCATCAAAAAATACCAAAGAAAATAACATTGATTCCAGAATAAA
ACCGCCTTATTTGGAAAAACTACATCGTGTTTCGGTTCAAGATCTTGGAA
CGGAATTGAGTTATTCTTATTTGATAGAAAACAAAGGTCCCGAATTGAAA
AACGTTACATTAAAATTTCTCTTCCCTTACAAAATCCAACCTGATAAATA
CATTTTGTATCTCATGGATAAAATTCGATTGTCAACAAGCGTAAAAGAAG
AAATTTCACTGCCTTCAATTAATGACAAGAATGGATTAGTGAAGTATTGT
AATGTCGCAAAGGAAATGTTGAATCCGTTAAATGTAATTGCTCATGATTA
TAAAAAATCCGAAACATATCGGTCAAAGCGAAGTGCCAACGAATTGAATT
TTTCTAATAAGTCAGTTAGTCAAAATGATCGATCTCAATCTGAAGGAAAC
GTTGCCTTATCCTCCCTTGGTCGAACTTCATTAATTAAATGTAATGAATC
AAATCCGAATCTTGGAGCTCCTATTTGCGGAGAAGTTATATGTCGTTTAG
ATGTCATTCCGAATAATAGCGAATTTAATTTTGATTTTCGAGCCTGGGTT
TTTACCAAAACCTTCTTTGATGCCCGTATTCCTCATTTAACTGTTATGAC
CACGTTACAAGCGAATTTAGAACTACCTAAAGGATTATCAGTCGTAAAAG
AAAACCAAATTATAGGTCCCATTTTTGCATCCCAAAATGTGTTATTTAAT
AAAATGAAAGTTGATGAAGATAAGCCTTTGCCTCTGTGGCCAATTATTGT
AGCTATAATTATTGGGATATTTCTTCTCGTTATCATAATTATAATAGCTT
ATTATTGTGGGTTTTTCAAGAGGAAACGATTAAGGAAAGAGAGACAAAAA
AATCGAGAAAATGCAACTAAAAACCAAGATAATGCCGATAATGCCCCTTT
GAATAGTAACTGTTAATTTGTTTAGCTTATTTTTATAAATTTGTATCCAA
TCTTTATAAATTATAAATATATTTATTTTTGATTTAAAAAAAA
back to top

protein sequence of SMED30018435-orf-1

>SMED30018435-orf-1 ID=SMED30018435-orf-1|Name=SMED30018435-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1035bp
MFQLLLFYFLANGVLTDQIKNWIPNYENENTFNEPYDFVDDKFLPNFQNF
GSGYDWISIAGSSIINQKQAHIAFTGTRNNNVSNYNSVYTKQSGIIILCS
SNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYC
DPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCDKFKKCLGGFSVD
IIAIDDDVKIIFGLPFENSTKLSNLVEYSKIRDGPENKGTYFNYGYSVAF
SGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNL
GGNLYAVVIGAPYQSKQNLVNVGAVFLACKGKPTDVIYGENAYDNFGYAI
ARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQS
KFTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIE
PSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNKGEPRFKLNNT
ELIEDSYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKT
SQVEWNHCEKIIKLPQQSCFLRNCKSELSINSVIDTKGNIIYYGDRTDYL
RTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKLTAGRHAS
VLVKNLIEAKDSVTISVDILYNDLEIMSSKTSINFTIWSINDDDNVANNN
FNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELS
YSYLIENKGPELKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISL
PSINDKNGLVKYCNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNK
SVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIP
NNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQI
IGPIFASQNVLFNKMKVDEDKPLPLWPIIVAIIIGIFLLVIIIIIAYYCG
FFKRKRLRKERQKNRENATKNQDNADNAPLNSNC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028994Integrin_alpha_N
IPR000413Integrin_alpha
IPR013519Int_alpha_beta-p
IPR013649Integrin_alpha-2
IPR032695Integrin_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0008305integrin complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007229integrin-mediated signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000413Integrin alpha chainPRINTSPR01185INTEGRINAcoord: 306..317
score: 32.32
coord: 404..428
score: 30.24
coord: 985..1004
score: 46.22
IPR013519Integrin alpha beta-propellorSMARTSM00191int_alpha_rptcoord: 342..395
e-value: 3.7E-6
score: 36.5
coord: 287..336
e-value: 29.0
score: 8.1
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 332..391
score: 9.259
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 277..327
score: 6.355
NoneNo IPR availableGENE3DG3DSA:2.60.40.1530coord: 723..955
e-value: 1.2E-17
score: 66.2
NoneNo IPR availableGENE3DG3DSA:1.20.5.930coord: 966..1017
e-value: 1.7E-13
score: 51.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1013..1034
NoneNo IPR availablePANTHERPTHR23220INTEGRIN ALPHAcoord: 91..1017
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.805
NoneNo IPR availableSUPERFAMILYSSF69318Integrin alpha N-terminal domaincoord: 89..436
NoneNo IPR availableTMHMMTMhelixcoord: 979..1001
IPR028994Integrin alpha, N-terminalGENE3DG3DSA:2.130.10.130coord: 61..438
e-value: 2.5E-33
score: 117.9
IPR013649Integrin alpha-2PFAMPF08441Integrin_alpha2coord: 513..864
e-value: 2.9E-16
score: 59.4
IPR032695Integrin domain superfamilySUPERFAMILYSSF69179Integrin domainscoord: 739..978