Active breakpoint cluster region-related protein

Overview
NameActive breakpoint cluster region-related protein
Smed IDSMED30018430
Length (bp)3153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Active breakpoint cluster region-related protein (SMED30018430) t-SNE clustered cells

Violin plots show distribution of expression levels for Active breakpoint cluster region-related protein (SMED30018430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Active breakpoint cluster region-related protein (SMED30018430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Active breakpoint cluster region-related protein (SMED30018430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018430h1SMcG0005490 dd_Smed_v4_4507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018430h1SMcG0005490 dd_Smed_v4_4507_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018430h1SMcG0005490 Contig26302newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30018430h1SMcG0005490 dd_Smed_v4_4507_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018430h1SMcG0005490 dd_Smed_v4_4507_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 228.409 bits (581), Expect = 4.160e-62
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   57 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 725          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 228.409 bits (581), Expect = 4.160e-62
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   57 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 725          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 228.409 bits (581), Expect = 4.160e-62
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   57 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 725          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 228.409 bits (581), Expect = 5.563e-62
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   93 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 761          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 228.409 bits (581), Expect = 5.563e-62
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   93 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 761          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 92.4337 bits (228), Expect = 5.416e-20
Identity = 50/167 (29.94%), Postives = 94/167 (56.29%), Query Frame = 2
Query: 2312 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTL 2812
            +FG +L ++   E   N LV   P  I    + IE  GL+ +GIYR+SG+ + + ++  + +++   A+  +   D+H +TG +K++ REL +PL   + ++      ++     RF ++ E++  LP  N  T+  +L+H  +V +HS++N+M   NL ++ GPTL
Sbjct:   91 VFGSTLSAICQHE---NSLV---PKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKAL--VSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTL 249          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Match: chin-1 (CHImaeriN (Rac-GTPase-activating protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q965N4])

HSP 1 Score: 93.9745 bits (232), Expect = 6.534e-20
Identity = 55/162 (33.95%), Postives = 89/162 (54.94%), Query Frame = 2
Query: 2375 NVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERIL---QIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP---PCDPNKQ 2842
            ++P I+  C   +E  GLD EGIYR+SGS + + +L ++ + N    ++ +   D+HT+ G++K+Y R LP+ L+  + ++++L   Q        ER  +  +V++ L + N  T+  VL H +KV  HS KN+M   NL  I  PTL      P  PN Q
Sbjct:  246 DLPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVC--DIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTLFCSGSIPAMPNHQ 405          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 95.9005 bits (237), Expect = 1.076e-19
Identity = 51/160 (31.87%), Postives = 88/160 (55.00%), Query Frame = 2
Query: 2372 ENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKN--PSYAISNLYT-----YDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCD 2830
            ++VPMI+ AC   IE  G+D  GIYRI G+   +N L + L+     S  +S + +      D++ ++ ++KM+LR+LPEPLL    Y   +   ++     R  +   ++  LP P++ T+ F++ H  ++  HS  N+M   NL L+ GP+++ P  D
Sbjct:  598 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDD 757          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 95.9005 bits (237), Expect = 1.106e-19
Identity = 51/160 (31.87%), Postives = 88/160 (55.00%), Query Frame = 2
Query: 2372 ENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKN--PSYAISNLYTYD-----LHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCD 2830
            ++VPMI+ AC   IE  G+D  GIYRI G+   +N L + L+     S  +S + + D     ++ ++ ++KM+LR+LPEPLL    Y   +   ++     R  +   ++  LP P++ T+ F++ H  ++  HS  N+M   NL L+ GP+++ P  D
Sbjct:  959 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDD 1118          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 95.9005 bits (237), Expect = 1.204e-19
Identity = 51/160 (31.87%), Postives = 88/160 (55.00%), Query Frame = 2
Query: 2372 ENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKN--PSYAISNLYTYD-----LHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCD 2830
            ++VPMI+ AC   IE  G+D  GIYRI G+   +N L + L+     S  +S + + D     ++ ++ ++KM+LR+LPEPLL    Y   +   ++     R  +   ++  LP P++ T+ F++ H  ++  HS  N+M   NL L+ GP+++ P  D
Sbjct:  959 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDD 1118          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0340053)

HSP 1 Score: 178.718 bits (452), Expect = 3.941e-45
Identity = 196/771 (25.42%), Postives = 343/771 (44.49%), Query Frame = 2
Query:  617 LLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWH------IFYNISDLIYAQKSLVTYLESMATEFDNHLV------KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEI--NYEG-KSMCLDALIAKPINWL-CNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKN-SLETNSFLRSSL---FVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLH--LSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISN-GPDKPHTLLLPSVKDLEIWKCDILKV-QREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIF----KVDGLNPDFRYYLSIEVDSFNLNELKARTK-ICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLT----LEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNE---VILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            ++  E+ ++  L  + QYK  +  +  + + V        IF+ I +L       ++ L+++ +     ++      + +E+ DLY+        ++ N   A+  +K     NP F+K ++ I  N +  +S+ L+ L+ KP+  +  N+L     L +  +   D Q L +  + +Q   ++    N+   +E+N  LR  +   F+ +L    RKLRH+FLF+ +I CAK K            LG +  +              +++KWFI LK++ ++      +E  +     I+ +K  +R ++ QL  E +                   S + AFR        D++  ++  ++++L+L +P     + N   +K  T  L S  +   W   IL + Q+ + P  N   S+  V  F+ + ++   +     S L  +     +LV +++     ++GL      Y+ +EVDS+     KA TK IC   + L WNESF ++L+ SQ + IL+YE K                L  K  L   ++        +S KLT    L  S ++    EL +   S     LFG  +  V+ REK+      ++P II AC + +E  G+ E G YR+SGS +++ +L K    +   A   L   D+H++TGI+K +LRELPE L     Y R              +R NE   V   LP+ N +++  +L H  +V    T N+M   NL ++ GPTL+ P
Sbjct:  677 IIQSETIYVECLNKMMQYKKAIHATLTTSQPVIREEEENTIFFKIDELYDLHTGFLSDLKTIVSHEGGDVLIGEPFRRLAEMFDLYS-------AFLHNYKNAIETVKKCSANNPQFKKIVSTIVLNLQTEQSLTLEDLLHKPVARVQINALVFNDLLRETPNAHPDHQPLRQAQKIIQMFLNQFNVVNQRLPIESNRNLRRMVRNSFIVELVDGHRKLRHLFLFNDVIACAKYK-----------ALGRDRID--------------YELKWFIPLKDVSIYEEADPAVELKESSPANISQVKRNLRSVRDQLAMEVAN------------------SGSGAFRS------GDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSL-EVTAFIVAMQK--GMKTEMGSYLMRNTNDESLLVGDLYMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPL-WNESFMLELEGSQNVRILLYEAKE------------RPLLKAKHILKLSLSWLTETTQPKSIKLTETLELGCSFRF-IPGELFRG--STKPGALFGAKMSQVLKREKR------DIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1366          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0340054)

HSP 1 Score: 178.333 bits (451), Expect = 4.900e-45
Identity = 196/771 (25.42%), Postives = 343/771 (44.49%), Query Frame = 2
Query:  617 LLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWH------IFYNISDLIYAQKSLVTYLESMATEFDNHLV------KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEI--NYEG-KSMCLDALIAKPINWL-CNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKN-SLETNSFLRSSL---FVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLH--LSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISN-GPDKPHTLLLPSVKDLEIWKCDILKV-QREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIF----KVDGLNPDFRYYLSIEVDSFNLNELKARTK-ICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLT----LEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNE---VILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            ++  E+ ++  L  + QYK  +  +  + + V        IF+ I +L       ++ L+++ +     ++      + +E+ DLY+        ++ N   A+  +K     NP F+K ++ I  N +  +S+ L+ L+ KP+  +  N+L     L +  +   D Q L +  + +Q   ++    N+   +E+N  LR  +   F+ +L    RKLRH+FLF+ +I CAK K            LG +  +              +++KWFI LK++ ++      +E  +     I+ +K  +R ++ QL  E +                   S + AFR        D++  ++  ++++L+L +P     + N   +K  T  L S  +   W   IL + Q+ + P  N   S+  V  F+ + ++   +     S L  +     +LV +++     ++GL      Y+ +EVDS+     KA TK IC   + L WNESF ++L+ SQ + IL+YE K                L  K  L   ++        +S KLT    L  S ++    EL +   S     LFG  +  V+ REK+      ++P II AC + +E  G+ E G YR+SGS +++ +L K    +   A   L   D+H++TGI+K +LRELPE L     Y R              +R NE   V   LP+ N +++  +L H  +V    T N+M   NL ++ GPTL+ P
Sbjct:  679 IIQSETIYVECLNKMMQYKKAIHATLTTSQPVIREEEENTIFFKIDELYDLHTGFLSDLKTIVSHEGGDVLIGEPFRRLAEMFDLYS-------AFLHNYKNAIETVKKCSANNPQFKKIVSTIVLNLQTEQSLTLEDLLHKPVARVQINALVFNDLLRETPNAHPDHQPLRQAQKIIQMFLNQFNVVNQRLPIESNRNLRRMVRNSFIVELVDGHRKLRHLFLFNDVIACAKYK-----------ALGRDRID--------------YELKWFIPLKDVSIYEEADPAVELKESSPANISQVKRNLRSVRDQLAMEVAN------------------SGSGAFRS------GDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSL-EVTAFIVAMQK--GMKTEMGSYLMRNTNDESLLVGDLYMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPL-WNESFMLELEGSQNVRILLYEAKE------------RPLLKAKHILKLSLSWLTETTQPKSIKLTETLELGCSFRF-IPGELFRG--STKPGALFGAKMSQVLKREKR------DIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1368          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0112920)

HSP 1 Score: 178.333 bits (451), Expect = 5.025e-45
Identity = 196/771 (25.42%), Postives = 343/771 (44.49%), Query Frame = 2
Query:  617 LLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWH------IFYNISDLIYAQKSLVTYLESMATEFDNHLV------KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEI--NYEG-KSMCLDALIAKPINWL-CNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKN-SLETNSFLRSSL---FVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLH--LSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISN-GPDKPHTLLLPSVKDLEIWKCDILKV-QREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIF----KVDGLNPDFRYYLSIEVDSFNLNELKARTK-ICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLT----LEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNE---VILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            ++  E+ ++  L  + QYK  +  +  + + V        IF+ I +L       ++ L+++ +     ++      + +E+ DLY+        ++ N   A+  +K     NP F+K ++ I  N +  +S+ L+ L+ KP+  +  N+L     L +  +   D Q L +  + +Q   ++    N+   +E+N  LR  +   F+ +L    RKLRH+FLF+ +I CAK K            LG +  +              +++KWFI LK++ ++      +E  +     I+ +K  +R ++ QL  E +                   S + AFR        D++  ++  ++++L+L +P     + N   +K  T  L S  +   W   IL + Q+ + P  N   S+  V  F+ + ++   +     S L  +     +LV +++     ++GL      Y+ +EVDS+     KA TK IC   + L WNESF ++L+ SQ + IL+YE K                L  K  L   ++        +S KLT    L  S ++    EL +   S     LFG  +  V+ REK+      ++P II AC + +E  G+ E G YR+SGS +++ +L K    +   A   L   D+H++TGI+K +LRELPE L     Y R              +R NE   V   LP+ N +++  +L H  +V    T N+M   NL ++ GPTL+ P
Sbjct:  678 IIQSETIYVECLNKMMQYKKAIHATLTTSQPVIREEEENTIFFKIDELYDLHTGFLSDLKTIVSHEGGDVLIGEPFRRLAEMFDLYS-------AFLHNYKNAIETVKKCSANNPQFKKIVSTIVLNLQTEQSLTLEDLLHKPVARVQINALVFNDLLRETPNAHPDHQPLRQAQKIIQMFLNQFNVVNQRLPIESNRNLRRMVRNSFIVELVDGHRKLRHLFLFNDVIACAKYK-----------ALGRDRID--------------YELKWFIPLKDVSIYEEADPAVELKESSPANISQVKRNLRSVRDQLAMEVAN------------------SGSGAFRS------GDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSL-EVTAFIVAMQK--GMKTEMGSYLMRNTNDESLLVGDLYMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPL-WNESFMLELEGSQNVRILLYEAKE------------RPLLKAKHILKLSLSWLTETTQPKSIKLTETLELGCSFRF-IPGELFRG--STKPGALFGAKMSQVLKREKR------DIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1367          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Match: RhoGAP1A (gene:FBgn0025836 transcript:FBtr0112919)

HSP 1 Score: 178.333 bits (451), Expect = 5.025e-45
Identity = 196/771 (25.42%), Postives = 343/771 (44.49%), Query Frame = 2
Query:  617 LLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWH------IFYNISDLIYAQKSLVTYLESMATEFDNHLV------KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEI--NYEG-KSMCLDALIAKPINWL-CNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKN-SLETNSFLRSSL---FVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLH--LSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISN-GPDKPHTLLLPSVKDLEIWKCDILKV-QREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIF----KVDGLNPDFRYYLSIEVDSFNLNELKARTK-ICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLT----LEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNE---VILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            ++  E+ ++  L  + QYK  +  +  + + V        IF+ I +L       ++ L+++ +     ++      + +E+ DLY+        ++ N   A+  +K     NP F+K ++ I  N +  +S+ L+ L+ KP+  +  N+L     L +  +   D Q L +  + +Q   ++    N+   +E+N  LR  +   F+ +L    RKLRH+FLF+ +I CAK K            LG +  +              +++KWFI LK++ ++      +E  +     I+ +K  +R ++ QL  E +                   S + AFR        D++  ++  ++++L+L +P     + N   +K  T  L S  +   W   IL + Q+ + P  N   S+  V  F+ + ++   +     S L  +     +LV +++     ++GL      Y+ +EVDS+     KA TK IC   + L WNESF ++L+ SQ + IL+YE K                L  K  L   ++        +S KLT    L  S ++    EL +   S     LFG  +  V+ REK+      ++P II AC + +E  G+ E G YR+SGS +++ +L K    +   A   L   D+H++TGI+K +LRELPE L     Y R              +R NE   V   LP+ N +++  +L H  +V    T N+M   NL ++ GPTL+ P
Sbjct:  678 IIQSETIYVECLNKMMQYKKAIHATLTTSQPVIREEEENTIFFKIDELYDLHTGFLSDLKTIVSHEGGDVLIGEPFRRLAEMFDLYS-------AFLHNYKNAIETVKKCSANNPQFKKIVSTIVLNLQTEQSLTLEDLLHKPVARVQINALVFNDLLRETPNAHPDHQPLRQAQKIIQMFLNQFNVVNQRLPIESNRNLRRMVRNSFIVELVDGHRKLRHLFLFNDVIACAKYK-----------ALGRDRID--------------YELKWFIPLKDVSIYEEADPAVELKESSPANISQVKRNLRSVRDQLAMEVAN------------------SGSGAFRS------GDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSL-EVTAFIVAMQK--GMKTEMGSYLMRNTNDESLLVGDLYMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPL-WNESFMLELEGSQNVRILLYEAKE------------RPLLKAKHILKLSLSWLTETTQPKSIKLTETLELGCSFRF-IPGELFRG--STKPGALFGAKMSQVLKREKR------DIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1367          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0343539)

HSP 1 Score: 114.775 bits (286), Expect = 1.910e-25
Identity = 108/403 (26.80%), Postives = 184/403 (45.66%), Query Frame = 2
Query: 1682 ISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPID-NPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLN--PDFRY-----------YLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQ-LNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQ--PSIMKTG---LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNP-SYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAK--LEEEVERFSRYNEVILS-LPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIM 2818
            +S GP  P   +L +             + R H+ ID NP             Y+    IV++         G+SG+L  ++    GL   P+              Y  IE D  +    KART + +G     W+ESF++DL  ++ +++LVY       +K    G      +  +  L+Q   K          + T+   +++     L KR+  PS ++ G   LFG  L++VV RE K       VP+++  C + +E  GLD  G+YR+ GS  +   L +   +N  +  ++  +  D++ ITG++K YLRELPEPL     ++  +      L ++ E  ++    IL  LP  N +T++F+L H   V+++S +N+M A  L  ++GP L++
Sbjct:  743 LSAGPASPSGSILSTGGHQSPAPTPSATLPRPHRQIDINPAE--------FAKYKLDKPIVDIG--------GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVH----KARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLHQLALKV-------EPRGTIYIRMRHTDPLALYKRRGLPS-LRAGYPTLFGADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLML 1117          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 224.557 bits (571), Expect = 1.221e-59
Identity = 199/754 (26.39%), Postives = 331/754 (43.90%), Query Frame = 2
Query:  632 SHHLCLLTTIQQYKYILIQSK--VSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRK-----AINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRK---NEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE-HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVY----EIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            SH   LL  ++  K     S+  ++ + +  IF+N+ +L    K     L     ++ N          L + L V  + +V N   A+   +   + N  F +      +     +     L+ L+ KP++ +  S  ++ +L+  T     D   L++ LR   N  S+ +E     + S+     E    LR    VE L    RKLRHVFLF+ +++CAK K QT    Q                        ++D KW+I L ++        ES+   +    EI  LK KI  +K ++  EK                          R  K   V+DR   ++ + ++ LLL+SP   F +SN   K +T L+ S  + E W+  I + Q++  K      + +  + N     +   SI            G+ G L   +    GL      Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + +L Y    + ++ GEN + ++   + QL+P+    +   +TV  ++    KL    S+++ ++   LKR PS  ++G+FG  + +V  RE         VP+I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  +   N+M   NL  + GPTL+ P
Sbjct:  479 SHLEALLVPMKPLKAAATTSQPMLTLQQIETIFFNVPELHEIHKDFYDGLLPRVQQWSNRQCVGDLFQKLASQLGVY-RAFVDNYKIAVETAEKCCQANSQFAEISENLKVKSAKDQNAKHSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVKKGENRQLLRDQFMVE-LVEGARKLRHVFLFTDILLCAKLKKQTGGKGQ------------------------QYDCKWYIPLADVTFQTIDESESSPIPQIPEEEIDALKVKISQIKNEIQREK--------------------------RVCKGGKVLDRLRKKLCEQESLLLLMSPCMAFRVSNRNGKGYTFLISSDYEREEWREVIREQQKKCFKSFSLTSLELQMLTNSCVKLQTVHSIPLTVNKDDDESTGLCGFLNVIVHSATGLKQSLNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENMDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKL----SMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKREHS------KVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRP 1170          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 223.787 bits (569), Expect = 2.273e-59
Identity = 193/723 (26.69%), Postives = 318/723 (43.98%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRK-----AINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRK---NEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE-HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVY----EIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IF+N+ +L    K     L     ++ N          L + L V  + +V N   A+   +   + N  F +      +     +     L+ L+ KP++ +  S  ++ +L+  T     D   L++ LR   N  S+ +E     + S+     E    LR    VE L    RKLRHVFLF+ +++CAK K QT    Q                        ++D KW+I L ++        ES+   +    EI  LK KI  +K ++  EK                          R  K   V+DR   ++ + ++ LLL+SP   F +SN   K +T L+ S  + E W+  I + Q++  K      + +  + N     +   SI            G+ G L   +    GL      Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + +L Y    + ++ GEN + ++   + QL+P+    +   +TV  ++    KL    S+++ ++   LKR PS  ++G+FG  + +V  RE         VP+I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  +   N+M   NL  + GPTL+ P
Sbjct:  573 IFFNVPELHEIHKDFYDGLLPRVQQWSNRQCVGDLFQKLASQLGVY-RAFVDNYKIAVETAEKCCQANSQFAEISENLKVKSAKDQNAKHSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVKKGENRQLLRDQFMVE-LVEGARKLRHVFLFTDILLCAKLKKQTGGKGQ------------------------QYDCKWYIPLADVTFQTIDESESSPVPQIPEEEIDALKVKISQIKNEIQREK--------------------------RVCKGGKVLDRLRKKLCEQESLLLLMSPCMAFRVSNRNGKGYTFLISSDYEREEWREVIREQQKKCFKSFSLTSLELQMLTNSCVKLQTVHSIPLTVNKDDDESTGLCGFLNVIVHSATGLKQSLNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENIDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKL----SMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKREHS------KVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRP 1233          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 218.394 bits (555), Expect = 7.808e-58
Identity = 163/566 (28.80%), Postives = 259/566 (45.76%), Query Frame = 2
Query: 1148 ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRK---NEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE-HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVY----EIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            E    LR    VE L    RKLRHVFLF+ +++CAK K QT    Q                        ++D KW+I L ++        ES+   +    EI  LK KI  +K ++  EK                          R  K   V+DR   ++ + ++ LLL+SP   F +SN   K +T L+ S  + E W+  I + Q++  K      + +  + N     +   SI            G+ G L   +    GL      Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + +L Y    + ++ GEN + ++   + QL+P+    +   +TV  ++    KL    S+++ ++   LKR PS  ++G+FG  + +V  RE         VP+I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  +   N+M   NL  + GPTL+ P
Sbjct:  534 ENRQLLRDQFMVE-LVEGARKLRHVFLFTDILLCAKLKKQTGGKGQ------------------------QYDCKWYIPLADVTFQTIDESESSPIPQIPEEEIDALKVKISQIKNEIQREK--------------------------RVCKGGKVLDRLRKKLCEQESLLLLMSPCMAFRVSNRNGKGYTFLISSDYEREEWREVIREQQKKCFKSFSLTSLELQMLTNSCVKLQTVHSIPLTVNKDDDESTGLCGFLNVIVHSATGLKQSLNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENMDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKL----SMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKREHS------KVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRP 1038          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 218.394 bits (555), Expect = 1.238e-57
Identity = 163/566 (28.80%), Postives = 259/566 (45.76%), Query Frame = 2
Query: 1148 ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRK---NEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE-HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVY----EIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            E    LR    VE L    RKLRHVFLF+ +++CAK K QT    Q                        ++D KW+I L ++        ES+   +    EI  LK KI  +K ++  EK                          R  K   V+DR   ++ + ++ LLL+SP   F +SN   K +T L+ S  + E W+  I + Q++  K      + +  + N     +   SI            G+ G L   +    GL      Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + +L Y    + ++ GEN + ++   + QL+P+    +   +TV  ++    KL    S+++ ++   LKR PS  ++G+FG  + +V  RE         VP+I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  +   N+M   NL  + GPTL+ P
Sbjct:  678 ENRQLLRDQFMVE-LVEGARKLRHVFLFTDILLCAKLKKQTGGKGQ------------------------QYDCKWYIPLADVTFQTIDESESSPIPQIPEEEIDALKVKISQIKNEIQREK--------------------------RVCKGGKVLDRLRKKLCEQESLLLLMSPCMAFRVSNRNGKGYTFLISSDYEREEWREVIREQQKKCFKSFSLTSLELQMLTNSCVKLQTVHSIPLTVNKDDDESTGLCGFLNVIVHSATGLKQSLNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENMDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKL----SMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKREHS------KVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRP 1182          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:ZFIN;Acc:ZDB-GENE-040724-43])

HSP 1 Score: 185.652 bits (470), Expect = 3.357e-47
Identity = 182/737 (24.69%), Postives = 309/737 (41.93%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNH------LVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMC--------LDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES---NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE-HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNY---------GENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IF+ + +L    K     L     ++ +H        K +  L LY       + +V N   A+   +   + N  F +    +       C        L+ L+ KP++ +  S  ++ +L+  T     D   L++ LR   N  S+ +E     + S+     E    L+    VE L    RKLRHVFLF+ +++CAK K       Q                        ++D KW+I L +L    ++  E          E+  +K KI  L+ ++  E+                          R  K   V++R   ++ + ++  LL SP     + N   K +  L+ S  +   WK  I + Q++  K  +   M +  + N     +    +            G+ G L   +    GL      Y ++EVDSF +   KA+T++   ++  +WNE F+I+L+ S  + +L YE K+Y         GE+ + ++G  +  L+P+    +   +TV  ++    K+    S+K+ ++   LKR PS    G+FG ++ +V  RE+        VP I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y        L + V + S    ++LSLPEPN  T +F+L H +++      N+M   NL  + GPTL+ P
Sbjct:  617 IFFKVPELYEIHKEFYDSLLPRVQQWSHHQRVGDLFQKQASQLGLY-------RAFVDNYELAVETAEKCCQANTQFAEISESLKVRSTKECKDLTAKYSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDYPLLQDALRISQNFLSSINEESTPRRQSMTVKKGENRQLLKDGFMVE-LVEGARKLRHVFLFTDLLLCAKLKKLIGGKSQ------------------------QYDSKWYIPLSDLTFQTAEESEPLPIPQAPDEELDAIKIKISSLRSEIQRER--------------------------RANKGSKVMERLKKKLSEQESLFLLNSPNMPLRVHNRNGKSYMFLISSDYERAEWKEVIREQQKKCFKTFNLSSMELQMLTNSCVKLQTVHQLPLTVNKEEDESTGLYGFLNVIVHSASGLKQSLNLYCTLEVDSFGIFVNKAKTRVYRYTTEPKWNEEFEIELEGSHTLRLLCYE-KSYNKAKVNKEDGESTDRIMGKGQMPLDPQMLQGKDWQRTVIPMNGIEVKI----SMKFTSREFSLKRMPSRKPMGVFGVNISTVTKRERS------KVPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALSDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRIAEKECVNKMSLHNLATVFGPTLLRP 1284          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Match: abr (ABR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:779766])

HSP 1 Score: 231.876 bits (590), Expect = 5.877e-63
Identity = 208/750 (27.73%), Postives = 343/750 (45.73%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDN-----HLV-KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES----NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMN 2851
            IFY I D+    K     L  +  +FDN     HL  K +  L +Y       K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV    +  E     +    +EI  +K KI  LK ++  E+                    SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +     Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P    +K  MN
Sbjct:  129 IFYKIEDIYQMHKDFYDKLCPIVLQFDNKTTVGHLFQKLASQLGVY-------KAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVFPSPEESEPIPQLHATPDHEIEEMKAKISVLKSEIQKERK-------------------SNKGSSR------TIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYFFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKASFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHMN 808          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Match: abr (ABR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:779766])

HSP 1 Score: 231.876 bits (590), Expect = 6.912e-63
Identity = 208/750 (27.73%), Postives = 343/750 (45.73%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDN-----HLV-KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES----NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMN 2851
            IFY I D+    K     L  +  +FDN     HL  K +  L +Y       K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV    +  E     +    +EI  +K KI  LK ++  E+                    SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +     Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P    +K  MN
Sbjct:  141 IFYKIEDIYQMHKDFYDKLCPIVLQFDNKTTVGHLFQKLASQLGVY-------KAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVFPSPEESEPIPQLHATPDHEIEEMKAKISVLKSEIQKERK-------------------SNKGSSR------TIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYFFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKASFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHMN 820          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Match: abr (ABR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:779766])

HSP 1 Score: 231.876 bits (590), Expect = 2.739e-62
Identity = 208/750 (27.73%), Postives = 343/750 (45.73%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDN-----HLV-KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES----NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMN 2851
            IFY I D+    K     L  +  +FDN     HL  K +  L +Y       K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV    +  E     +    +EI  +K KI  LK ++  E+                    SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +     Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P    +K  MN
Sbjct:  298 IFYKIEDIYQMHKDFYDKLCPIVLQFDNKTTVGHLFQKLASQLGVY-------KAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVFPSPEESEPIPQLHATPDHEIEEMKAKISVLKSEIQKERK-------------------SNKGSSR------TIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYFFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKASFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHMN 977          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 214.157 bits (544), Expect = 1.875e-57
Identity = 182/639 (28.48%), Postives = 299/639 (46.79%), Query Frame = 2
Query:  977 LDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEI---------KNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINEL---YKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            L+AL+ KP++ +  S  ++ +LI  T     D   L++ LR   N  S+ +E     + S+     E    L+ S  VE L    RKLRHVFLF+ +++CAK K Q     Q                        ++D KW+I L +L     +T++ ++   N      D+I  +K+++   KS +      H   K L+R        RK            ++ + ++ LLL+SP+  F I N   K +TLL  S  +   W   I + Q+  K   +  +S   +     S  +  ++  V  +    DD   G+ G L   +    G       + ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE          ++ G++ E ++   + QL  +  L +   ++V  ++    KL    S+K+ ++   LKR PS  +TG+FG  +  V  RE+        VP I+  C + IE  GL+E GIYR+SG   +I  L   +   NK+ S  +S++   D++ I G +K+Y RELP PL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  + ++N+M   NL  + GPTL+ P
Sbjct:  159 LEALLYKPVDRVTRSTLVLHDLIKHTPIGHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVRKGEHRQLLKDSFMVE-LVEGARKLRHVFLFTDLLLCAKLKKQIGGKSQ------------------------QYDCKWYIPLADLNF---QTVDESETASNIPMIPDDEIEAIKVKISQLKSDIQREKKAHKGGKGLER-------LRK------------KLSEQESVLLLVSPSMAFRIQNRNGKSYTLLTWSDYERAEWAEHIREQQK--KCFKSFSLSSLEIQMLTNSCVKLQTVHRVPLTLSKEDDESSGLYGFLNVIVHSATGFQQSSNLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGIEVKL----SMKFTSREFSLKRLPSRKQTGVFGVKIAVVTKRERS------KVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM---DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALSDPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRP 735          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 214.157 bits (544), Expect = 1.875e-57
Identity = 184/652 (28.22%), Postives = 302/652 (46.32%), Query Frame = 2
Query:  977 LDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEI---------KNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINEL---YKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP-------PCDPNK 2839
            L+AL+ KP++ +  S  ++ +LI  T     D   L++ LR   N  S+ +E     + S+     E    L+ S  VE L    RKLRHVFLF+ +++CAK K Q     Q                        ++D KW+I L +L     +T++ ++   N      D+I  +K+++   KS +      H   K L+R        RK            ++ + ++ LLL+SP+  F I N   K +TLL  S  +   W   I    RE +   +  +S   +     S  +  ++  V  +    DD   G+ G L   +    G       + ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE          ++ G++ E ++   + QL  +  L +   ++V  ++    KL    S+K+ ++   LKR PS  +TG+FG  +  V  RE+        VP I+  C + IE  GL+E GIYR+SG   +I  L   +   NK+ S  +S++   D++ I G +K+Y RELP PL     Y    +   L + V + S    ++LSLPEPN  T +F+L H ++V  + ++N+M   NL  + GPTL+ P       P +P +
Sbjct:  151 LEALLYKPVDRVTRSTLVLHDLIKHTPIGHPDYPLLQDALRISQNFLSSINEEITPRRQSMTVRKGEHRQLLKDSFMVE-LVEGARKLRHVFLFTDLLLCAKLKKQIGGKSQ------------------------QYDCKWYIPLADLNF---QTVDESETASNIPMIPDDEIEAIKVKISQLKSDIQREKKAHKGGKGLER-------LRK------------KLSEQESVLLLVSPSMAFRIQNRNGKSYTLLTWSDYERAEWAEHI----REQQKKCDFSLSSLEIQMLTNSCVKLQTVHRVPLTLSKEDDESSGLYGFLNVIVHSATGFQQSSNLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGIEVKL----SMKFTSREFSLKRLPSRKQTGVFGVKIAVVTKRERS------KVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM---DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALSDPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPSEKDSKIPVNPTQ 738          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Match: Abr (active BCR-related gene [Source:MGI Symbol;Acc:MGI:107771])

HSP 1 Score: 229.565 bits (584), Expect = 2.915e-62
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  139 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 807          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Match: Abr (active BCR-related gene [Source:MGI Symbol;Acc:MGI:107771])

HSP 1 Score: 228.794 bits (582), Expect = 3.194e-62
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   93 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRER------SKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 761          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Match: Abr (active BCR-related gene [Source:MGI Symbol;Acc:MGI:107771])

HSP 1 Score: 228.024 bits (580), Expect = 5.372e-62
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  102 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 770          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Match: Abr (active BCR-related gene [Source:MGI Symbol;Acc:MGI:107771])

HSP 1 Score: 228.794 bits (582), Expect = 6.798e-62
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  151 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 819          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Match: Abr (active BCR-related gene [Source:MGI Symbol;Acc:MGI:107771])

HSP 1 Score: 229.18 bits (583), Expect = 3.884e-61
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  465 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 1133          
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Match: sp|Q8AVG0|ABR_XENLA (Active breakpoint cluster region-related protein OS=Xenopus laevis OX=8355 GN=abr PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.163e-63
Identity = 202/729 (27.71%), Postives = 337/729 (46.23%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEI--------KNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L  +  ++DN          L T L V  K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV     ++E ++       T   +I ++K ++   KS++             K   SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +    +Y ++EVDSF     KA+T++   +S  +WNE F+I+L+ SQ + IL YE         K+  E  + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L H +KV  +   N+M   NL  + GPTL+ P
Sbjct:  141 IFYKIEDIYQMHKDFYDKLCPIVQQWDNKTTVGHLFQKLATQLGV-YKAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVF---PSLEESEPIHQLHATPDYEIEEMKAKISVLKSEIQ------------KEKKSNKGSSR------AIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNFYCTLEVDSFGYFVSKAKTRVFRDTSEPEWNEEFEIELEGSQCLRILCYETCYDKSKLNKDNNEIVDKIMGKGQIQLDPQGVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAAFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLHHLKKVAENEPINKMSLHNLATVFGPTLLRP 810          
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Match: sp|A4II46|ABR_XENTR (Active breakpoint cluster region-related protein OS=Xenopus tropicalis OX=8364 GN=abr PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.662e-62
Identity = 208/750 (27.73%), Postives = 343/750 (45.73%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDN-----HLV-KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES----NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMN 2851
            IFY I D+    K     L  +  +FDN     HL  K +  L +Y       K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV    +  E     +    +EI  +K KI  LK ++  E+                    SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +     Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P    +K  MN
Sbjct:  141 IFYKIEDIYQMHKDFYDKLCPIVLQFDNKTTVGHLFQKLASQLGVY-------KAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVFPSPEESEPIPQLHATPDHEIEEMKAKISVLKSEIQKERK-------------------SNKGSSR------TIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYFFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKASFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHMN 820          
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Match: sp|A0A0G2JTR4|ABR_RAT (Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.910e-61
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  139 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKVKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 807          
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Match: sp|Q5SSL4|ABR_MOUSE (Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.039e-61
Identity = 202/736 (27.45%), Postives = 335/736 (45.52%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR----RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++ +      +E+  +K KI  LK ++  EK+                    N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  139 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-MSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKEKA--------------------NKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVESKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 807          
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Match: sp|Q12979|ABR_HUMAN (Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 3.412e-61
Identity = 200/733 (27.29%), Postives = 339/733 (46.25%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTD-EEQDRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKD-KIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL   +   + N  F+K   E+  +G         S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     ET   ++    VE +    RKLRHVFLF+ +++CAK K  +   HQ                        ++D KW+I L +LV    +  E++     ++    D ++ D+K+++ A KS++             ++  +N    R       I+R   ++F+ +  LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  +  +S   DD   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  +W+E F+I+L+ SQ + IL YE K Y + K         + ++G  + QL+P+  +  N H T  + M       + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  139 IFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGV-YKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVE-VSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQ------------------------QYDCKWYIPLADLVFPSPEESEASP----QVHPFPDHELEDMKMKISALKSEI-------------QKEKANKGQSR------AIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYE-KCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWH-TDVIEM-----NGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 807          
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Match: T1EGD3 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20195635 PE=4 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 5.534e-69
Identity = 230/767 (29.99%), Postives = 371/767 (48.37%), Query Frame = 2
Query:  608 IKMLLNHESHHLCLLTTIQQ----YKYI--LIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLL----HVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--KSMCLDALIAKPI-NWLCNSLELIKNLIDCTDEEQ-DRQKLEETL---RNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESN----DRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGP-DKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQ 2842
            +K +L  E+ +L +L  + +    YK I    Q  +S   V  IF+ I +L +A K  V  L     ++        +I D++ +L    H    +++KN P A+  +   + ++  F     EI  +   +S  L+ L+ KP+  +  NSL ++ +LI CT     D   L++TL   R+   N D S  +N N+       +  L VE++   VRK+RHVFLF+ +IVCA+QK+ T    + K  L P                     KW+I L +L L     IE      + +K EI  L+ K+ +L+ +L AE                LK ++  NS  +KLK K +I++        Q  L+  SP   F I N   ++ HTLL+ S  +   W+  I  +    +   N   S T + + L S + Y S+ E     LF      G L   IFK+ GL     YY +IEVD+F    +KA+TK+        WNE F+I+L+ SQ + IL Y++   G++   L+G    +L+          K +S+    + +L+L  SL Y ++++ LKR  S +K G+FG  +KSV  RE        ++PMI+ +C + +E  G+ E GIYR+SG   EI ++ K   KN   A + L   D++ +TG++K Y RELPE L     Y ++++   L +   + +    ++ SLPEPN +T ++++ H  +V  +  +N+M   NL  + GPTL+ P   P +Q
Sbjct:    6 VKSILESENSYLGILDMLMKHMTTYKNISSTAQMLISAADVEIIFHRIPELHHAHKMFVYQLAPKLEQWSGE----QQIADVFKMLVDEEHRIAPDFLKNYPKAVATIHRCWSESQQFADLTKEIRIKSTSESPSLEELLHKPVLRFQRNSL-VLHDLIKCTPASHPDYDTLQKTLNLSRSFLENLD-SPDNNLNADHQRYLAKQGLIVEKVG-QVRKVRHVFLFNDVIVCARQKITT----KQKIHLEP---------------------KWYISLIDLSLDDIVCIEDERQLLESQKQEIEILQKKMSELQKELKAE----------------LKGAVKENSDSQKLK-KKMIEQ--------QALLIKSSPCLIFKIHNRKMNRQHTLLMASDYERASWRTTITGLLSRAQTSLN--FSSTELQSLLNSQKVYLSLEE---EHLF------GTLSIKIFKLQGLKVPSGYYCTIEVDTFGQFFMKAKTKVVYEQPEPAWNEDFEIELEGSQTIRILCYKM---GKDVGCLVGSCALELSKAWLRGDFQEKPISI----NDELSLIVSLIYCSRDQTLKRAQSTVKGGVFGAPIKSVTKREGT------DIPMIVKSCVQEVEKRGMQEVGIYRVSGVSGEIQKMKKCFEKNSKVASTMLGDLDINVVTGVLKTYFRELPEALFTDYLYPQLVKGMGLGDPEAKVACITSLVQSLPEPNRATALYLIDHLIRVSKNEPENRMTLKNLATVFGPTLLRPANKPQQQ 691          
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Match: A0A3S1I215 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_001583 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 4.114e-67
Identity = 213/758 (28.10%), Postives = 363/758 (47.89%), Query Frame = 2
Query:  608 IKMLLNHESHHLCLLTTIQQYKYIL------IQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEI---NYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR----NLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVL--HLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSL-SNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKV-QREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGV-SGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYE-IKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            +K +L+ E  +L +LT +  YK +L       Q  +S E V  IF NI  +       VT LE    ++ +H     EI  +     +    Y+ N   A+  +    + N  F++   +I   +   +S  L+  + KP+  +  +  ++ +LI  T ++  D + L++ L+     L++      K +  + E    ++SS  VE L   VRKLR+VFLFS ++VC K++      H+   V                     FD KWF  L           T ++   ++++I  LK K+R LK ++ AE  K +  D          RSL S   A R      V+++   +I + + +L++ SP   F  S    K +TLL+ +  + E WK  I  +  R  +  + P MS   V + + S +    + ++ +  L  D+ + SG L   + K++GL  D   Y  +E+DSF    +KART IC G+    WNE F+++L+ SQ +  L +   +  G++ + ++G    +L+ +        KTVSM  NE   ++L  S+++    + ++R PS +    FG  + S+  RE K       VP I+ AC + +E  GLDE GIYR+SG  +E+  + K  +KN     ++L   D++ +TGI+K+Y RELPEPL     Y+  +   KL++E  +      ++  LP+ N+ T++ +++H  KV  +  +N+M   NL  I GPTL+ P
Sbjct: 1359 VKGVLDSEKVYLDILTVLINYKKLLEENSESTQPVISREDVGTIFSNIETIYRIHNEFVTSLEPKVKDW-HHEESIGEIFKIMISKFIDFGNYLTNYALAVSTIHRCSQGNERFQELAQKIVLTSTVKESSSLEDALFKPVQRVQRNTLVLHDLIKYTPQDHPDHEALQKALKLSHHILETFATAVPKCD-TTKENRRLVKSSFLVE-LVNGVRKLRYVFLFSDVLVCTKRE-----THRNNKVT--------------------FDPKWFTPLSEATFDTKFDYTDDTKHSKRDDIDQLKSKLRALKKEMRAEMKKFDDKD--------KHRSLVSLGGATR------VVEKLRKKISQYEAQLIIASPKLPFKASLNGGKVYTLLMTTDYEREEWKETIHSLCSRTSQ--NAPVMSSIFVQDLINSVKETPQVNKIGSVLLQKDEDILSGTLNVTVHKMNGLTEDCDTYCCLEMDSFGHFFMKARTHICEGTRDPAWNEDFELELESSQTLRFLCFRRGETGGDSGDIMLGRGAIELSKQWLKGSFQEKTVSM--NE---ISLVVSVRHTPAEKTMQRTPSKVSAACFGVKITSLARREGK------TVPTIVTACLQEVEKRGLDEVGIYRVSGVTSELQRIKKLFDKNVRSGAASLTDVDINAVTGILKLYFRELPEPLFTEACYQNFIDTLKLQDEEAKAQCMLSLLHGLPDTNYYTIVTLMEHLIKVARNVGENKMSIHNLSTIFGPTLLAP 2061          
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Match: A0A0K8RYL0 (Active breakpoint cluster region-related protein isoform b OS=Crotalus horridus OX=35024 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 1.231e-60
Identity = 199/723 (27.52%), Postives = 338/723 (46.75%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKS--MCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSLET----NSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K L   L      +D+ +V       L T L +  K +V N   AL   +   + N  F+K   E+  +G    + ++AL+ KPIN +  S  ++++L+  T  +  D   L++ LR   N  S+ +E     + ++ T    N  L    F+ ++    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L  LV     ++E +D   +        + D+K+++ + KS++            LK   +   +         ++R   ++F  +  LLL SP+    I N   K +  LL S  +   W+  I K+Q+  K +    +S   +   + S  +  ++  +  +S   DD   G+ G L   +  V G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y + K         + ++G ++ QL+P+       TK   +   E   + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        +P ++  C + +E  G+DE GIYRISG   +I +L    + N +  +  L   D++ I G +K+Y RELPEPLL    Y   +Q   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   92 IFYKIQDIYEIHKELYDNLWPHLQNWDSEVVLGHLFQKLATQLGI-YKAFVDNYKIALETAEKCSQHNSQFQKISEELKVKGTHSFVTMEALLYKPINRVTRSTSVLQDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGENRQLVKDGFLVEVAEGSRKLRHVFLFTDVLLCAKLK---------KTGVGKN---------------QQYECKWYIPLAELVF---PSLEESDLCPHVQAMPDHDLEDMKIKISSMKSEV------------LKEKANKGQS-------RAMERLKKKMFDNEFWLLLNSPSIPLRIHNRNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQTFVLSSVELQYLMGSCFKLRTVHNIPLTSNTDDDKPLGMCGFLHVIVHSVKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPQWNEEFEIELEGSQYLRILCYE-KCYDKTKLNKDNNEIVDRIVGKWQVQLDPQTVQ----TKNWQVDVIEMNGVKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KIPYVVRQCVEEVEKRGIDEVGIYRISGVATKIQDLKAAFDSNSTDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPTFMQGIALSDPSAKENCMLHLLRSLPDPNLITFLFLLEHLKRVAEKEPVNKMSLYNLATVFGPTLLRP 754          
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Match: A0A1L8HD47 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=abr PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 3.605e-60
Identity = 202/729 (27.71%), Postives = 337/729 (46.23%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEI--------KNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L  +  ++DN          L T L V  K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV     ++E ++       T   +I ++K ++   KS++             K   SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +    +Y ++EVDSF     KA+T++   +S  +WNE F+I+L+ SQ + IL YE         K+  E  + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L H +KV  +   N+M   NL  + GPTL+ P
Sbjct:  297 IFYKIEDIYQMHKDFYDKLCPIVQQWDNKTTVGHLFQKLATQLGV-YKAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVF---PSLEESEPIHQLHATPDYEIEEMKAKISVLKSEIQ------------KEKKSNKGSSR------AIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYLFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNFYCTLEVDSFGYFVSKAKTRVFRDTSEPEWNEEFEIELEGSQCLRILCYETCYDKSKLNKDNNEIVDKIMGKGQIQLDPQGVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAAFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLHHLKKVAENEPINKMSLHNLATVFGPTLLRP 966          
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Match: A0A5G3L812 (Active breakpoint cluster region-related protein OS=Xenopus tropicalis OX=8364 GN=abr PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 9.228e-60
Identity = 208/750 (27.73%), Postives = 343/750 (45.73%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDN-----HLV-KFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG--------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES----NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMN 2851
            IFY I D+    K     L  +  +FDN     HL  K +  L +Y       K +V N   AL   +   + N  F K   ++  +G        +S+ ++AL+ KPI+ +  S  ++ +L+  T  +  D   L++ LR   N  S+ +E     + ++     E    ++    VE L  + RKLRH+FLF+ +++CAK K  T   HQ                        ++D KW+I L +LV    +  E     +    +EI  +K KI  LK ++  E+                    SN  + R       I+R   ++F+ ++ LLL SPT  F I N   K +  LL S  +   W+  I K+Q+  K +    +S   +     S  +  ++  V   S   DD   G+ G L   +    G +     Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+   +++    V  ++     + +E S+K+ +++  LKR PS  +TG+FG  +  V  RE+        VP I+  C + +E  G++E GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T +F+L+H ++V      N+M   NL  + GPTL+ P    +K  MN
Sbjct:  129 IFYKIEDIYQMHKDFYDKLCPIVLQFDNKTTVGHLFQKLASQLGVY-------KAFVDNYKFALETAEKCSQCNVQFFKISEDLKVKGPKDSKEQPQSVTMEALLYKPIDRVTRSTLVLHDLLKHTPTDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEPRQLVKDGFLVE-LSENSRKLRHLFLFTDLLLCAKLKKTTVGKHQ------------------------QYDCKWYIPLADLVFPSPEESEPIPQLHATPDHEIEEMKAKISVLKSEIQKERK-------------------SNKGSSR------TIERLKKKMFEYESWLLLYSPTIPFRIHNKNGKSYFFLLSSDYERSEWREAIQKLQK--KDLQALALSPFELQVLTASCFKLRTVHNVPIISHKDDDESPGLYGFLHVIVKSAKGFSHSSNLYCTLEVDSFGYFVSKAKTRVFRDTTEPEWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDNNEIVDKIMGKGQIQLDPQVVQSKNWHDDVIEMNG----IKVEFSMKFSSRDMSLKRTPSKKQTGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKASFDANSKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLMTFLFLLQHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKGHMN 808          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 224.557 bits (571), Expect = 8.856e-61
Identity = 194/732 (26.50%), Postives = 338/732 (46.17%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL  ++   + N  F+K    +  +G         ++ ++AL+ KPI+ +  S  ++ +L+  T +E  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L +L     +T++ +D   +  T  + +I ++K+++   KS++             K++    S         ++DR   ++ + ++ LLL SPT  F I N   K    LL S  +   W+  I K+Q+  K + +  +S   +     S  +  ++  +  +S   D+   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+     N H+         E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T + +L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  109 IFYKIQDIYEIHKEFYDALFPNIQQWDDKVTVGHLFQKLASQLGVY-KAFVDNYKLALETVEKCSQANSQFQKISENVKVKGPKDSKDRTTTVTMEALLYKPIDRVTRSTLVLHDLLKHTPKEHPDFALLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSEGSRKLRHVFLFTDLLLCAKMK---------KTAVGRN---------------QQYECKWYIPLADLTF---QTLDDSDSCPHVQTLPEHEIEEMKIKISVIKSEIQKE----------KKAQKGQS--------RIVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFVFLLSSDYERSEWRESIQKLQK--KDLQSCVLSTLELQVLTSSCFKLRTVHNIPVTSNKDDEESSGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWHVDVI------EMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 778          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 224.557 bits (571), Expect = 1.008e-60
Identity = 194/732 (26.50%), Postives = 338/732 (46.17%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL  ++   + N  F+K    +  +G         ++ ++AL+ KPI+ +  S  ++ +L+  T +E  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L +L     +T++ +D   +  T  + +I ++K+++   KS++             K++    S         ++DR   ++ + ++ LLL SPT  F I N   K    LL S  +   W+  I K+Q+  K + +  +S   +     S  +  ++  +  +S   D+   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+     N H+         E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T + +L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  134 IFYKIQDIYEIHKEFYDALFPNIQQWDDKVTVGHLFQKLASQLGVY-KAFVDNYKLALETVEKCSQANSQFQKISENVKVKGPKDSKDRTTTVTMEALLYKPIDRVTRSTLVLHDLLKHTPKEHPDFALLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSEGSRKLRHVFLFTDLLLCAKMK---------KTAVGRN---------------QQYECKWYIPLADLTF---QTLDDSDSCPHVQTLPEHEIEEMKIKISVIKSEIQKE----------KKAQKGQS--------RIVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFVFLLSSDYERSEWRESIQKLQK--KDLQSCVLSTLELQVLTSSCFKLRTVHNIPVTSNKDDEESSGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWHVDVI------EMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 803          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 224.172 bits (570), Expect = 1.626e-60
Identity = 194/732 (26.50%), Postives = 338/732 (46.17%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL  ++   + N  F+K    +  +G         ++ ++AL+ KPI+ +  S  ++ +L+  T +E  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L +L     +T++ +D   +  T  + +I ++K+++   KS++             K++    S         ++DR   ++ + ++ LLL SPT  F I N   K    LL S  +   W+  I K+Q+  K + +  +S   +     S  +  ++  +  +S   D+   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+     N H+         E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T + +L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  136 IFYKIQDIYEIHKEFYDALFPNIQQWDDKVTVGHLFQKLASQLGV-YKAFVDNYKLALETVEKCSQANSQFQKISENVKVKGPKDSKDRTTTVTMEALLYKPIDRVTRSTLVLHDLLKHTPKEHPDFALLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSEGSRKLRHVFLFTDLLLCAKMK---------KTAVGRN---------------QQYECKWYIPLADLTF---QTLDDSDSCPHVQTLPEHEIEEMKIKISVIKSEIQKE----------KKAQKGQS--------RIVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFVFLLSSDYERSEWRESIQKLQK--KDLQSCVLSTLELQVLTSSCFKLRTVHNIPVTSNKDDEESSGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWHVDVI------EMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRER------SKVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 805          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 223.787 bits (569), Expect = 1.581e-59
Identity = 200/759 (26.35%), Postives = 349/759 (45.98%), Query Frame = 2
Query:  644 CLLTTIQQYKYILIQSK--VSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGK--------SMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
             LL  ++  K     SK  ++ E +  IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL  ++   + N  F+K    +  +G         ++ ++AL+ KPI+ +  S  ++ +L+  T +E  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L +L     +T++ +D   +  T  + +I ++K+++   KS++             K++    S         ++DR   ++ + ++ LLL SPT  F I N   K    LL S  +   W+  I K+Q+  K + +  +S   +     S  +  ++  +  +S   D+   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+     N H+         E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T + +L+H ++V      N+M   NL  + GPTL+ P
Sbjct:  422 ALLLPMRPLKATATTSKPVLTVEQIETIFYKIQDIYEIHKEFYDALFPNIQQWDDKVTVGHLFQKLASQLGV-YKAFVDNYKLALETVEKCSQANSQFQKISENVKVKGPKDSKDRTTTVTMEALLYKPIDRVTRSTLVLHDLLKHTPKEHPDFALLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSEGSRKLRHVFLFTDLLLCAKMK---------KTAVGRN---------------QQYECKWYIPLADLTF---QTLDDSDSCPHVQTLPEHEIEEMKIKISVIKSEIQKE----------KKAQKGQS--------RIVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFVFLLSSDYERSEWRESIQKLQK--KDLQSCVLSTLELQVLTSSCFKLRTVHNIPVTSNKDDEESSGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWHVDVI------EMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 1118          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 210.305 bits (534), Expect = 1.824e-56
Identity = 189/722 (26.18%), Postives = 330/722 (45.71%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCL--DALIAKP-----INWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENK---------ESLIGYFEFQLNPK--DHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D+    K     L     ++D+ +        L + L V  K +V N   AL  ++   + N  F+K I+E+     +  +  D L   P        L ++L + +N +   +EE D ++   T     + + E+++  K+            F+ ++    RKLRHVFLF+ +++CAK K         K  +G                 ++++ KW+I L +L     +T++ +D   +  T  + +I ++K+++   KS++             K++    S         ++DR   ++ + ++ LLL SPT  F I N   K    LL S  +   W+  I K+Q+  K + +  +S   +     S  +  ++  +  +S   D+   G+ G L   +    G       Y ++EVDSF     KA+T++   ++  QWNE F+I+L+ SQ + IL YE K Y ++K         + ++G  + QL+P+     N H+         E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLP+PN  T + +L+H ++V      N+M   NL  + GPTL+ P
Sbjct:   51 IFYKIQDIYEIHKEFYDALFPNIQQWDDKVTVGHLFQKLASQLGV-YKAFVDNYKLALETVEKCSQANSQFQK-ISEVTKNTYTTLVLHDLLKHTPKEHPDFALLQDALRISQNFLSSINEEIDPRRTAVT-----TPKGEARQLVKDG-----------FLVEVSEGSRKLRHVFLFTDLLLCAKMK---------KTAVGRN---------------QQYECKWYIPLADLTF---QTLDDSDSCPHVQTLPEHEIEEMKIKISVIKSEIQKE----------KKAQKGQS--------RIVDRLRKKMNEQESWLLLHSPTIPFRIHNKHGKSFVFLLSSDYERSEWRESIQKLQK--KDLQSCVLSTLELQVLTSSCFKLRTVHNIPVTSNKDDEESSGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWHVDVI------EMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRER------SKVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRP 694          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 103.605 bits (257), Expect = 4.439e-25
Identity = 50/149 (33.56%), Postives = 89/149 (59.73%), Query Frame = 2
Query: 2381 PMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYD-LHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPP 2824
            PM++  C K IE  GL  EG+YR+SG    I ++    +++   A  +  +YD ++ ITG +K+Y R+LP PL+  + Y + ++ +KL +  ER    +E +  LP  ++ ++ +++ H ++V  +S +N M A NL ++ GPTL+ PP
Sbjct:   46 PMVVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRLLPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPP 194          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 9.591e-24
Identity = 54/179 (30.17%), Postives = 95/179 (53.07%), Query Frame = 2
Query: 2285 RQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            R   ++K  +FG  L  +  RE         VP  +    + ++  GL  +GIYR+SG+   I +L   ++     ++   +  D+H ITG +KM+ RELPEPL   N ++  +   KL++  E+ ++  E +  LP+PN  T+  + +H +KV+A    N+M   ++ ++ GPTL+ P
Sbjct:  410 RDKGLIKEQVFGCPLAMLCERENT------TVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHEEKVSLDESHWEDIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQDSREKLTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLLRP 582          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 106.301 bits (264), Expect = 1.424e-23
Identity = 59/196 (30.10%), Postives = 106/196 (54.08%), Query Frame = 2
Query: 2273 ELLKRQPSI--------MKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPN 2836
            +L+ R+P++        +K  +FG  L  +  RE         VP+ +  C   +E   L+ +G+YR+SG++  I +L   ++ +    + +    D++ ITG +K++ RELPEPL+    +E+ +   K+ E   R     ++I  LP PNH+T+ F+++H + V+AH  KN+M   N+ ++  PTL+ P  DP 
Sbjct:  584 KLITRRPTLQTLKDKGYIKEQVFGCPLACLCEREN------SMVPLFVRMCMIALEWQRLEIDGVYRVSGNQATIQKLRIMVDHDEHVDLDDSQWEDINVITGALKLFFRELPEPLVPYIFFEQFIAAIKIFEYHNRVKCMKDLINILPLPNHNTMKFLIRHLKTVVAHGEKNRMSMQNMAIVFAPTLLRPEVDPG 773          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 96.6709 bits (239), Expect = 4.639e-22
Identity = 52/173 (30.06%), Postives = 89/173 (51.45%), Query Frame = 2
Query: 2312 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTY-DLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHF--QKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            +FG  L ++V   +        +PM++  C   IE  GL  EG+YR+SG  + + E+    +K    A  +   Y D++ ITG +K+Y RELP PL+    Y   ++ AK+ +  ER  +    + +LP  ++ T+  ++ H   ++V      N M + NL ++ GPTL+ P
Sbjct:  109 VFGCDLTALVKAHRG------RLPMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERLEQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRP 275          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.586e-20
Identity = 59/191 (30.89%), Postives = 96/191 (50.26%), Query Frame = 2
Query: 2276 LLKRQPS--------IMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQ-KVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            L+ R+P+        I+K  +FG  L+++  RE      V N   + V C   +E +GL  +GIYR+SG+   I +L   ++      +      D+H ITG +KM+ RELPEPL     +   +   K+++  E+     ++I  LP  N  T+  +  H   +V+AH   N+M   NL ++ GPTL+ P
Sbjct:  391 LISRRPTRQALEEKGIIKEQVFGCPLQTLCEREGSA---VPNFARLSVQC---VERTGLQVDGIYRVSGNLATIQKLRFIVDHEEKLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINAIKIKDYAEKIRCMGKLIAILPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTLLRP 575          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 84.7297 bits (208), Expect = 5.746e-17
Identity = 59/179 (32.96%), Postives = 91/179 (50.84%), Query Frame = 2
Query: 2312 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNK----NPSYAISNLYTYDLHTITGIVKMYLRELPEPLL---MTNNYERIL----QIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLI 2815
            +FG  L+ V  RE   N L+   P I+V   + IE  GLDE G+YRI GS   IN L    ++    + S+ + +   ++++ I G  KMYLRELP+ L    M N++  +       A + EE +R    NE++  LP   + T+  ++ H  KV  H   N+M A NL ++   + I
Sbjct: 1964 IFGVPLEDVCERE---NTLI---PTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRM--MNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFI 2134          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 74.7146 bits (182), Expect = 2.064e-14
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = 2
Query: 2312 LFGFSLKSV--VTRE----KKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYA--ISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYE----RILQIAKLEEEVERFSR-YNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCD---PNKQGMNNSNIAFETVHS 2884
            +FG SL+    V +E    +K    + ++P++I    K ++++ LD  GI+RI+GS   + EL    +K P Y         +++H I  ++K YL  L EPL+    Y+     IL+  K+ E  E+  + Y ++ + LP+ N   ++++         +  KN M A NL  I+ P+L+  P D   P +   + + I F  +H+
Sbjct:   47 VFGVSLEESLKVAQEEVIIQKSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRELQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYDIFRNPILENPKINEHKEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLLSHPKDEMCPKEYEASRTVIEFLILHA 253          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 73.1738 bits (178), Expect = 1.347e-13
Identity = 48/179 (26.82%), Postives = 97/179 (54.19%), Query Frame = 2
Query: 2315 FGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYT-----YDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPN 2836
            FG  L+S++  E+      + VP I+  C   I+  GLD+EGIYR S +  ++++L ++++K+P+     L +      D++ +  ++K +   LP+ +L       I    ++E+   R +  + +I +LP+  + T+  ++ H ++V+AH  +N+M    L +I GPT+   P +P+
Sbjct:  470 FGVPLESLIEFEQ------DMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIA--PANPD 640          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 68.1662 bits (165), Expect = 5.128e-12
Identity = 54/197 (27.41%), Postives = 91/197 (46.19%), Query Frame = 2
Query: 2306 TGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIE--DSGLDEEGIYRISGSKNEINELYKKLNK---NPSYAISNLYT-YDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERF---------------------SRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLI 2815
            + L+G SL +    E         +PMI+  C   IE  +  +  EGIYR SGS+  I E+ K+ +      +    N+ T  DL+ +TG++K YLR+LP P+     YE ++++ K ++ +E                       S    ++  LP  ++  +  + +H +KV  +S  N+M   NL L+  P LI
Sbjct:  786 SNLYGSSLVARCNYENN------EIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 67.0106 bits (162), Expect = 1.242e-11
Identity = 60/198 (30.30%), Postives = 94/198 (47.47%), Query Frame = 2
Query: 2312 LFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIE--DSGLDEEGIYRISGSKNEINELYKKLNKNPSY-------AISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEP--------------------NHSTVIFVL-KHFQKVMAHSTKNQMIAGNLGLILGPTLI 2815
            L+G SL++    EK        VP+II  C  RIE  D GL+ EG+YR SGS+  + E+  +  +N S         ++ L   D+H +  ++K YLR+LP+P+L  + Y+ ++ + +  + +ER    N+  L  P+                      H  V+ VL  H  KV   S +N M   NL L+  P+LI
Sbjct:  785 LYGSSLQARCAYEK------STVPIIIRCCIDRIEKDDIGLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLI 976          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 196.823 bits (499), Expect = 5.659e-52
Identity = 174/779 (22.34%), Postives = 350/779 (44.93%), Query Frame = 2
Query:  617 LLNHESHHLCLLTTIQQYKYILIQSKVSDEIVW------HIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALI---------ELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKL--EETLRNLQ-----SNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESND----RRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGV-SGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNES-----------------FDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            +++ E  +L  L+T+ +Y      S  +   +        IFY I +L          LE+    ++ + +     L L     V  +EY+ N  TA+          +   +F K      AI E+        L+ L +KP++ +   + ++ +L+  T ++     +  +  +  LQ     S  D+    +   ++ +  L    F+ +L   VRK RH+FLF+ +++C K+K+                   S +Q       E++  KW++ L ++ LH  +  E+        + +   LK +I  LK ++  E+     +D         K+  ++++      I  ++++   ++ + +  LLL  P+    + +   K +TLL  S  +   WK  +L + ++   + +  +S+  +   LE+ ++  +   +   S+  D  + +GVL  ++    G +     Y ++EVD F     KARTKI   +    W++                  FD++++ ++ + I VY    Y   ++   G    QL  ++ L     +T+++  ++   +TL  SL+Y    + ++R+ S+   G+FG  +++V +RE        ++P+I++ C + IE  GL+E GIYR+SG+ +++  L +  ++N   A+  +   D+H + G+ KMYLR+LPEPL     Y++ ++   + +  E+     E+  SLP PN  T  ++ +H +KV   S  ++M   NL  + GP ++ P
Sbjct:   45 VMDSEKGYLLCLSTLHKYMKPFKASLSTSAPILTVADFNKIFYKIDELFTIHSKFYNDLEARVASWNPNKIIGDLFLSLVEQFDV-YREYIMNYKTAIDTIHKCKSNEQFSQIFSKEIKL-TAIQEVT------TLEGLFSKPVDRIGRYVTVLNDLMKQTPQDHPDHSILTDVQVYTLQFISRISGGDQKDGPHFPRVKRDHHLIKDGFLVELTDGVRKFRHLFLFNDVLICTKRKI-------------------SGRQ-------EQYVSKWYLQLSDVQLHPHENSEAAQIVPVASQADFDLLKGRIVSLKAEIKQEQGMTGQSDNSPDASPSSKQKRAHST------INKMVEKLKKKLAQQEAALLLAIPSLPLHLYHRQGKTYTLLCKSDVERADWKEAMLPLLKQDN-LPSGALSLFELQTLLEACKKLRTCKTIGKVSIKEDKELFNGVLYVHVQNGKGFHRS-DLYCTLEVDHFGQFVKKARTKIAKTTGDPVWDQGTGGETLDTCPFINMSQDFDLEVEGTKELRIHVYSKSRYTLQRDEECGLGRIQLR-RESLADLKKRTITIALDKQGAITL--SLQYSKTRQGIERKKSVNSVGVFGVDIETVTSRESC------DIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRP 772          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Match: EDO38242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK1])

HSP 1 Score: 106.686 bits (265), Expect = 2.257e-26
Identity = 69/184 (37.50%), Postives = 103/184 (55.98%), Query Frame = 2
Query: 2276 LLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNP-SYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSR----YNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTL 2812
            LLKR  S  K+G+FGF L   VT E + +    +VP+++  C   IE  GL+  G+YRISG+     EL    ++N  +  IS     D++ ITGI+K YLRELPEPL+     E + + AK E + ++        +E++  LP+PN  T++F+L H + VM     N+M A NL + L P +
Sbjct:   13 LLKRVQSSKKSGVFGFRLN--VTSELEQS----SVPLLVRKCVLEIEKRGLESVGLYRISGNARRKKELRGFFDENSEAVDISEENCPDINVITGILKDYLRELPEPLITEKMTEGLRKAAKNEIQDKKVDEQKQVMSELLSGLPDPNRHTLVFILNHLRHVMEKKEFNKMDARNLSVCLAPVM 190          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 105.916 bits (263), Expect = 5.481e-24
Identity = 51/157 (32.48%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 2381 PMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISN--------LYTYD-LHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPP 2824
            P ++  C   +E  GLD EG+YR+SG  ++I  L    +K  ++   N        L TYD ++TITG+ K+Y R+LP PL+    Y + +  AK +++  R    ++ +  LP+ ++ T+ F++ H  +V    +KN M   NL ++ GPTL+  P
Sbjct:  269 PFVVDICINEVEKRGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFIAAAKTQDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAP 425          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Match: EDO31406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY14])

HSP 1 Score: 97.4413 bits (241), Expect = 5.404e-21
Identity = 50/148 (33.78%), Postives = 86/148 (58.11%), Query Frame = 2
Query: 2381 PMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKN-PSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            P+++  C   IE+ G+  +GIYR+SGS + I +L    + + P       Y  D+H I+ ++KMY RELP PLL  + Y++ +   ++ +E ER    + V+  LP P++ T+ ++L+H  KV +H+ +  M A NL ++  P L+ P
Sbjct:  293 PLVLEKCAAVIEEHGI-VDGIYRLSGSSSIIQKLRFLFDGDEPPELDDEYYLRDVHCISSLLKMYFRELPNPLLTYSLYDKFVSAIQITDEKERKVAIHHVVQQLPPPHYRTLEYLLQHLAKVASHAGQTAMHAKNLAIVWAPNLLKP 439          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 93.9745 bits (232), Expect = 1.233e-19
Identity = 47/176 (26.70%), Postives = 100/176 (56.82%), Query Frame = 2
Query: 2315 FGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYK--KLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPN 2836
            F  S+K +  RE         +P ++ +C + I+  GLD  GI+R+SGS  +IN++ +  +  ++P   +++    D++ + G++++Y REL +PL  +++Y++ ++ ++     +   +   VI  LP+  +  + ++ K  ++V  HS +N+M A NL ++ GPTL+  P + +
Sbjct:  429 FQLSIKQITGRE---------IPEVVESCVRFIKRFGLDHPGIFRLSGSSTDINDMKQLFECGRDPLAGLNHWK--DINAVAGLLRVYFRELEDPLFPSSHYQQFIEASRFPTNEDVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLLRIPSEQD 593          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 213.001 bits (541), Expect = 8.595e-57
Identity = 197/740 (26.62%), Postives = 326/740 (44.05%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFD-----NHLVK-FSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG-------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR-------RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE--HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYE------IKNYGENK--ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D++   K     L     ++D      HL K  +  L +Y       K +V N   AL   +   + N  F+K    +  +G        ++ ++AL+ KPI+ +  S  ++ +L+  T E+  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K      HQ                        +++ KW+I L +L     +T + +D         ++EI  +K KI  LK ++  EK                          +  K +S ++R   ++ + ++ LLL SPT  F + N   K    LL S  +   W+  I K+Q++     I   Y  +  + N     R   +I            G+ G L   +    G       Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE      + N  +N+  + ++G  + QL+P+       +K   M   E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLPEPN  T + +L H ++V      N+M   NL  + GPTL+ P
Sbjct:  131 IFYKIQDILEIHKEFYDALSPSIQQWDEKVTVGHLFKKLASQLGVY-------KAFVDNYKIALETAEKCSQANIQFQKISENLKVKGPKDSKDCSTVSMEALLYKPIDRVTRSTLVLHDLLKHTPEDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQ------------------------QYECKWYIPLADLTF---QTPDDSDPCPSIQVLPEHEIEEMKMKISVLKNEIQKEK--------------------------KAPKGQSRVERLRKKMNEQESWLLLHSPTIPFRVHNKHGKTFLFLLSSDYERSEWRESIQKLQKKDLQVCILTTY-ELQVLTNSCVKLRTVHNIPVTGNKDDEESSGLYGFLHVIVHSAKGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQ----SKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRP 798          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 212.231 bits (539), Expect = 9.966e-57
Identity = 197/740 (26.62%), Postives = 326/740 (44.05%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFD-----NHLVK-FSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG-------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR-------RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE--HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYE------IKNYGENK--ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D++   K     L     ++D      HL K  +  L +Y       K +V N   AL   +   + N  F+K    +  +G        ++ ++AL+ KPI+ +  S  ++ +L+  T E+  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K      HQ                        +++ KW+I L +L     +T + +D         ++EI  +K KI  LK ++  EK                          +  K +S ++R   ++ + ++ LLL SPT  F + N   K    LL S  +   W+  I K+Q++     I   Y  +  + N     R   +I            G+ G L   +    G       Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE      + N  +N+  + ++G  + QL+P+       +K   M   E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLPEPN  T + +L H ++V      N+M   NL  + GPTL+ P
Sbjct:   94 IFYKIQDILEIHKEFYDALSPSIQQWDEKVTVGHLFKKLASQLGVY-------KAFVDNYKIALETAEKCSQANIQFQKISENLKVKGPKDSKDCSTVSMEALLYKPIDRVTRSTLVLHDLLKHTPEDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQ------------------------QYECKWYIPLADLTF---QTPDDSDPCPSIQVLPEHEIEEMKMKISVLKNEIQKEK--------------------------KAPKGQSRVERLRKKMNEQESWLLLHSPTIPFRVHNKHGKTFLFLLSSDYERSEWRESIQKLQKKDLQVCILTTY-ELQVLTNSCVKLRTVHNIPVTGNKDDEESSGLYGFLHVIVHSAKGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQ----SKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRP 761          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 212.616 bits (540), Expect = 1.066e-56
Identity = 197/740 (26.62%), Postives = 326/740 (44.05%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFD-----NHLVK-FSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG-------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR-------RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE--HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYE------IKNYGENK--ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D++   K     L     ++D      HL K  +  L +Y       K +V N   AL   +   + N  F+K    +  +G        ++ ++AL+ KPI+ +  S  ++ +L+  T E+  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K      HQ                        +++ KW+I L +L     +T + +D         ++EI  +K KI  LK ++  EK                          +  K +S ++R   ++ + ++ LLL SPT  F + N   K    LL S  +   W+  I K+Q++     I   Y  +  + N     R   +I            G+ G L   +    G       Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE      + N  +N+  + ++G  + QL+P+       +K   M   E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLPEPN  T + +L H ++V      N+M   NL  + GPTL+ P
Sbjct:  137 IFYKIQDILEIHKEFYDALSPSIQQWDEKVTVGHLFKKLASQLGVY-------KAFVDNYKIALETAEKCSQANIQFQKISENLKVKGPKDSKDCSTVSMEALLYKPIDRVTRSTLVLHDLLKHTPEDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQ------------------------QYECKWYIPLADLTF---QTPDDSDPCPSIQVLPEHEIEEMKMKISVLKNEIQKEK--------------------------KAPKGQSRVERLRKKMNEQESWLLLHSPTIPFRVHNKHGKTFLFLLSSDYERSEWRESIQKLQKKDLQVCILTTY-ELQVLTNSCVKLRTVHNIPVTGNKDDEESSGLYGFLHVIVHSAKGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQ----SKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRP 804          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 213.001 bits (541), Expect = 3.160e-56
Identity = 195/734 (26.57%), Postives = 324/734 (44.14%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEG-------KSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDR-------RKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQRE--HKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYE------IKNYGENK--ESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IFY I D++   K     L     ++D  +        L + L V  K +V N   AL   +   + N  F+K    +  +G        ++ ++AL+ KPI+ +  S  ++ +L+  T E+  D   L++ LR   N  S+ +E     + ++     E    ++    VE +    RKLRHVFLF+ +++CAK K      HQ                        +++ KW+I L +L     +T + +D         ++EI  +K KI  LK ++  EK                          +  K +S ++R   ++ + ++ LLL SPT  F + N   K    LL S  +   W+  I K+Q++     I   Y  +  + N     R   +I            G+ G L   +    G       Y ++EVDSF     KA+T++   ++   WNE F+I+L+ SQ + IL YE      + N  +N+  + ++G  + QL+P+       +K   M   E   + +E S+K+ +++  LKR PS  ++G+FG  +  V  RE+        VP I+  C + +E  G+DE GIYRISG   +I  L    + N    +  L   D++ I G +K+Y RELPEPLL    Y   ++   L +   + +    ++ SLPEPN  T + +L H ++V      N+M   NL  + GPTL+ P
Sbjct:  375 IFYKIQDILEIHKEFYDALSPSIQQWDEKVTVGHLFKKLASQLGV-YKAFVDNYKIALETAEKCSQANIQFQKISENLKVKGPKDSKDCSTVSMEALLYKPIDRVTRSTLVLHDLLKHTPEDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVE-VSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQ------------------------QYECKWYIPLADLTF---QTPDDSDPCPSIQVLPEHEIEEMKMKISVLKNEIQKEK--------------------------KAPKGQSRVERLRKKMNEQESWLLLHSPTIPFRVHNKHGKTFLFLLSSDYERSEWRESIQKLQKKDLQVCILTTY-ELQVLTNSCVKLRTVHNIPVTGNKDDEESSGLYGFLHVIVHSAKGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQ----SKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERS------KVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRP 1042          
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Match: bcr (breakpoint cluster region protein [Source:NCBI gene;Acc:101174443])

HSP 1 Score: 206.838 bits (525), Expect = 5.760e-54
Identity = 188/735 (25.58%), Postives = 322/735 (43.81%), Query Frame = 2
Query:  719 IFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKC---KEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMC-------LDALIAKPINWLCNSLELIKNLIDCTDEEQ-DRQKLEETLR---NLQSNEDESKKSNKNSL-----ETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIES---NDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPD-KPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDD---GVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEI--------KNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 2821
            IF+ + +L    K     L     ++ +H      + DL+  L  +    + ++ N   A+   +   + N  F +    +       C       L+AL+ KP++ +  S  ++ +L+  T     D   L + LR   N  S+ +E     + S+     E    L+ S  VE L    RKLRHVFLF+ +++CAK K Q          +G +N++              +D KW+I L  L     +  +          E+  +K KI  L+ ++  EK                          R  K   VIDR   ++ + ++ LLL+SP+    + N  + K ++ L+ S  +   W+ +++K Q + K +    ++   +     S  +  ++  +  S+   +D   G+ G L   +    GL      Y ++EVDSF     KA+T++   ++  +WNE F+I+L+ SQ + +L YE         K  G+  + ++G  +  L P+    +   +TV  ++    KL    S+K+ ++   LKR P+    G+FG  + SV  RE+        VP I+  C + IE  G++E GIYR+SG   +I  L    + N       +   D++ I G +K+Y RELPEPL     Y        L + V + S    ++LSLPEPN  T +F+L H ++V    + N+M   NL  + GPTL+ P
Sbjct:  645 IFFKVPELYEIHKDFYDALLPRVQQWSHH----QRVGDLFQKLAGQLGVYRAFLDNYELAVETAEKCCQANAQFSEISENLKVRSPKDCKETAKTSLEALLYKPVDRVTRSTLVLHDLLKHTPTSHPDHPLLLDALRISQNFLSSINEETTPRRQSMTVKKGENRQLLKDSFMVE-LVEGARKLRHVFLFTDLLLCAKLKKQ----------IGGKNQQ--------------YDSKWYIPLTELTFQGPEEADPLTIPQVPDEELDAIKVKISHLRSEIQKEK--------------------------RANKGSKVIDRLRKKLCEQESLLLLMSPSMPLRLYNKNNGKSYSFLISSDYERAEWR-EVIKEQHK-KCLKATSLTSMELQMLTSSCLKLQTVHHIPLSTNKDEDESSGLYGFLNVIVHSASGLKQSLNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYEKCYNKTKQNKEDGDGTDRIMGKGQIPLEPQSLQGKDWQRTVIPMNGIEVKL----SMKFTSREFSLKRTPTRKPMGVFGVKISSVTKRERS------KVPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITLSDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRP 1312          
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 1940.62 bits (5026), Expect = 0.000e+0
Identity = 959/964 (99.48%), Postives = 962/964 (99.79%), Query Frame = 2
Query:   83 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFXXXXXXXXXXXXIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 2974
            MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEG+HS F EPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKN+PTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTK+CTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL
Sbjct:    1 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGKHSSFREPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNVPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 964          
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 1899.4 bits (4919), Expect = 0.000e+0
Identity = 944/964 (97.93%), Postives = 947/964 (98.24%), Query Frame = 2
Query:   83 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFXXXXXXXXXXXXIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 2974
            MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEG+HS F EPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKN+PTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD               NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTK+CTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL
Sbjct:    1 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGKHSSFREPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNVPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD---------------NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 949          
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 1878.6 bits (4865), Expect = 0.000e+0
Identity = 937/964 (97.20%), Postives = 940/964 (97.51%), Query Frame = 2
Query:   83 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFXXXXXXXXXXXXIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 2974
            MNEQESEQSDIRVVTRDSTAIHSSRSKI       SSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEG+HS F EPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKN+PTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD               NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTK+CTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL
Sbjct:    1 MNEQESEQSDIRVVTRDSTAIHSSRSKIS------SSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGKHSSFREPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNVPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD---------------NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 943          
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 1865.12 bits (4830), Expect = 0.000e+0
Identity = 932/964 (96.68%), Postives = 935/964 (96.99%), Query Frame = 2
Query:   83 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFXXXXXXXXXXXXIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 2974
            MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLL            FDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEG+HS F EPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKN+PTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD               NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTK+CTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL
Sbjct:    1 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLL------------FDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGKHSSFREPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNVPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD---------------NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 937          
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 1848.94 bits (4788), Expect = 0.000e+0
Identity = 925/964 (95.95%), Postives = 929/964 (96.37%), Query Frame = 2
Query:   83 MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFXXXXXXXXXXXXIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 2974
            MNEQESEQSDIRVVTRDSTAIHSSRSKI                  +FDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEG+HS F EPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKN+PTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD               NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTK+CTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL
Sbjct:    1 MNEQESEQSDIRVVTRDSTAIHSSRSKI------------------SFDISKIDENENQCIKEFYKLNLNPPIDQLDDEESEGKHSSFREPIYESSTIIRSDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHSRRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYILIQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILDLYTLLHVKCKEYVKNVPTALIELKSLFEKNPNFRKAINEINYEGKSMCLDALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKSNKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNHQTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESNDRRKNEITTLKDKIRDLKLQLIAEKSKLNSTD---------------NSAFRKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVKDLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSLFHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNKAAISFEKMIGHSFL 931          
The following BLAST results are available for this feature:
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABR4.160e-6227.29ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
ABR4.160e-6227.29ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
ABR4.160e-6227.29ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
ABR5.563e-6227.29ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
ABR5.563e-6227.29ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-3255.416e-2029.94WW domain-containing protein tag-325 [Source:UniP... [more]
chin-16.534e-2033.95CHImaeriN (Rac-GTPase-activating protein) homolog ... [more]
pac-11.076e-1931.88GTPase-activating protein pac-1 [Source:UniProtKB... [more]
pac-11.106e-1931.88GTPase-activating protein pac-1 [Source:UniProtKB... [more]
pac-11.204e-1931.88GTPase-activating protein pac-1 [Source:UniProtKB... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP1A3.941e-4525.42gene:FBgn0025836 transcript:FBtr0340053[more]
RhoGAP1A4.900e-4525.42gene:FBgn0025836 transcript:FBtr0340054[more]
RhoGAP1A5.025e-4525.42gene:FBgn0025836 transcript:FBtr0112920[more]
RhoGAP1A5.025e-4525.42gene:FBgn0025836 transcript:FBtr0112919[more]
RhoGAP100F1.910e-2526.80gene:FBgn0039883 transcript:FBtr0343539[more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-91m11.51.221e-5926.39si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.52.273e-5926.69si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.57.808e-5828.80si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.51.238e-5728.80si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
bcr3.357e-4724.69BCR activator of RhoGEF and GTPase [Source:ZFIN;Ac... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abr5.877e-6327.73ABR, RhoGEF and GTPase activating protein [Source:... [more]
abr6.912e-6327.73ABR, RhoGEF and GTPase activating protein [Source:... [more]
abr2.739e-6227.73ABR, RhoGEF and GTPase activating protein [Source:... [more]
bcr1.875e-5728.48BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr1.875e-5728.22BCR, RhoGEF and GTPase activating protein [Source:... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abr2.915e-6227.45active BCR-related gene [Source:MGI Symbol;Acc:MGI... [more]
Abr3.194e-6227.45active BCR-related gene [Source:MGI Symbol;Acc:MGI... [more]
Abr5.372e-6227.45active BCR-related gene [Source:MGI Symbol;Acc:MGI... [more]
Abr6.798e-6227.45active BCR-related gene [Source:MGI Symbol;Acc:MGI... [more]
Abr3.884e-6127.45active BCR-related gene [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AVG0|ABR_XENLA2.163e-6327.71Active breakpoint cluster region-related protein O... [more]
sp|A4II46|ABR_XENTR3.662e-6227.73Active breakpoint cluster region-related protein O... [more]
sp|A0A0G2JTR4|ABR_RAT1.910e-6127.29Active breakpoint cluster region-related protein O... [more]
sp|Q5SSL4|ABR_MOUSE2.039e-6127.45Active breakpoint cluster region-related protein O... [more]
sp|Q12979|ABR_HUMAN3.412e-6127.29Active breakpoint cluster region-related protein O... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1EGD35.534e-6929.99Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A3S1I2154.114e-6728.10Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0K8RYL01.231e-6027.52Active breakpoint cluster region-related protein i... [more]
A0A1L8HD473.605e-6027.71Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A5G3L8129.228e-6027.73Active breakpoint cluster region-related protein O... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABR8.856e-6126.50ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.008e-6026.50ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.626e-6026.50ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.581e-5926.35ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.824e-5626.18ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chn24.439e-2533.56chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
ENSPMAT00000004676.19.591e-2430.17pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ARHGAP151.424e-2330.10Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
chn24.639e-2230.06chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
ENSPMAT00000004494.11.586e-2030.89pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BEM25.746e-1732.96Rho GTPase activating protein (RhoGAP); involved i... [more]
BAG72.064e-1427.54Rho GTPase activating protein (RhoGAP); stimulates... [more]
RGD11.347e-1326.82GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA15.128e-1227.41GTPase-activating protein for polarity-establishme... [more]
RGA21.242e-1130.30GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474415.659e-5222.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382422.257e-2637.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421765.481e-2432.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314065.404e-2133.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468651.233e-1926.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABR8.595e-5726.62ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR9.966e-5726.62ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.066e-5626.62ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR3.160e-5626.57ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
bcr5.760e-5425.58breakpoint cluster region protein [Source:NCBI gen... [more]
back to top
BLAST of Active breakpoint cluster region-related protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025211.10.000e+099.48SMESG000025211.1[more]
SMESG000025211.10.000e+097.93SMESG000025211.1[more]
SMESG000025211.10.000e+097.20SMESG000025211.1[more]
SMESG000025211.10.000e+096.68SMESG000025211.1[more]
SMESG000025211.10.000e+095.95SMESG000025211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018430 ID=SMED30018430|Name=Active breakpoint cluster region-related protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3153bp
ATCAACTAACCTTCAAACTTTAAGTTCATAATATGAATTGAATTTTTAAG
TGGAAGTTAGCCAATAATTATTGCACTATATAATGAACGAACAAGAGTCA
GAACAGTCTGATATACGAGTAGTAACTCGAGATTCCACAGCTATTCACAG
CTCAAGATCTAAAATTAGACAACGGCCAGATCTTCTTTCATCAATGACGA
CTGATCTCACCGGAACTCACAATTTTGATATCAGCAAGATTGACGAGAAC
GAAAATCAATGCATTAAAGAATTTTACAAATTAAATTTGAATCCACCAAT
CGACCAATTAGACGATGAAGAATCAGAAGGACAACATTCAAGATTCCACG
AACCTATTTATGAAAGTTCAACTATTATTAGAAGTGATCGTCACAGAAAC
AGTTTTGACGATTCTGCAATTGAAACAAGAATCAAAGAATTGGAAGAAAG
TTATGGTTTTTTAGATACTGAGAATGATGCAGATTTATGTGGTGATCTGA
TTCAGACTGGTGACAACAAAAAGTCACATTCCAGAAGGTCTGAATCAACA
GAAAACCTGATATCAATATTTACAACAAATAATTCTAAAACGAATACTCT
GAATAATATTAAAATGTTACTGAATCATGAAAGCCACCATCTTTGTCTTT
TGACAACGATCCAGCAATACAAATACATTCTCATCCAATCAAAAGTCAGC
GATGAAATCGTCTGGCACATTTTCTATAACATCAGCGATCTGATTTACGC
ACAGAAATCACTCGTCACATATCTCGAATCAATGGCCACAGAATTTGATA
ATCATCTGGTAAAATTCAGTGAAATTTTGGATCTTTATACTCTGCTTCAT
GTTAAGTGCAAAGAATATGTCAAAAATATTCCAACAGCATTAATAGAATT
AAAATCTTTATTTGAAAAAAATCCAAATTTCAGAAAAGCTATTAATGAAA
TAAATTATGAAGGCAAATCGATGTGTCTCGATGCTTTGATCGCAAAACCC
ATCAATTGGCTGTGCAATTCCTTGGAGCTTATAAAGAATTTAATTGATTG
CACCGATGAAGAACAAGACAGACAAAAACTCGAAGAAACCTTAAGGAATT
TGCAAAGCAATGAAGATGAAAGTAAAAAGTCCAACAAAAATAGTTTAGAG
ACGAACAGTTTTTTAAGAAGCAGCTTATTTGTTGAACAGCTACCTTATGA
TGTGAGAAAACTTCGTCATGTGTTTCTTTTTTCTGGGATGATCGTATGCG
CGAAACAGAAATTGCAAACCGATTGTAATCATCAAACAAAAAATGTCCTT
GGACCTGAGAACGAAGAGAAATCCTCAAAGCAAATACCGGATGTAAAATC
TATTGAAAAGTTTGATGTTAAATGGTTCATCTGGTTAAAAAATTTAGTTT
TGCATTTATCAAAAACAATAGAAAGTAATGATAGAAGGAAAAATGAAATT
ACCACTTTGAAAGATAAAATAAGAGACTTGAAATTGCAGCTAATAGCAGA
GAAAAGCAAGTTGAATAGTACAGATGTAGTTCATCACGTACCAAAGCCTC
TAAAACGTTCACTGTCGAATAATTCTGCATTTCGAAAACTGAAAATCAAG
AGCGTTATTGATAGATTTTGCAATCAAATATTTAAAATTCAAACAGAACT
GCTACTGATATCCCCCACAACGGAGTTCGTGATCAGTAATGGTCCTGATA
AACCCCATACGCTTCTATTGCCCTCTGTAAAAGATCTCGAGATCTGGAAA
TGTGATATATTAAAAGTCCAAAGGGAACACAAACCCATAGACAATCCATA
CATGTCAATTACAGCTGTCAACAATTTCCTGGAAAGTTATCGTAGATATT
CATCTATTGTTGAAGTTGCGACAAGTTCGCTCTTTCATGATGATGGCGTG
TCAGGAGTTCTCGTCACGAATATATTCAAAGTTGACGGGTTGAATCCGGA
TTTCAGATATTATTTATCCATTGAGGTTGATTCGTTTAACTTGAACGAAT
TGAAAGCTCGAACCAAAATCTGTACCGGATCTTCAAGTTTGCAATGGAAT
GAATCGTTCGACATTGATCTCGACTGCAGTCAAATGATGAATATTTTGGT
GTACGAAATCAAAAATTACGGCGAAAATAAAGAGTCTTTGATTGGTTATT
TTGAATTTCAGCTGAATCCAAAAGATCATCTGAATCAACACATTACAAAA
ACTGTTTCAATGCTGAGTAATGAATCGGCGAAGTTAACCTTAGAGGCTTC
TTTAAAATATGAAGCTAAAAATGAACTCCTCAAACGGCAGCCTTCAATAA
TGAAGACCGGTCTTTTCGGATTTAGTTTGAAATCTGTGGTTACAAGGGAA
AAGAAAGGCAATGTTTTAGTTGAAAATGTCCCAATGATTATTGTAGCTTG
TTTTAAAAGAATCGAAGACTCTGGTTTGGACGAAGAAGGAATTTATCGGA
TATCTGGTAGTAAAAATGAAATAAATGAACTCTACAAAAAGCTGAACAAA
AATCCGTCATATGCAATTAGTAATCTCTATACGTACGATTTACATACAAT
TACCGGAATCGTTAAGATGTACTTGCGTGAGTTGCCGGAGCCGTTATTAA
TGACAAATAATTATGAACGAATATTGCAGATTGCAAAATTAGAGGAAGAG
GTCGAACGTTTCAGCAGGTACAATGAAGTTATTCTGAGTCTCCCTGAACC
AAATCATTCCACAGTCATATTTGTATTGAAACATTTCCAAAAAGTCATGG
CTCATTCAACTAAAAATCAAATGATTGCAGGCAATCTGGGTTTAATTCTT
GGTCCAACCCTAATAATGCCGCCTTGTGATCCTAATAAGCAAGGAATGAA
TAATTCGAATATTGCCTTTGAAACCGTGCATAGTATGCTTTTAGCCAGAG
CATTCACTCAAATTCTGATTGGTGTAAATAAAGCTGCTATATCCTTCGAA
AAAATGATTGGTCATAGTTTTTTGTAAATTACATCCAATAACTGACAACC
GCTGAGTTTTATAATTGTAAAGTGGTTTTTTTAAAATATTTTTTTCATTC
ACAGAATTGAAATGTGCTCTTATTTACTACTAACTTTTTTGTTAATAGTT
TTCGTAAATATATCTTTATAATCATTATATTTTGGTAAATAATTTTTATA
TAA
back to top

protein sequence of SMED30018430-orf-1

>SMED30018430-orf-1 ID=SMED30018430-orf-1|Name=SMED30018430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=965bp
MNEQESEQSDIRVVTRDSTAIHSSRSKIRQRPDLLSSMTTDLTGTHNFDI
SKIDENENQCIKEFYKLNLNPPIDQLDDEESEGQHSRFHEPIYESSTIIR
SDRHRNSFDDSAIETRIKELEESYGFLDTENDADLCGDLIQTGDNKKSHS
RRSESTENLISIFTTNNSKTNTLNNIKMLLNHESHHLCLLTTIQQYKYIL
IQSKVSDEIVWHIFYNISDLIYAQKSLVTYLESMATEFDNHLVKFSEILD
LYTLLHVKCKEYVKNIPTALIELKSLFEKNPNFRKAINEINYEGKSMCLD
ALIAKPINWLCNSLELIKNLIDCTDEEQDRQKLEETLRNLQSNEDESKKS
NKNSLETNSFLRSSLFVEQLPYDVRKLRHVFLFSGMIVCAKQKLQTDCNH
QTKNVLGPENEEKSSKQIPDVKSIEKFDVKWFIWLKNLVLHLSKTIESND
RRKNEITTLKDKIRDLKLQLIAEKSKLNSTDVVHHVPKPLKRSLSNNSAF
RKLKIKSVIDRFCNQIFKIQTELLLISPTTEFVISNGPDKPHTLLLPSVK
DLEIWKCDILKVQREHKPIDNPYMSITAVNNFLESYRRYSSIVEVATSSL
FHDDGVSGVLVTNIFKVDGLNPDFRYYLSIEVDSFNLNELKARTKICTGS
SSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHL
NQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLK
SVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINEL
YKKLNKNPSYAISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQI
AKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAG
NLGLILGPTLIMPPCDPNKQGMNNSNIAFETVHSMLLARAFTQILIGVNK
AAISFEKMIGHSFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0030424axon
GO:0042995cell projection
GO:0043197dendritic spine
GO:0045202synapse
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR035899DBL_dom_sf
IPR037769Abr/Bcr
IPR000198RhoGAP_dom
IPR000008C2_dom
IPR000219DH-domain
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0035023regulation of Rho protein signal transduction
GO:0035556intracellular signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 146..176
NoneNo IPR availableCOILSCoilCoilcoord: 272..299
NoneNo IPR availableCDDcd00159RhoGAPcoord: 590..759
e-value: 1.58929E-41
score: 147.448
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 429..535
IPR000008C2 domainSMARTSM00239C2_3ccoord: 432..529
e-value: 7.9E-5
score: 32.0
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 2..167
e-value: 0.0092
score: 4.6
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 5..165
e-value: 3.9E-9
score: 37.0
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 1..173
score: 10.869
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 587..773
e-value: 1.9E-53
score: 193.6
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 590..738
e-value: 1.7E-41
score: 141.6
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 570..768
score: 40.798
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 555..767
e-value: 3.6E-51
score: 175.4
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 567..759
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 430..554
e-value: 9.2E-7
score: 30.9
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 1..188
e-value: 1.9E-11
score: 45.8
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 3..164
IPR037769Abr/BcrPANTHERPTHR23182BREAKPOINT CLUSTER REGION PROTEIN BCRcoord: 35..739