E3 SUMO protein ligase PIAS2

Overview
NameE3 SUMO protein ligase PIAS2
Smed IDSMED30018434
Length (bp)3452
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 SUMO protein ligase PIAS2 (SMED30018434) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 SUMO protein ligase PIAS2 (SMED30018434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 SUMO protein ligase PIAS2 (SMED30018434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 SUMO protein ligase PIAS2 (SMED30018434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018434

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018434SMESG000023854.1 SmedASXL_015893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018434SMESG000023854.1 SmedASXL_015893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30018434SMESG000023854.1 dd_Smed_v4_7152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018434SMESG000023854.1 dd_Smed_v4_7152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018434SMESG000023854.1 Contig40470uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018434SMESG000023854.1 Contig40470newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 117.857 bits (294), Expect = 1.991e-26
Identity = 106/375 (28.27%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQL-NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT  +  + +   +    F L+      I   R  L   +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + +++S V     S   +    K+ V +++      SD+EE+   K
Sbjct:  157 LDVLI-KPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 117.087 bits (292), Expect = 2.113e-26
Identity = 95/331 (28.70%), Postives = 146/331 (44.11%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
              +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + +++S V     S   +    K+ V +++      SD+EE+   K
Sbjct:  200 GGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Match: PIAS2 (protein inhibitor of activated STAT 2 [Source:HGNC Symbol;Acc:HGNC:17311])

HSP 1 Score: 115.931 bits (289), Expect = 3.827e-26
Identity = 106/375 (28.27%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQL-NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT  +  + +   +    F L+      I   R  L   +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + +++S V     S   +    K+ V +++      SD+EE+   K
Sbjct:  186 LDVLI-KPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAK 516          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:HGNC Symbol;Acc:HGNC:2752])

HSP 1 Score: 116.701 bits (291), Expect = 5.037e-26
Identity = 86/286 (30.07%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDN 1715
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL   +   D  E+    DG++ P+    S++  Q +    + VD 
Sbjct:  189 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRNYSMAVYLVKQLSSTVLLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL---KYCTDCDEIQFKEDGTWAPM---RSKKEVQEVSASYNGVDG 434          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Match: PIAS3 (protein inhibitor of activated STAT 3 [Source:HGNC Symbol;Acc:HGNC:16861])

HSP 1 Score: 116.701 bits (291), Expect = 5.040e-26
Identity = 77/235 (32.77%), Postives = 107/235 (45.53%), Query Frame = 3
Query:  960 EYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
            +Y PP L + VN    PL   LP      E KR  RPINI+   + S+        TI VNW    G  + Y  +VYL R+L+   L  +   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQ FDA LYL MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+  K+
Sbjct:  205 DYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSAT----VPNTIVVNWSSEFG--RNYSLSVYLVRQLTAGTLLQKL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEVATTSLRVSLMCPL-------GKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCS---DCDEIQFMEDGSWCPMKPKK 412          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 95.9005 bits (237), Expect = 6.597e-20
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  990 VNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF-INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            V+++ V L +++P+N    E KR  RP+NI+     S+ +      T+ V W     V+      VY   +++   LF R   N + H  + ++                KK+S    ++  D   +              K+R+T P R   C HLQCFD   YLMMNE++  W+CPVC S+   + L VD++FL +L    KN   TEV +  DGSY
Sbjct:  247 VDDSVVQLPNVIPTNKTNAEPKRPSRPVNIT-----SNMNRYKKEHTVAVEWLADKRVWAA---GVYFVHRVNSDILFKRLNQNVSRHRSLEVT-----------KQEVIKKLSGGEDDIAMDRLNISLLDPLC-------KTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDMLAKVDKN--TTEVELKEDGSY 437          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 95.9005 bits (237), Expect = 6.658e-20
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  990 VNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF-INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            V+++ V L +++P+N    E KR  RP+NI+     S+ +      T+ V W     V+      VY   +++   LF R   N + H  + ++                KK+S    ++  D   +              K+R+T P R   C HLQCFD   YLMMNE++  W+CPVC S+   + L VD++FL +L    KN   TEV +  DGSY
Sbjct:  182 VDDSVVQLPNVIPTNKTNAEPKRPSRPVNIT-----SNMNRYKKEHTVAVEWLADKRVWAA---GVYFVHRVNSDILFKRLNQNVSRHRSLEVT-----------KQEVIKKLSGGEDDIAMDRLNISLLDPLC-------KTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDMLAKVDKN--TTEVELKEDGSY 372          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 95.9005 bits (237), Expect = 6.658e-20
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  990 VNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF-INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            V+++ V L +++P+N    E KR  RP+NI+     S+ +      T+ V W     V+      VY   +++   LF R   N + H  + ++                KK+S    ++  D   +              K+R+T P R   C HLQCFD   YLMMNE++  W+CPVC S+   + L VD++FL +L    KN   TEV +  DGSY
Sbjct:  182 VDDSVVQLPNVIPTNKTNAEPKRPSRPVNIT-----SNMNRYKKEHTVAVEWLADKRVWAA---GVYFVHRVNSDILFKRLNQNVSRHRSLEVT-----------KQEVIKKLSGGEDDIAMDRLNISLLDPLC-------KTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDMLAKVDKN--TTEVELKEDGSY 372          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 95.9005 bits (237), Expect = 6.665e-20
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  990 VNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF-INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            V+++ V L +++P+N    E KR  RP+NI+     S+ +      T+ V W     V+      VY   +++   LF R   N + H  + ++                KK+S    ++  D   +              K+R+T P R   C HLQCFD   YLMMNE++  W+CPVC S+   + L VD++FL +L    KN   TEV +  DGSY
Sbjct:  249 VDDSVVQLPNVIPTNKTNAEPKRPSRPVNIT-----SNMNRYKKEHTVAVEWLADKRVWAA---GVYFVHRVNSDILFKRLNQNVSRHRSLEVT-----------KQEVIKKLSGGEDDIAMDRLNISLLDPLC-------KTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDMLAKVDKN--TTEVELKEDGSY 439          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Match: gei-17 (E3 SUMO-protein ligase gei-17 [Source:UniProtKB/Swiss-Prot;Acc:Q94361])

HSP 1 Score: 95.9005 bits (237), Expect = 6.665e-20
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  990 VNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF-INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            V+++ V L +++P+N    E KR  RP+NI+     S+ +      T+ V W     V+      VY   +++   LF R   N + H  + ++                KK+S    ++  D   +              K+R+T P R   C HLQCFD   YLMMNE++  W+CPVC S+   + L VD++FL +L    KN   TEV +  DGSY
Sbjct:  249 VDDSVVQLPNVIPTNKTNAEPKRPSRPVNIT-----SNMNRYKKEHTVAVEWLADKRVWAA---GVYFVHRVNSDILFKRLNQNVSRHRSLEVT-----------KQEVIKKLSGGEDDIAMDRLNISLLDPLC-------KTRMTTPSRCQDCTHLQCFDLLSYLMMNEKKPTWQCPVCSSNCPYDRLIVDDYFLDMLAKVDKN--TTEVELKEDGSY 439          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0302505)

HSP 1 Score: 132.494 bits (332), Expect = 7.492e-32
Identity = 95/306 (31.05%), Postives = 144/306 (47.06%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            L  LI KP+  + + T+ + ++   FTL+      I ++R   N+ +     QV +RF +           E   +  +  PP + + VNN    L +++P+N    E KR PRP+N++  +K S         TI V W   P   + Y  AVYL +KL+ ++L  R   KT  V+ P  +T   I+EK +         D   E+      V  +          GK ++  P R   C HLQCFDA LYL MNER+  W CPVCD  A  + L +D +F ++L       D TE+ ++ DGS+
Sbjct:  136 LGTLI-KPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLV----------ETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPT----VTNTITVQW--CPDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVK-PADYTRGLIKEKLT--------EDADCEIATTMLKVSLNCPL-------GKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSW 406          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0088576)

HSP 1 Score: 132.109 bits (331), Expect = 8.903e-32
Identity = 95/306 (31.05%), Postives = 144/306 (47.06%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            L  LI KP+  + + T+ + ++   FTL+      I ++R   N+ +     QV +RF +           E   +  +  PP + + VNN    L +++P+N    E KR PRP+N++  +K S         TI V W   P   + Y  AVYL +KL+ ++L  R   KT  V+ P  +T   I+EK +         D   E+      V  +          GK ++  P R   C HLQCFDA LYL MNER+  W CPVCD  A  + L +D +F ++L       D TE+ ++ DGS+
Sbjct:  136 LGTLI-KPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLV----------ETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPT----VTNTITVQW--CPDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVK-PADYTRGLIKEKLT--------EDADCEIATTMLKVSLNCPL-------GKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSW 406          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0302506)

HSP 1 Score: 132.494 bits (332), Expect = 8.987e-32
Identity = 95/306 (31.05%), Postives = 144/306 (47.06%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            L  LI KP+  + + T+ + ++   FTL+      I ++R   N+ +     QV +RF +           E   +  +  PP + + VNN    L +++P+N    E KR PRP+N++  +K S         TI V W   P   + Y  AVYL +KL+ ++L  R   KT  V+ P  +T   I+EK +         D   E+      V  +          GK ++  P R   C HLQCFDA LYL MNER+  W CPVCD  A  + L +D +F ++L       D TE+ ++ DGS+
Sbjct:  147 LGTLI-KPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLV----------ETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPT----VTNTITVQW--CPDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVK-PADYTRGLIKEKLT--------EDADCEIATTMLKVSLNCPL-------GKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSW 417          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0302507)

HSP 1 Score: 132.88 bits (333), Expect = 9.498e-32
Identity = 95/306 (31.05%), Postives = 144/306 (47.06%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            L  LI KP+  + + T+ + ++   FTL+      I ++R   N+ +     QV +RF +           E   +  +  PP + + VNN    L +++P+N    E KR PRP+N++  +K S         TI V W   P   + Y  AVYL +KL+ ++L  R   KT  V+ P  +T   I+EK +         D   E+      V  +          GK ++  P R   C HLQCFDA LYL MNER+  W CPVCD  A  + L +D +F ++L       D TE+ ++ DGS+
Sbjct:  183 LGTLI-KPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLV----------ETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPT----VTNTITVQWC--PDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVK-PADYTRGLIKEKLT--------EDADCEIATTMLKVSLNCPL-------GKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSW 453          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Match: Su(var)2-10 (gene:FBgn0003612 transcript:FBtr0088574)

HSP 1 Score: 132.109 bits (331), Expect = 1.021e-31
Identity = 95/306 (31.05%), Postives = 144/306 (47.06%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSY 1643
            L  LI KP+  + + T+ + ++   FTL+      I ++R   N+ +     QV +RF +           E   +  +  PP + + VNN    L +++P+N    E KR PRP+N++  +K S         TI V W   P   + Y  AVYL +KL+ ++L  R   KT  V+ P  +T   I+EK +         D   E+      V  +          GK ++  P R   C HLQCFDA LYL MNER+  W CPVCD  A  + L +D +F ++L       D TE+ ++ DGS+
Sbjct:  147 LGTLI-KPSTLVPRNTQRVQEVPFYFTLTPQQATEIASNRDIRNSSKVEHAIQVQLRFCLV----------ETSCDQEDCFPPNVNVKVNNKLCQLPNVIPTNRPNVEPKRPPRPVNVTSNVKLSPT----VTNTITVQW--CPDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVK-PADYTRGLIKEKLT--------EDADCEIATTMLKVSLNCPL-------GKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWNCPVCDKPAIYDNLVIDGYFQEVLGSSLLKSDDTEIQLHQDGSW 417          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Match: pias2 (protein inhibitor of activated STAT, 2 [Source:ZFIN;Acc:ZDB-GENE-060424-1])

HSP 1 Score: 120.168 bits (300), Expect = 2.049e-27
Identity = 88/291 (30.24%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I V W   P + + Y  +VYL R+L+   L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  AT   L +D  F++IL D     D+ E+    DG++ P+  K  +E  +     IS +D S
Sbjct:  190 GGRRDYMVQIQLRFCLAETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEQKRPGRPLNITSLVRLSSA----VPNQIVVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--RMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKATYESLIIDGLFMEILNDC---TDVDEIQFQEDGTWCPMRPK--KETLKLSSPCISKIDCS 437          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Match: pias2 (protein inhibitor of activated STAT, 2 [Source:ZFIN;Acc:ZDB-GENE-060424-1])

HSP 1 Score: 119.783 bits (299), Expect = 2.541e-27
Identity = 88/291 (30.24%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I V W   P + + Y  +VYL R+L+   L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  AT   L +D  F++IL D     D+ E+    DG++ P+  K  +E  +     IS +D S
Sbjct:  190 GGRRDYMVQIQLRFCLAETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEQKRPGRPLNITSLVRLSSA----VPNQIVVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--RMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKATYESLIIDGLFMEILNDC---TDVDEIQFQEDGTWCPMRPK--KETLKLSSPCISKIDCS 437          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Match: pias2 (protein inhibitor of activated STAT, 2 [Source:ZFIN;Acc:ZDB-GENE-060424-1])

HSP 1 Score: 119.783 bits (299), Expect = 2.804e-27
Identity = 88/291 (30.24%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I V W   P + + Y  +VYL R+L+   L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  AT   L +D  F++IL D     D+ E+    DG++ P+  K  +E  +     IS +D S
Sbjct:  199 GGRRDYMVQIQLRFCLAETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEQKRPGRPLNITSLVRLSSA----VPNQIVVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--RMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKATYESLIIDGLFMEILNDC---TDVDEIQFQEDGTWCPMRPK--KETLKLSSPCISKIDCS 446          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Match: pias2 (protein inhibitor of activated STAT, 2 [Source:ZFIN;Acc:ZDB-GENE-060424-1])

HSP 1 Score: 119.783 bits (299), Expect = 3.036e-27
Identity = 88/291 (30.24%), Postives = 129/291 (44.33%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I V W   P + + Y  +VYL R+L+   L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  AT   L +D  F++IL D     D+ E+    DG++ P+  K  +E  +     IS +D S
Sbjct:  199 GGRRDYMVQIQLRFCLAETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEQKRPGRPLNITSLVRLSSA----VPNQIVVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--RMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKATYESLIIDGLFMEILNDC---TDVDEIQFQEDGTWCPMRPK--KETLKLSSPCISKIDCS 446          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 115.931 bits (289), Expect = 5.508e-26
Identity = 86/287 (29.97%), Postives = 125/287 (43.55%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++LS + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+  P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+    S++  Q +    + +D  
Sbjct:  178 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLIRLSTT----VPNTIVVSW--TSEIGRSYSLAVYLVKQLSSTMLLQRLRGKG--IRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNSCL---DCDEIQFKEDGSWAPM---RSKKEVQEVSASYNGIDGG 424          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:NCBI gene;Acc:100144644])

HSP 1 Score: 118.627 bits (296), Expect = 9.690e-27
Identity = 92/296 (31.08%), Postives = 140/296 (47.30%), Query Frame = 3
Query:  789 KMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESRE 1673
            +    F L+    H I + R  L   +  +  QV +RF + + + P            +Y PP L + VN    PL   LP      E KR  RPINI+  ++ +S        TI VNW    G  + Y  +VYL ++L+   L  +   +   ++ P   +   I+EK +        +D  +E+        ++ L +SL+CP+GK R+T P R + C HLQCFDA LYL MNE++  W CPVCD  A  + L +D  F+ IL       D  E+    DGS+ P+  K+ ++
Sbjct:  154 EAHFNFALTPQQVHQILSSRDILPGAKCDYTVQVQLRFCLCETSCP----------QEDYFPPNLFVKVNQKLCPLPGYLPPTKNGAEPKRPNRPINITPLIRLTST----VPNTIVVNWSSEFG--RNYSLSVYLVKQLTSVTLLQKL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEI-------ATTSLRVSLMCPLGKMRLTVPCRAITCTHLQCFDAALYLQMNEKKPTWTCPVCDKKAPYDMLIIDGLFMDILNSC---TDCDEIQFMEDGSWCPMRPKKEKQ 412          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:NCBI gene;Acc:100144644])

HSP 1 Score: 118.627 bits (296), Expect = 9.776e-27
Identity = 92/291 (31.62%), Postives = 139/291 (47.77%), Query Frame = 3
Query:  804 FTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESRE 1673
            F L+    H I + R  L   +  +  QV +RF + + + P            +Y PP L + VN    PL   LP      E KR  RPINI+  ++ +S        TI VNW    G  + Y  +VYL ++L+   L  +   +   ++ P   +   I+EK +        +D  +E+        ++ L +SL+CP+GK R+T P R + C HLQCFDA LYL MNE++  W CPVCD  A  + L +D  F+ IL       D  E+    DGS+ P+  K+ ++
Sbjct:  159 FALTPQQVHQILSSRDILPGAKCDYTVQVQLRFCLCETSCP----------QEDYFPPNLFVKVNQKLCPLPGYLPPTKNGAEPKRPNRPINITPLIRLTST----VPNTIVVNWSSEFG--RNYSLSVYLVKQLTSVTLLQKL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEI-------ATTSLRVSLMCPLGKMRLTVPCRAITCTHLQCFDAALYLQMNEKKPTWTCPVCDKKAPYDMLIIDGLFMDILNSC---TDCDEIQFMEDGSWCPMRPKKEKQ 412          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:NCBI gene;Acc:100144644])

HSP 1 Score: 117.472 bits (293), Expect = 1.665e-26
Identity = 92/296 (31.08%), Postives = 140/296 (47.30%), Query Frame = 3
Query:  789 KMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESRE 1673
            +    F L+    H I + R  L   +  +  QV +RF + + + P            +Y PP L + VN    PL   LP      E KR  RPINI+  ++ +S        TI VNW    G  + Y  +VYL ++L+   L  +   +   ++ P   +   I+EK +        +D  +E+        ++ L +SL+CP+GK R+T P R + C HLQCFDA LYL MNE++  W CPVCD  A  + L +D  F+ IL       D  E+    DGS+ P+  K+ ++
Sbjct:  119 EAHFNFALTPQQVHQILSSRDILPGAKCDYTVQVQLRFCLCETSCP----------QEDYFPPNLFVKVNQKLCPLPGYLPPTKNGAEPKRPNRPINITPLIRLTST----VPNTIVVNWSSEFG--RNYSLSVYLVKQLTSVTLLQKL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEI-------ATTSLRVSLMCPLGKMRLTVPCRAITCTHLQCFDAALYLQMNEKKPTWTCPVCDKKAPYDMLIIDGLFMDILNSC---TDCDEIQFMEDGSWCPMRPKKEKQ 377          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:NCBI gene;Acc:100488714])

HSP 1 Score: 115.161 bits (287), Expect = 1.421e-25
Identity = 86/289 (29.76%), Postives = 129/289 (44.64%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKV 1724
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + +  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL+      D  E+    DGS+ P+    S++  Q +    + VD+  +
Sbjct:  188 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRNFSLAVYLVKQLSSAILLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRSLTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKCC---TDCDEIQFKEDGSWSPM---RSKKEVQEVTTSYNGVDSGCI 436          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Match: PIAS1 (protein inhibitor of activated STAT 1 [Source:NCBI gene;Acc:100488714])

HSP 1 Score: 114.775 bits (286), Expect = 1.600e-25
Identity = 86/289 (29.76%), Postives = 129/289 (44.64%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKV 1724
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + +  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL+      D  E+    DGS+ P+    S++  Q +    + VD+  +
Sbjct:  189 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRNFSLAVYLVKQLSSAILLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRSLTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKCC---TDCDEIQFKEDGSWSPM---RSKKEVQEVTTSYNGVDSGCI 437          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 118.242 bits (295), Expect = 7.439e-27
Identity = 106/375 (28.27%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQL-NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT  +  + +   +    F L+      I   R  L   +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + V++S V     S   +    K+ + +++      SD+EE+   K
Sbjct:  150 LDVLI-KPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAK 480          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Match: Pias3 (protein inhibitor of activated STAT 3 [Source:MGI Symbol;Acc:MGI:1913126])

HSP 1 Score: 115.931 bits (289), Expect = 9.483e-27
Identity = 77/235 (32.77%), Postives = 107/235 (45.53%), Query Frame = 3
Query:  960 EYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
            +Y PP L + VN    PL   LP      E KR  RPINI+   + S+        TI VNW    G  + Y  +VYL R+L+   L  +   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQ FDA LYL MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+  K+
Sbjct:  196 DYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSAT----VPNTIVVNWSSEFG--RNYSLSVYLVRQLTAGTLLQKL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEVATTSLRVSLMCPL-------GKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNSC---SDCDEIQFMEDGSWCPMKPKK 403          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 118.242 bits (295), Expect = 9.723e-27
Identity = 106/376 (28.19%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTT--RIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT ++VQ++  R   K  +        R +  +       +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + V++S V     S   +    K+ + +++      SD+EE+   K
Sbjct:  150 LDVLI-KPT-SLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAK 480          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Match: Pias1 (protein inhibitor of activated STAT 1 [Source:MGI Symbol;Acc:MGI:1913125])

HSP 1 Score: 118.242 bits (295), Expect = 1.195e-26
Identity = 87/286 (30.42%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDN 1715
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL   +   D  E+    DGS+ P+    S++  Q +    + VD 
Sbjct:  189 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRTYSMAVYLVKQLSSTVLLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL---KYCTDCDEIQFKEDGSWAPM---RSKKEVQEVTASYNGVDG 434          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Match: Pias2 (protein inhibitor of activated STAT 2 [Source:MGI Symbol;Acc:MGI:1096566])

HSP 1 Score: 117.857 bits (294), Expect = 1.219e-26
Identity = 106/376 (28.19%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTT--RIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT ++VQ++  R   K  +        R +  +       +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + V++S V     S   +    K+ + +++      SD+EE+   K
Sbjct:  157 LDVLI-KPT-SLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCS---DVDEIKFQEDGSWCPMRPK--KEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Match: sp|O88907|PIAS1_MOUSE (E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 8.360e-26
Identity = 87/286 (30.42%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDN 1715
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL   +   D  E+    DGS+ P+    S++  Q +    + VD 
Sbjct:  189 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRTYSMAVYLVKQLSSTVLLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL---KYCTDCDEIQFKEDGSWAPM---RSKKEVQEVTASYNGVDG 434          
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Match: sp|Q8C5D8|PIAS2_MOUSE (E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 8.525e-26
Identity = 106/376 (28.19%), Postives = 165/376 (43.88%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTT--RIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT ++VQ++  R   K  +        R +  +       +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + V++S V     S   +    K+ + +++      SD+EE+   K
Sbjct:  157 LDVLI-KPT-SLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCS---DVDEIKFQEDGSWCPMRPK--KEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Match: sp|Q6AZ28|PIAS2_RAT (E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 9.197e-26
Identity = 95/331 (28.70%), Postives = 146/331 (44.11%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
              +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + V++S V     S   +    K+ + +++      SD+EE+   K
Sbjct:  200 GGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Match: sp|O75928|PIAS2_HUMAN (E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3)

HSP 1 Score: 117.857 bits (294), Expect = 9.562e-26
Identity = 106/375 (28.27%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  729 LSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQL-NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLE------SDDEENNQVK 1820
            L +LI KPT  +  + +   +    F L+      I   R  L   +R +  QV +R  + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+++W    G  + Y  +VYL R+L+ + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  F++IL D     D+ E+    DGS+ P+  K  +E  +      + +++S V     S   +    K+ V +++      SD+EE+   K
Sbjct:  157 LDVLI-KPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSA----VPNQISISWASEIG--KNYSMSVYLVRQLTSAMLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDC---SDVDEIKFQEDGSWCPMRPK--KEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAK 487          
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Match: sp|O75925|PIAS1_HUMAN (E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 2.419e-25
Identity = 86/286 (30.07%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDN 1715
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++LS + L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL   +   D  E+    DG++ P+    S++  Q +    + VD 
Sbjct:  189 GTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TAEIGRNYSMAVYLVKQLSSTVLLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEIL---KYCTDCDEIQFKEDGTWAPM---RSKKEVQEVSASYNGVDG 434          
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Match: A0A0R3VTV7 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS701 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 7.766e-35
Identity = 160/548 (29.20%), Postives = 256/548 (46.72%), Query Frame = 3
Query:  105 KITIKNYILNSISQRELVELCGMFNIPLNGRRIQIQKRLIDSVLIATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINRNVNYQLNGYNQLP-MSGNLISSIYRICNENLDKCPINLRPEIVNG--------IDPSNIFI---PNYTKYPTGYFNAPSCSPSFVNGRVN---MPN--VQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLN-NKRFFKWQVLVRFGVYDPT------KPFPNSSE-NISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDES--TEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYV---PVAV 1658
            K  +K YI +S  ++ L  L  +  +P +G +  +  RL++ + +  + E + ++  M+    +R             S +P D  Q    NG +  EIN       +  N+ P M     ++  RI    L       +P + +G        +DP N       N     + +   PS + + VNG      MP+  V+LP C        S FY    V+ P +++ P  + N     RI  ++ L F +++     IT H  +L+ N+R F  QVL+RFG  +P+          +S E  ++   + +P +L +FVN     L  +LP+     +G+R+ RP+NI+  L+ S +        + ++W      + Y +FA+YL +K S  EL +       H   P       I  K ++      +   S   E  DDDDL I + LP+ LLCP+ K RI  P+RG  CQH+QC+DA  YL++NER+  WKCPVCDS A  +ELFVD   + IL   ++++D+ E+  N DGS+    PV V
Sbjct:    4 KTNLKEYI-HSCKRKTLESLLKIAGLPTSGLKDSLIVRLVNYIDVGPSDEFISEVNLMMQTAMSR------------FSLRPVD-IQAPALNGSSMPEINSGTQSNADNMNKQPLMRLQQNANSLRIPPMQLPHQQQLAQPNLRSGHIRPTGTPMDPQNWGTFGQNNCDSRKSTFLPEPSRANTQVNGGFTTLPMPDRVVRLPIC-PLLRFEESPFYKVLDVIIPPTIMTPS-SHNFTPGKRIYERL-LDFRINSDQAETITYHSHRLDGNRRDFGVQVLMRFGKLEPSVLSDVVASTSDSREPALAPFADSMPIHLNIFVNVKQASLPPLLPTCRPNMDGRRYARPVNITPLLRVSPS----VSNHVKLSWSHDYSTFSYNFFAIYLVQKHSTKELCEALRT---HAYRPAPVVQKQIVGKLASTVTSCGVGSGSGTVEESDDDDLQIQNTLPVQLLCPLSKCRIKLPVRGQRCQHIQCYDADTYLLINERKPAWKCPVCDSLAPFHELFVDGLLMDILA-ARESQDVEEIVFNEDGSWTTMRPVCV 526          
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Match: A0A0R3SHI3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4396 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.316e-33
Identity = 123/409 (30.07%), Postives = 198/409 (48.41%), Query Frame = 3
Query:  507 PINLRPEIVN-GIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPNVQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNI-VQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPT--KPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSK 1721
            P  + PE+ N GI PS++  P Y +   G  N    +P  V        V++PY   +   S + FY    V+ P +L+IP   P++   T +   +      L  +    IT H   + N+R F+ Q LVRFG  +P+       S   +    + +P +L + VN   V L   LP++    +G+R+ RPI+I+  L+       G    I ++W      + YY+FAVYL ++LS  EL D      +    P +F    I  K +++       ++  ++   + L +  + P+       K RI  P+RG  CQH+QC+DA  Y ++NER+  WKCPVCD  A  +ELFVD   ++IL+  +K+++  E+  N DGS+    +K S       G +  NV+NS+
Sbjct:  126 PPGIPPELNNWGIQPSDLSRP-YNR--QGTLNVTLPTPEGV--------VRVPY-FPDVRFSDTPFYEILDVIQPPTLIIP---PDVNFHTGKRPYERTYDIKLDANQSETITYHSYNVGNRREFRVQALVRFGKLEPSMLHRITASQPTLEPFQDNMPIHLAVQVNQRNVILPPFLPTSRPNMDGRRNARPISITPQLRMCP----GAVNLIKLSWSHDYTSFTYYFFAVYLVKRLSTKELCDFLKTNCYR---PGNFVRKQIIAKLASSGLPLNDGEDDDDIQIQNTLPVQLLCPL------SKCRINLPVRGKRCQHIQCYDADTYFIINERKPAWKCPVCDLLAPFDELFVDGLLMEILES-KKSQNAEEIVFNEDGSW--TTMKSSS-----CGGVNGNVENSR 498          
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Match: A0A068WE72 (E3 SUMO protein ligase PIAS2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000941500 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.859e-33
Identity = 153/534 (28.65%), Postives = 247/534 (46.25%), Query Frame = 3
Query:  105 KITIKNYILNSISQRELVELCGMFNIPLNGRRIQIQKRLIDSVLIATNTELLQQILFMINGTYNR----DNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINR---NVNYQLNGYNQLPMSGNLISSIYRICNENLDKCPINLRPEIVNGIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMP---NVQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLN-NKRFFKWQVLVRFGVYDPT-------KPFPNSSE-NISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISD-ESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYV 1646
            K ++K YI +S  ++ L  L     +P +G +  +  RL++ + +  + E + ++  M+  T +R      +   L  N     +    TQ  V N +N  ++ R   NVN       QLP    L     R  +  L   P+          DP N    +         N  + S     G + +P    V             S FY    V+ P +++ P    N     R   ++ L F +++     IT H  +L+ N+R F  QVL+RFG  +P+          P+SSE  ++   + +P +L +FVN     L  +LP+     +G+R+ RP+NI+  L+ S +        + ++W      + Y +FA+YL +K S  EL +    +TH  +  +      + +  ST       SD E  +  DDDDL I + LP+ LLCP+ K RI  P+RG  CQH+QC+DA  YL++NER+  WKCPVCDS A  +ELFVD   + IL   ++++D+ E+  N +GS+ 
Sbjct:    4 KTSLKEYI-HSCKRKTLESLLKTAGLPTSGLKDSLIVRLLNYIDVGPSDEFISKVNLMMQTTMSRYGLRPGDIQTLALNGASMPEITSGTQPNVDN-VNKQQLIRMQQNVNSLRIPSLQLPHQHQLAQPNLRSGHMRLTGPPM----------DPHNWITTSQNNREQSRANMQTNS-----GFITLPMPDGVLRLPLCPLLRFEESPFYKILDVIIPPTIMTPSAY-NFTPGKRTYERL-LDFRINSDQAETITYHSHRLDGNRRDFGVQVLMRFGKLEPSLLPEVVAASTPDSSEPALAPFADSMPIHLNIFVNVKQAMLPPLLPTCRPNMDGRRYARPVNITPLLRVSPS----VSNHVKLSWSHDYSTFSYNFFAIYLVQKHSTKELCEAL--RTHAYRPALVVQRQIVDKLASTVTSCGGGSDNEVMDESDDDDLQIQNTLPVQLLCPLSKCRIKLPVRGQRCQHIQCYDADTYLLINERKPAWKCPVCDSLAPFHELFVDGLLMDILAT-RESQDVEEIVFNENGSWT 511          
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Match: A0A068YA98 (E3 SUMO protein ligase PIAS2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000941500 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.778e-33
Identity = 150/549 (27.32%), Postives = 243/549 (44.26%), Query Frame = 3
Query:  105 KITIKNYILNSISQRELVELCGMFNIPLNGRRIQIQKRLIDSVLIATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINRNVNYQLNGYN-------------------QLPMSGNLISSIYRICNENLDKCPINLRPEIVNGIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPN-VQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLN-NKRFFKWQVLVRFGVYDPT-------KPFPNSSENI-SNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFST------NNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYV 1646
            K  +K YI +S  ++ L  L  +  +P +G +  +  RL++ + +  + E + ++  M+  T +R       G  Q          Q F  NG + +EI       ++  N                   QLP    L     R  +  L   P+          DP N    +         N  + +  F+   + MP+ V             S FY    V+ P +++ P    N     R   ++ L F +++     IT H  +L+ N+R F  QVL+RFG  +P+          P+SSE + +   + +P +L +FVN     L  +LP+     +G+R+ RP+NI+  L+ S A        + ++W      + Y +FA+YL +K S  EL +       H   P       I +K ++            + DES +    DDL I + LP+ LLCP+ K RI  P+RG  CQH+QC+DA  YL++NER+  WKCPVCDS A  +ELFVD   + IL   ++++D+ E+  N +GS+ 
Sbjct:    4 KTNLKEYI-HSCKRKTLESLLKIAGLPTSGLKDSLIVRLLNYIDVGPSDEFISKVNLMMQTTMSR------YGLRQ-------GDIQTFALNGASMSEITSGTQPNVDTVNKQQLIRMQQNANSLRIPPLQLPHQHQLAQPNLRSGHMRLTGPPM----------DPHNWITTSQNNREQSRANMQT-NGGFIT--LPMPDGVLRLPLCPLLRFEESPFYKILDVIIPPTIMTPSAY-NFTPGKRTYERL-LDFRINSDQAETITYHSHRLDGNRRDFGVQVLMRFGKLEPSLLPEVVAASTPDSSEPVLAPFADSMPIHLNIFVNVKQAMLPPLLPTCRPNMDGRRYARPVNITPLLRVSPA----VSNHVKLSWSHDYSTFSYNFFAIYLVQKHSTKELCEALRT---HAYRPAPVVQRQIVDKLASTVTSCGGGSGNGVVDESDD----DDLQIQNTLPVQLLCPLSKCRIKLPVRGQRCQHIQCYDADTYLLINERKPAWKCPVCDSPAPFHELFVDGLLMDILAT-RESQDVEEIVFNENGSWT 511          
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Match: A0A0X3PN85 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR123421 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.320e-32
Identity = 119/344 (34.59%), Postives = 172/344 (50.00%), Query Frame = 3
Query:  654 QLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTK---------PFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVA 1655
            ++P C      +SS F+    V+ P ++L P    N +   R   +  L   +S      IT H  +L++KR  F  QV++RF   DP                  ++S  P+  P +L L VN     L  +LP+     +G+R+ RP+NI+  L+ S A       T+ + W      Y Y+++AVYL RK S  EL +    + H  Q   S T   I EK ++       +  ST   +D DLVI + LP+ LLCP+ K RI  P+RG  CQH+QC+DA+ YL++NER+  WKCPVCD  A  +EL VD   L+IL D    E+L E+    D S+ PV 
Sbjct:  105 RIPTCPPGLSFTSSPFFKVIEVIRPPTILSPSEL-NFIPGKRPYERA-LNLRISIDQAEAITYHSQRLDDKRLDFGVQVIMRFAKLDPADLVNLRIGEPKQQQQQLSLSPQPDNFPIHLMLHVNGRPAQLPPLLPTTRPGLDGRRNARPVNITPLLRVSPA----VSNTVKLVWTHDYATYSYFFYAVYLARKRSTRELCEAL--RRHSFQT-ASVTKQKIIEKLAS-------TAASTNTMEDADLVIENTLPVQLLCPLSKCRIDLPVRGHNCQHIQCYDANTYLLINERKPAWKCPVCDVPAPFHELLVDGLMLEILADTM-TENLEEIVFKEDSSWSPVG 431          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Match: pias2 (protein inhibitor of activated STAT, 2 [Source:ZFIN;Acc:ZDB-GENE-060424-1])

HSP 1 Score: 120.553 bits (301), Expect = 1.159e-27
Identity = 84/273 (30.77%), Postives = 124/273 (45.42%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              +R +  Q+ +RF + + + P    +PNS              L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+V W   P + + Y  +VYL R+L+   L  R   +   ++ P   +   I+EK +        +D  +E+      V             GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  AT   L +D  F++IL D     D+ E+    DG++ P+  K+
Sbjct:  195 GGRRDYMVQIQLRFCLSETSCPQEDNYPNS--------------LCIKVNGKLFPLPGYAPPPKNGVEQKRPGRPLNITSLVRLSSA----VPNQISVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--RMKGIRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLMCPL-------GKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKATYESLIIDGLFMEILNDC---TDVDEIKFQEDGTWCPMRPKK 426          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 113.235 bits (282), Expect = 2.480e-25
Identity = 84/269 (31.23%), Postives = 119/269 (44.24%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL R+ S S L  R  +K   ++ P   +   I+EK +        +D  +E+      V             GK R+  P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DG++ P+  K+
Sbjct:  186 GTKCDFAVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSYSMAVYLVRQQSSSVLLQRLRSKG--IRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNSC---VDCDEIQFKEDGNWAPMRSKK 417          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 112.849 bits (281), Expect = 3.337e-25
Identity = 96/324 (29.63%), Postives = 144/324 (44.44%), Query Frame = 3
Query:  747 KPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
            KPT      ++   +    F L+      I+        K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++ + + L  R   +   ++ P   +   I+EK +        +D  +E+        ++ L +SLLCP+GK R+  P R V C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+    S++  Q +    + VD  
Sbjct:  141 KPTSLASDNSQRFQETCFAFALTPQQVQQISGSMDISGTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSYSMAVYLVKQQTSTALLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEI-------ATTSLRVSLLCPLGKMRLMIPCRAVTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNSCV---DCDEIQFKEDGSWAPM---RSKKEVQEVSASCNGVDGG 424          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Match: pias1b (protein inhibitor of activated STAT, 1b [Source:ZFIN;Acc:ZDB-GENE-050419-202])

HSP 1 Score: 113.235 bits (282), Expect = 3.555e-25
Identity = 84/269 (31.23%), Postives = 119/269 (44.24%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL R+ S S L  R  +K   ++ P   +   I+EK +        +D  +E+      V             GK R+  P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DG++ P+  K+
Sbjct:  183 GTKCDFAVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSYSMAVYLVRQQSSSVLLQRLRSKG--IRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNSCV---DCDEIQFKEDGNWAPMRSKK 414          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Match: pias1a (protein inhibitor of activated STAT, 1a [Source:ZFIN;Acc:ZDB-GENE-120727-5])

HSP 1 Score: 112.849 bits (281), Expect = 4.170e-25
Identity = 96/324 (29.63%), Postives = 144/324 (44.44%), Query Frame = 3
Query:  747 KPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
            KPT      ++   +    F L+      I+        K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++ + + L  R   +   ++ P   +   I+EK +        +D  +E+        ++ L +SLLCP+GK R+  P R V C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+    S++  Q +    + VD  
Sbjct:  155 KPTSLASDNSQRFQETCFAFALTPQQVQQISGSMDISGTKCDFTVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSYSMAVYLVKQQTSTALLQRL--RAKGIRNP-DHSRALIKEKLT--------ADPDSEI-------ATTSLRVSLLCPLGKMRLMIPCRAVTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILNSC---VDCDEIQFKEDGSWAPM---RSKKEVQEVSASCNGVDGG 438          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006097.1 (pep scaffold:Pmarinus_7.0:GL477570:42904:66158:-1 gene:ENSPMAG00000005462.1 transcript:ENSPMAT00000006097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 3.107e-27
Identity = 91/311 (29.26%), Postives = 137/311 (44.05%), Query Frame = 3
Query:  747 KPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF----INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
            KPT  +  + +   +    F L+      I++ R  L  +++ F  QV +RF +          SE      ++ P  L + VN    PL   LP      E KR  RPINI+ Y++ S          I V+W  T    + Y  +VYL ++L+ S L +R     I  + H +         I+EK +        +D  +E+      V             GK R+T P R + C HLQCFDA LY+ MNE++  W CPVCD  A  + L +D  F++IL       D+ E+    DGS+ P+  K+
Sbjct:  172 KPTSLVTSSNQRFQETYYVFALTPQQVAQISSSRDILPGQKYDFTVQVQLRFCL----------SETSCPQEDHFPANLCVKVNGKLCPLPGYLPPTKNGVEPKRPSRPINITAYVRLSPT----VPNHITVSW--TADFGRNYSISVYLVKQLTSSLLLNRMKAKGIRNSDHSRA-------LIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLTIPCRALTCTHLQCFDAALYIQMNEKKPTWVCPVCDKKAPYDSLIIDGLFMEILSSCT---DVDEIKFREDGSWSPMRPKK 441          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001340.1 (pep scaffold:Pmarinus_7.0:GL476352:326724:335624:-1 gene:ENSPMAG00000001204.1 transcript:ENSPMAT00000001340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 6.344e-21
Identity = 89/317 (28.08%), Postives = 139/317 (43.85%), Query Frame = 3
Query:  741 IPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRF----INKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVA-VKESRE 1673
            I KPT  +  +T+ M +    F L+      I++ R  L   R+ +  Q+ +RF +          SE      ++ P  + + VN    PL   LP      E KR  R +N++  ++ + +        I V+W    G  + Y  AV+L ++LS + L +R     I  + H +         I+EK +        +D  +E+      V             GK R++ P R + C HLQCFDA LYL MNE++  W CPVCD  A  + L +D  F++IL       D  E+    DG + P+   KES+E
Sbjct:  151 IMKPTGLVATSTQRMQEAYFVFPLTPQQVSQISSSRELLPGSRYDYSVQLQLRFCL----------SETSCPQEDHFPLNVCVKVNGKPCPLPGCLPPQKNGVEPKRSSRAVNMTSLVRLTPS----VPNHITVSWSTDFG--RSYSLAVHLVKQLSSAVLLNRLKAKGIRNSDHSRA-------LIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLSLPCRALTCTHLQCFDAALYLQMNEKKPTWVCPVCDKKAPYDGLIIDGLFVEILNSC---TDADEIQFRQDGLWSPMKPKKESKE 426          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Yeast
Match: NFI1 (SUMO E3 ligase; catalyzes sumoylation of Yku70p/80p and Sir4p promoting telomere anchoring to the nuclear envelope and regulating telomerase activity; DNA-bound form catalyzes a DNA-damaged triggered sumoylation wave resulting in multisite modification of several DNA repair proteins, enhancing interactions between these proteins and accelerating repair; sumoylates Cse4p, a prerequisite for STUbL-mediated Ub-dependent degradation; role in telomere length maintenance [Source:SGD;Acc:S000005682])

HSP 1 Score: 64.3142 bits (155), Expect = 8.040e-11
Identity = 27/80 (33.75%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1413 SRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPV 1652
            +R+  P +   C+H+QCFDA  +L    +   W+CP+C      ++L + EF   I+Q+   NED+ +V ++ DGS+ P+
Sbjct:  343 TRMKYPAKTDQCKHIQCFDALWFLHSQSQVPTWQCPICQHPIKFDQLKISEFVDNIIQNC--NEDVEQVEISVDGSWKPI 420          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Yeast
Match: SIZ1 (SUMO E3 ligase; promotes attachment of small ubiquitin-related modifier sumo (Smt3p) to primarily cytoplasmic proteins; regulates Rsp5p ubiquitin ligase activity and is in turn itself regulated by Rsp5p; required for sumoylation of septins and histone H3 variant Cse4p, a prerequisite for STUbL-mediated Ub-dependent degradation; localizes to the septin ring; acts as an adapter between E2, Ubc9p and substrates; tends to compensate for survival of DNA damage in absence of Nfi1p [Source:SGD;Acc:S000002817])

HSP 1 Score: 64.3142 bits (155), Expect = 9.160e-11
Identity = 29/80 (36.25%), Postives = 44/80 (55.00%), Query Frame = 3
Query: 1413 SRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPV 1652
            +R+  P + + C+HLQCFDA  +L    +   W+CPVC     L  L + EF   ILQ+ QKN  + +V +  DG +  +
Sbjct:  366 TRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKN--VEQVELTSDGKWTAI 443          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Nematostella
Match: EDO32140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX5])

HSP 1 Score: 92.4337 bits (228), Expect = 8.345e-20
Identity = 85/274 (31.02%), Postives = 122/274 (44.53%), Query Frame = 3
Query:  831 LITAHRSQLNNKRF-FKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVP 1649
            LIT  R    + R  F  Q+ +R  + +       S E   N P      L + VN     L   +P N A+ + KR  RP+NI++  + SS         I+V+W  TP   Q +   + L R ++ S L  R   K    + P   +   I+EK +         D  +E+      V             GKS++T P R V C HLQCFDA LYL MNE+++ W CPVCD  A    L +D  F +IL +   +   TE++   DGS+ P
Sbjct:  138 LITTSRDNRPHSRHDFTVQIQLRICLLE------TSCEQSDNFPSS----LCIKVNGKICSLPGYVPPN-ASVDHKRPGRPVNITNQCRLSST----VPNHIHVSW--TPRHGQRHVVVIRLVRLVTSSCLMQRL--KARGYRNP-DHSRALIKEKLA--------HDPDSEVATTSLRVTLLCPL-------GKSKMTLPCRSVTCSHLQCFDAALYLQMNEKKTTWICPVCDQKAEFKSLVLDGLFREILDN--TSGSCTEISFYEDGSWRP 374          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Nematostella
Match: EDO40709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6F2])

HSP 1 Score: 51.6026 bits (122), Expect = 3.015e-7
Identity = 21/37 (56.76%), Postives = 25/37 (67.57%), Query Frame = 3
Query: 1416 RITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVC 1526
            RI+ P RG  C+H+QCFD   YL +N  R  WKCPVC
Sbjct:  160 RISLPARGHDCKHIQCFDLESYLRLNCERGSWKCPVC 196          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Match: pias1b (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101160651])

HSP 1 Score: 116.701 bits (291), Expect = 2.758e-26
Identity = 95/327 (29.05%), Postives = 142/327 (43.43%), Query Frame = 3
Query:  747 KPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXLXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPV-AVKESREHKQHIGNIISNVDNSKV 1724
            KPT  +   T+   +    F L+      I++       K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + +  AVYL R+ S + L  R   K   ++ P   +   I+EK + + +  +I+  S  +     L              GK R+T P R   C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+ + KE +E       + S+V  ++ 
Sbjct:  139 KPTSLVSDNTQRFQEACYAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSFSMAVYLVRQQSSAVLLQRLRAKG--IRNP-DHSRALIKEKLTADPE-SEIATTSLRVSLLCPL--------------GKMRLTIPCRSATCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSSC---SDCDEIQFKEDGSWAPMRSKKEVQEVSASYNGVDSDVSRTEA 428          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Match: pias1b (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101160651])

HSP 1 Score: 116.316 bits (290), Expect = 3.218e-26
Identity = 94/324 (29.01%), Postives = 140/324 (43.21%), Query Frame = 3
Query:  747 KPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXLXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNS 1718
            KPT  +   T+   +    F L+      I++       K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + +  AVYL R+ S + L  R   K   ++ P   +   I+EK + + +  +I+  S  +     L              GK R+T P R   C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+    S++  Q +    + VD+ 
Sbjct:  148 KPTSLVSDNTQRFQEACYAFALTPQQVQQISSSMDISGTKCDFAVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCNLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRSFSMAVYLVRQQSSAVLLQRLRAKG--IRNP-DHSRALIKEKLTADPE-SEIATTSLRVSLLCPL--------------GKMRLTIPCRSATCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILSSC---SDCDEIQFKEDGSWAPM---RSKKEVQEVSASYNGVDSG 431          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Match: pias2 (E3 SUMO-protein ligase PIAS2 [Source:NCBI gene;Acc:101155036])

HSP 1 Score: 113.62 bits (283), Expect = 1.122e-25
Identity = 87/273 (31.87%), Postives = 130/273 (47.62%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+V W   P + + Y  +VYL R+L+   L  R   K   ++ P   +   I+EK +        +D  +E+        ++ L +SL+CP+GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  FL+IL D     D+ E+     G++ P+  K+
Sbjct:  109 GGRRDYLVQIQLRFCLSETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEPKRPGRPLNITSLVRLSSA----VPNQISVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEV-------ATTSLRVSLMCPLGKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKAAYENLIIDGLFLEILNDC---SDVDEIKFLEGGTWCPMRPKK 340          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Match: pias2 (E3 SUMO-protein ligase PIAS2 [Source:NCBI gene;Acc:101155036])

HSP 1 Score: 113.62 bits (283), Expect = 1.298e-25
Identity = 87/273 (31.87%), Postives = 130/273 (47.62%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKP----FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              +R +  Q+ +RF + + + P    +PN               L + VN    PL    P      E KR  RP+NI+  ++ SSA        I+V W   P + + Y  +VYL R+L+   L  R   K   ++ P   +   I+EK +        +D  +E+        ++ L +SL+CP+GK R+T P R V C HLQCFDA LYL MNE++  W CPVCD  A    L +D  FL+IL D     D+ E+     G++ P+  K+
Sbjct:  100 GGRRDYLVQIQLRFCLSETSCPQEDNYPNG--------------LCIKVNGKLFPLPGFAPPPKNGVEPKRPGRPLNITSLVRLSSA----VPNQISVTW--APEIGKTYSMSVYLVRQLTSPLLLQRL--KMKGIRNP-DHSRALIKEKLT--------ADPDSEV-------ATTSLRVSLMCPLGKMRLTVPCRAVTCSHLQCFDAALYLQMNEKKPTWICPVCDKKAAYENLIIDGLFLEILNDC---SDVDEIKFLEGGTWCPMRPKK 331          
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Match: pias1a (E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc:101169428])

HSP 1 Score: 112.079 bits (279), Expect = 4.773e-25
Identity = 83/269 (30.86%), Postives = 118/269 (43.87%), Query Frame = 3
Query:  858 NNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKE 1664
              K  F  QV +RF +          SE      ++ PP L + VN     L   LP      E KR  RPINI+  ++ S+        TI V+W  T  + + Y  AVYL ++ S + L  R   K   ++ P   +   I+EK +        +D  +E+      V             GK R+  P R + C HLQCFDA LY+ MNE++  W CPVCD  A    L +D  F++IL       D  E+    DGS+ P+  K+
Sbjct:  202 GTKCDFSVQVQLRFCL----------SETSCPQEDHFPPNLCVKVNGKPCTLPGYLPPTKNGVEPKRPSRPINITSLVRLSTT----VPNTIVVSW--TSEIGRNYSMAVYLVKQQSSTVLLQRLRAKG--IRNP-DHSRALIKEKLT--------ADPDSEIATTSLRVSLLCPL-------GKMRLMIPCRALTCSHLQCFDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFVEILNSCM---DCDEIQFKEDGSWAPMRSKK 433          
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Match: SMESG000023854.1 (SMESG000023854.1)

HSP 1 Score: 1174.46 bits (3037), Expect = 0.000e+0
Identity = 653/654 (99.85%), Postives = 654/654 (100.00%), Query Frame = 3
Query:   87 MTIEDVKITIKNYILNSISQRELVELCGMFNIPLNGRRIQIQKRLIDSVLIATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINRNVNYQLNGYNQLPMSGNLISSIYRICNENLDKCPINLRPEIVNGIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPNVQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLESDDEENNQVKMXXXXXXXXXXXXVEVAPVPKPHTTQPKSSMKSLTIDLTXXXXXXXXXXXXXXXXXXXXXXXXXXXNPQYSHINSQ 2048
            MTIEDVKITIKNYILNSISQRELVELCGMFNIPLNGR+IQIQKRLIDSVLIATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINRNVNYQLNGYNQLPMSGNLISSIYRICNENLDKCPINLRPEIVNGIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPNVQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMDDDDDLVISSVLPISLLCPVGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVNEDENSTDSSDSTEKQPVILLESDDEENNQVKMSSDQNISSSSNNVEVAPVPKPHTTQPKSSMKSLTIDLTSDSEDDIESQSSQPVSSISLSVSKSSSNPQYSHINSQ
Sbjct:    1 MTIEDVKITIKNYILNSISQRELVELCGMFNIPLNGRKIQIQKRLIDSVLIATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGLNNAEINRNVNYQLNGYNQLPMSGNLISSIYRICNENLDKCPINLRPEIVNGIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPNVQLPYCVKNTVISSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMDDDDDLVISSVLPISLLCPVGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVNEDENSTDSSDSTEKQPVILLESDDEENNQVKMSSDQNISSSSNNVEVAPVPKPHTTQPKSSMKSLTIDLTSDSEDDIESQSSQPVSSISLSVSKSSSNPQYSHINSQ 654          
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Match: SMESG000070635.1 (SMESG000070635.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.123e-71
Identity = 146/355 (41.13%), Postives = 216/355 (60.85%), Query Frame = 3
Query:  756 PNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKP---FPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSAD-DQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVXXXXXXXXXXXXXXKQPVILLESDDEEN 1808
            PN V   R+ +   L F ++ + R+LI+ ++ ++N K  +KWQVL+RF   D T+    F N  E     PE IPPY++L VN  + PLWD+LPSN   KEG+RHP+PI I+D LK ++ +   GY+Q +++ WWQ P +  Y+Y  VYLERK+SV E+   +   +     P+   L ++R KF       +  D+  ++   + L I+   P+       KSRI  PLR + C+HLQCFDA  +L MNERRSVWKCP+CD  AT N+LF D+FFL ILQ F+ +E++++VNVNPD S+  VAV ++R+ +Q + N +   +NS VN+             Q +I+L+SD+EE+
Sbjct:    4 PNFV--VRVNTTQPLNFIITENVRNLISNNQYKVNGKIEYKWQVLLRFVGIDVTQAKEVFANPPEI---FPENIPPYMSLIVNEISHPLWDVLPSNHKLKEGRRHPKPIQITDKLKLNTRNASGGYKQLVSMTWWQIPEITPYFYVGVYLERKISVREMMSLYAPNSLFNNRPMDEILAWVRNKFGKAPNNSQNDDDCDDLVISNVLPINLNCPV------SKSRIGIPLRTIRCEHLQCFDAVFFLSMNERRSVWKCPICDEQATPNDLFTDKFFLSILQHFKNDEEVSDVNVNPDNSF--VAVTQNRDREQ-VENPMPRNENSVVNQASTQPV-------QDLIVLDSDEEED 337          
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Match: SMESG000058500.1 (SMESG000058500.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.412e-26
Identity = 94/317 (29.65%), Postives = 150/317 (47.32%), Query Frame = 3
Query:  699 FYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLITAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVP 1649
            FY C   + PL+ L        V+  R +    L+F+L      L++  +   +NK  F  + ++RF   +         ++   L +  P +L L +NN  + L   LP++   K+G+R PRP+++S+ L     D+        + W Q     + +YFAVYL R+ +  EL    + K      PI  T NFI E   +NN      D+         +++ + +  SL+CPV + R++ P+RG +C HLQCFD   YL+MN  +  W+CPVCD       L VD   L IL D  +++ +  V  N  G + P
Sbjct:   11 FYECIDTIIPLTKLRLTNLLPDVKPGRFIGNQLLEFSLQLDHSFLLSESKKHKSNK--FDIRAIIRFSNIEDVHKV----DDQFTLKDVFPIHLKLNLNNTLITLPQFLPNDRTGKDGRRFPRPVDLSEGL----LDNPLVINKFLIQWVQDDCKKESFYFAVYLVRRRTCEELSQILMKKQ---LSPIQNTQNFIAEH--SNNHNTGQDDD--------LMLVDNTINTSLICPVSRVRMSTPVRGQHCTHLQCFDCVTYLIMNFNKPTWQCPVCDKKTFFCYLEVDSLILGILNDL-RSKSIDGVIFNKIGQWKP 303          
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Match: SMESG000069268.1 (SMESG000069268.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.141e-18
Identity = 66/234 (28.21%), Postives = 104/234 (44.44%), Query Frame = 3
Query:  951 NLPEY-IPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVP 1649
            N  EY  PP+L + VNN  + L D LP ++    G+R+ RPI+I+D + F    D+ Y+    + W Q       + FA+++ ++ S  EL  + + K  +    I    + I    S  + +   S                             R+  P+RG  C HLQCFD   YL MN  + +W+CP+CD     + L VD     IL D ++++ L E+  N  G + P
Sbjct:   76 NKNEYTFPPFLKISVNNCQIHLSDYLPFDNERTWGRRYARPIDITDAIVF----DKDYKNHCVIKWGQ-EYCNTKFMFALFILKRKSTDELCSQIMKKPVY---EIGKNQSLISSYLSITSLHCPAS---------------------------LCRMGFPVRGDTCTHLQCFDLVTYLTMNFLKPIWRCPICDKETPYHLLRVDSLIHNILND-ERSKPLKEIKFNDKGQWKP 273          
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Match: SMESG000069268.1 (SMESG000069268.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.167e-18
Identity = 66/234 (28.21%), Postives = 104/234 (44.44%), Query Frame = 3
Query:  951 NLPEY-IPPYLTLFVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTINVNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFIREKFSTNNQYKKISDESTEMXXXXXXXXXXXXXXXXXXXXGKSRITCPLRGVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQDFQKNEDLTEVNVNPDGSYVP 1649
            N  EY  PP+L + VNN  + L D LP ++    G+R+ RPI+I+D + F    D+ Y+    + W Q       + FA+++ ++ S  EL  + + K  +    I    + I    S  + +   S                             R+  P+RG  C HLQCFD   YL MN  + +W+CP+CD     + L VD     IL D ++++ L E+  N  G + P
Sbjct:   25 NKNEYTFPPFLKISVNNCQIHLSDYLPFDNERTWGRRYARPIDITDAIVF----DKDYKNHCVIKWGQ-EYCNTKFMFALFILKRKSTDELCSQIMKKPVY---EIGKNQSLISSYLSITSLHCPAS---------------------------LCRMGFPVRGDTCTHLQCFDLVTYLTMNFLKPIWRCPICDKETPYHLLRVDSLIHNILND-ERSKPLKEIKFNDKGQWKP 222          
The following BLAST results are available for this feature:
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIAS21.991e-2628.27protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS22.113e-2628.70protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS23.827e-2628.27protein inhibitor of activated STAT 2 [Source:HGNC... [more]
PIAS15.037e-2630.07protein inhibitor of activated STAT 1 [Source:HGNC... [more]
PIAS35.040e-2632.77protein inhibitor of activated STAT 3 [Source:HGNC... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gei-176.597e-2030.59E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-176.658e-2030.59E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-176.658e-2030.59E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-176.665e-2030.59E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
gei-176.665e-2030.59E3 SUMO-protein ligase gei-17 [Source:UniProtKB/S... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Su(var)2-107.492e-3231.05gene:FBgn0003612 transcript:FBtr0302505[more]
Su(var)2-108.903e-3231.05gene:FBgn0003612 transcript:FBtr0088576[more]
Su(var)2-108.987e-3231.05gene:FBgn0003612 transcript:FBtr0302506[more]
Su(var)2-109.498e-3231.05gene:FBgn0003612 transcript:FBtr0302507[more]
Su(var)2-101.021e-3131.05gene:FBgn0003612 transcript:FBtr0088574[more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias22.049e-2730.24protein inhibitor of activated STAT, 2 [Source:ZFI... [more]
pias22.541e-2730.24protein inhibitor of activated STAT, 2 [Source:ZFI... [more]
pias22.804e-2730.24protein inhibitor of activated STAT, 2 [Source:ZFI... [more]
pias23.036e-2730.24protein inhibitor of activated STAT, 2 [Source:ZFI... [more]
pias1a5.508e-2629.97protein inhibitor of activated STAT, 1a [Source:ZF... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias39.690e-2731.08protein inhibitor of activated STAT 3 [Source:NCBI... [more]
pias39.776e-2731.62protein inhibitor of activated STAT 3 [Source:NCBI... [more]
pias31.665e-2631.08protein inhibitor of activated STAT 3 [Source:NCBI... [more]
PIAS11.421e-2529.76protein inhibitor of activated STAT 1 [Source:NCBI... [more]
PIAS11.600e-2529.76protein inhibitor of activated STAT 1 [Source:NCBI... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pias27.439e-2728.27protein inhibitor of activated STAT 2 [Source:MGI ... [more]
Pias39.483e-2732.77protein inhibitor of activated STAT 3 [Source:MGI ... [more]
Pias29.723e-2728.19protein inhibitor of activated STAT 2 [Source:MGI ... [more]
Pias11.195e-2630.42protein inhibitor of activated STAT 1 [Source:MGI ... [more]
Pias21.219e-2628.19protein inhibitor of activated STAT 2 [Source:MGI ... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88907|PIAS1_MOUSE8.360e-2630.42E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10... [more]
sp|Q8C5D8|PIAS2_MOUSE8.525e-2628.19E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10... [more]
sp|Q6AZ28|PIAS2_RAT9.197e-2628.70E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus ... [more]
sp|O75928|PIAS2_HUMAN9.562e-2628.27E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=96... [more]
sp|O75925|PIAS1_HUMAN2.419e-2530.07E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=96... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3VTV77.766e-3529.20Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3SHI31.316e-3330.07Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068WE721.859e-3328.65E3 SUMO protein ligase PIAS2 OS=Echinococcus granu... [more]
A0A068YA984.778e-3327.32E3 SUMO protein ligase PIAS2 OS=Echinococcus multi... [more]
A0A0X3PN851.320e-3234.59Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias21.159e-2730.77protein inhibitor of activated STAT, 2 [Source:ZFI... [more]
pias1b2.480e-2531.23protein inhibitor of activated STAT, 1b [Source:ZF... [more]
pias1a3.337e-2529.63protein inhibitor of activated STAT, 1a [Source:ZF... [more]
pias1b3.555e-2531.23protein inhibitor of activated STAT, 1b [Source:ZF... [more]
pias1a4.170e-2529.63protein inhibitor of activated STAT, 1a [Source:ZF... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006097.13.107e-2729.26pep scaffold:Pmarinus_7.0:GL477570:42904:66158:-1 ... [more]
ENSPMAT00000001340.16.344e-2128.08pep scaffold:Pmarinus_7.0:GL476352:326724:335624:-... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NFI18.040e-1133.75SUMO E3 ligase; catalyzes sumoylation of Yku70p/80... [more]
SIZ19.160e-1136.25SUMO E3 ligase; promotes attachment of small ubiqu... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO321408.345e-2031.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407093.015e-756.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias1b2.758e-2629.05E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias1b3.218e-2629.01E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
pias21.122e-2531.87E3 SUMO-protein ligase PIAS2 [Source:NCBI gene;Acc... [more]
pias21.298e-2531.87E3 SUMO-protein ligase PIAS2 [Source:NCBI gene;Acc... [more]
pias1a4.773e-2530.86E3 SUMO-protein ligase PIAS1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of E3 SUMO protein ligase PIAS2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023854.10.000e+099.85SMESG000023854.1[more]
SMESG000070635.11.123e-7141.13SMESG000070635.1[more]
SMESG000058500.11.412e-2629.65SMESG000058500.1[more]
SMESG000069268.14.141e-1828.21SMESG000069268.1[more]
SMESG000069268.14.167e-1828.21SMESG000069268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018434 ID=SMED30018434|Name=E3 SUMO protein ligase PIAS2|organism=Schmidtea mediterranea sexual|type=transcript|length=3452bp
CGGCATATTATTTAAATTATAAAAATAATACTTAGTATATATATATTTTA
ATCAATTTTAATTATTTTAGAGTAATTTTCGGTGAAATGACTATTGAGGA
TGTAAAAATTACTATTAAGAATTATATTTTAAATTCAATTTCACAACGTG
AATTAGTCGAGTTATGCGGAATGTTTAATATACCACTTAATGGCAGAAGA
ATACAAATTCAGAAAAGATTAATAGATTCTGTTCTTATTGCAACGAATAC
TGAATTACTACAGCAAATTCTTTTTATGATAAATGGAACTTATAATCGCG
ATAACAACCCAAATATTTTAGGTGCTAATCAACCACTATCGTCTCAACCT
AGAGATCAAACGCAAAATTTTGTCCAAAATGGTCTAAATAATGCTGAAAT
TAATCGGAATGTTAATTATCAATTGAATGGTTATAATCAGTTGCCAATGT
CAGGCAATTTAATATCTAGTATTTATCGAATTTGCAATGAAAATTTGGAT
AAATGCCCTATAAATTTACGTCCAGAAATTGTTAATGGCATTGATCCTTC
AAATATATTCATCCCAAATTATACTAAATACCCGACTGGTTATTTCAACG
CTCCTAGCTGCAGCCCGTCATTTGTGAATGGTCGAGTAAATATGCCAAAC
GTTCAACTTCCATACTGTGTAAAAAACACGGTAATAAGCTCTTCGCAATT
TTATTGCTGCCAAGTTGTTCTCCACCCACTCTCTTTGTTGATTCCAAAAC
CAACTCCCAATATCGTTCAAACAACTCGTATAATGTCAAAAATGCAATTA
CAGTTCACTCTTTCAAATAGCGCACGACATTTAATTACTGCTCACAGATC
ACAATTAAACAACAAGCGATTCTTCAAATGGCAAGTTCTTGTTCGATTTG
GAGTTTATGATCCAACAAAACCATTCCCAAATTCCTCAGAAAACATTTCT
AATTTACCCGAATACATTCCACCTTATTTAACATTATTTGTTAACAACGC
TACAGTTCCATTATGGGATATTTTACCAAGCAATTCAGCGGCTAAAGAAG
GAAAGCGTCACCCGAGGCCGATAAATATCAGTGATTATTTAAAGTTTTCT
TCAGCGGATGATCAGGGTTATCGGCAGACAATAAACGTTAATTGGTGGCA
AACACCTGGAGTGTACCAATATTATTATTTCGCAGTTTACCTCGAGAGGA
AATTATCTGTCAGTGAATTGTTCGACAGATTCATTAATAAAACTCATCAT
GTTCAAATGCCTATCAGCTTCACGCTAAATTTCATTCGTGAGAAATTTTC
CACAAATAATCAGTATAAAAAAATATCTGATGAATCTACTGAAATGGATG
ATGATGACGATTTAGTGATATCTTCAGTGCTTCCGATCTCTTTGCTGTGT
CCTGTTGGTAAAAGTAGAATAACTTGTCCGCTTCGTGGAGTTTATTGTCA
GCATTTGCAATGTTTTGATGCTCACCTGTATTTAATGATGAATGAACGTC
GGTCGGTTTGGAAATGCCCTGTTTGCGATTCCAGTGCTACTCTCAATGAA
TTGTTTGTCGATGAGTTCTTTCTAAAAATTCTACAAGATTTCCAGAAAAA
CGAAGATTTAACAGAGGTCAATGTCAATCCAGACGGCTCGTATGTGCCAG
TGGCTGTGAAAGAAAGCAGAGAACACAAACAACATATCGGTAATATAATT
TCCAATGTTGATAACAGCAAAGTCAATGAAGACGAAAATTCAACCGACAG
TTCTGATTCAACGGAAAAACAGCCAGTTATTTTATTGGAAAGTGATGATG
AAGAGAATAATCAAGTGAAAATGTCCTCAGATCAAAATATTTCATCGAGC
TCAAACAATGTGGAGGTTGCACCGGTTCCAAAGCCTCATACAACACAACC
CAAATCTTCAATGAAATCTCTAACAATAGATCTCACATCAGACAGTGAAG
ATGATATAGAAAGTCAAAGTTCCCAACCCGTTTCCAGCATATCTCTATCT
GTTAGCAAATCATCTTCAAATCCTCAATATTCACATATAAACTCTCAGAA
TCCTTCTTTAATAAGTCAACAGTTGCCTCATCAATATATCGTACCAAAAA
TGCCAAGTAATTTTGCGATTACATCATCATCGGAAGCTCCACGGATCGCT
AGTGCATCGGTGTTGCACCCTCGCTCATCATCAATCGAATTCATACCATT
GACTAATCCATATCAGACATACATCAGCAATCCAGGATCATCACAATCGA
AAATCCCGCAATATAATTGGATGAATCCAACACATAGATTTCCGTCCAAC
CGAACAACGGAAATTTTCAACAGCTTTATGCCGGCATTGAAACCGTGTTA
TAATCCCAATTTTGTCAATATAATCCGACCCTCATCAACAGCTTCAGTAG
CGGCATTTCCAAATATAGCCACTATGTCACATCCGAGTTCCGTTGGTTCC
GGCTTACCACTATTACCAAAACCAATGAAAATTGATCCTCATCACAATCA
GTTAACAATTATTCCAGTAAAGGAATCCCTAGCAACCAATATTAACCCGC
CGAATAATCTCCATTCCAAAACATCGTCGTCCAATAAGGAACGCCGAAAA
CACAAAATTCACGAAACAAAAAAATTATCATCTTCAACGGCAACAGCATC
ATCAGCCAGAGATTACGCAAATGCCAGGCGCAGCTCGAGAATCCTGAATC
AGAATAGAAAAGTCTACCGAGAAAAAAGTCTAACCGACGATGAAGAATCC
GACAGTGACCAATCAGATATTGTCAGTTCGCGGAACACGAAACGCCGCAA
CGCATTAGTCGAGAGTTCCTCTTCATCGTCATCATCAGCGTCGACATCAT
CCAGTTTATCAGTTTCAAATCCAAAGCGACGAAGATTAGTGCGTCATGAT
CGATCATTGTCCGGTGCGGAGCATATTTCACCGCCAGCGCCACCGTCACC
ATCATCGTCGCCGCCGCCATTTGTTGACCAATCAGATTTAGTGAAAAATT
TGAAATTTCCTCTTGTTATCTTGAATAAACTAGATCCCGTAGTTTTAAAG
GTTTATTTACAACAGAATGAAATTTCCAATCCAGATCATCAAATTGTTGT
TGTTTCAAATGATTATTCAATGTCGGGCGCTCGCGCAGTTGATGGAGGTG
AAAATCCATGTCGTCCGATTGTGCCAGATTTGTTGCCAGTAGTAGGAGAC
TGCATTAGCAATGGTCGTTCAGAAGGAGTAGGTGAAACTGGAGCAGCAAG
AGGAGGAAGAGTTGATGGATCCGGATCCCGATCAGACTGGTTATCCAGTA
ATAATATTAATAACATGCAGTGCTCTGGCAATGATATTATATAAAATTAA
CCAAAAATTTCATTGTGATTTATATATATATATGATGTTGCCACGGTAAC
CAGATGCTTGTATATAGATTTGAATATATTTATAGGATTTATTTGTATGG
AA
back to top

protein sequence of SMED30018434-orf-1

>SMED30018434-orf-1 ID=SMED30018434-orf-1|Name=SMED30018434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1086bp
MTIEDVKITIKNYILNSISQRELVELCGMFNIPLNGRRIQIQKRLIDSVL
IATNTELLQQILFMINGTYNRDNNPNILGANQPLSSQPRDQTQNFVQNGL
NNAEINRNVNYQLNGYNQLPMSGNLISSIYRICNENLDKCPINLRPEIVN
GIDPSNIFIPNYTKYPTGYFNAPSCSPSFVNGRVNMPNVQLPYCVKNTVI
SSSQFYCCQVVLHPLSLLIPKPTPNIVQTTRIMSKMQLQFTLSNSARHLI
TAHRSQLNNKRFFKWQVLVRFGVYDPTKPFPNSSENISNLPEYIPPYLTL
FVNNATVPLWDILPSNSAAKEGKRHPRPINISDYLKFSSADDQGYRQTIN
VNWWQTPGVYQYYYFAVYLERKLSVSELFDRFINKTHHVQMPISFTLNFI
REKFSTNNQYKKISDESTEMDDDDDLVISSVLPISLLCPVGKSRITCPLR
GVYCQHLQCFDAHLYLMMNERRSVWKCPVCDSSATLNELFVDEFFLKILQ
DFQKNEDLTEVNVNPDGSYVPVAVKESREHKQHIGNIISNVDNSKVNEDE
NSTDSSDSTEKQPVILLESDDEENNQVKMSSDQNISSSSNNVEVAPVPKP
HTTQPKSSMKSLTIDLTSDSEDDIESQSSQPVSSISLSVSKSSSNPQYSH
INSQNPSLISQQLPHQYIVPKMPSNFAITSSSEAPRIASASVLHPRSSSI
EFIPLTNPYQTYISNPGSSQSKIPQYNWMNPTHRFPSNRTTEIFNSFMPA
LKPCYNPNFVNIIRPSSTASVAAFPNIATMSHPSSVGSGLPLLPKPMKID
PHHNQLTIIPVKESLATNINPPNNLHSKTSSSNKERRKHKIHETKKLSSS
TATASSARDYANARRSSRILNQNRKVYREKSLTDDEESDSDQSDIVSSRN
TKRRNALVESSSSSSSSASTSSSLSVSNPKRRRLVRHDRSLSGAEHISPP
APPSPSSSPPPFVDQSDLVKNLKFPLVILNKLDPVVLKVYLQQNEISNPD
HQIVVVSNDYSMSGARAVDGGENPCRPIVPDLLPVVGDCISNGRSEGVGE
TGAARGGRVDGSGSRSDWLSSNNINNMQCSGNDII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR004181Znf_MIZ
IPR023321PINIT
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016874ligase activity
GO:0019789SUMO transferase activity
Vocabulary: biological process
TermDefinition
GO:0016925protein sumoylation