Tubulin alpha chain, nucleomorph
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30018426 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 3
Homology
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Match: TUBA8 (tubulin alpha 8 [Source:HGNC Symbol;Acc:HGNC:12410]) HSP 1 Score: 50.447 bits (119), Expect = 1.712e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 433 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 463
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Match: TUBA8 (tubulin alpha 8 [Source:HGNC Symbol;Acc:HGNC:12410]) HSP 1 Score: 50.0618 bits (118), Expect = 2.077e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768]) HSP 1 Score: 49.6766 bits (117), Expect = 3.767e-7 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR D+ ALE+DYE++ +S D Sbjct: 479 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAD 511
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768]) HSP 1 Score: 49.2914 bits (116), Expect = 4.564e-7 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR D+ ALE+DYE++ +S D Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGADSAD 441
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408]) HSP 1 Score: 48.9062 bits (115), Expect = 5.324e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688]) HSP 1 Score: 49.2914 bits (116), Expect = 1.481e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 412 VGEGMEEGEFTEAREDLAALEKDYEEVGADS 442
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688]) HSP 1 Score: 49.2914 bits (116), Expect = 1.596e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 407 VGEGMEEGEFTEAREDLAALEKDYEEVGADS 437
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Match: Y19D2B.1 (pep chromosome:WBcel235:II:10922672:10922974:-1 gene:WBGene00012489.1 transcript:Y19D2B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y19D2B.1) HSP 1 Score: 46.595 bits (109), Expect = 1.743e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 44 VGEGMEEGEFTEAREDLAALEKDYEEVGADS 74
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690]) HSP 1 Score: 48.9062 bits (115), Expect = 2.087e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 407 VGEGMEEGEFTEAREDLAALEKDYEEVGADS 437
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690]) HSP 1 Score: 48.9062 bits (115), Expect = 2.087e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 407 VGEGMEEGEFTEAREDLAALEKDYEEVGADS 437
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087) HSP 1 Score: 48.521 bits (114), Expect = 3.500e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFAEAREDLAALEKDYEEVGIDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639) HSP 1 Score: 48.521 bits (114), Expect = 3.638e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538) HSP 1 Score: 48.521 bits (114), Expect = 3.854e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588]) HSP 1 Score: 50.447 bits (119), Expect = 1.013e-7 Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR D+ ALE+DYE++A +S D Sbjct: 415 VGEGMEEGEFSEAREDMAALEKDYEEVAADSTD 447
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Match: tuba4l (tubulin, alpha 4 like [Source:ZFIN;Acc:ZDB-GENE-030131-5588]) HSP 1 Score: 50.447 bits (119), Expect = 1.029e-7 Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR D+ ALE+DYE++A +S D Sbjct: 408 VGEGMEEGEFSEAREDMAALEKDYEEVAADSTD 440
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8]) HSP 1 Score: 50.0618 bits (118), Expect = 1.427e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8]) HSP 1 Score: 50.0618 bits (118), Expect = 1.445e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 437 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 467
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860]) HSP 1 Score: 50.0618 bits (118), Expect = 1.713e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415]) HSP 1 Score: 50.0618 bits (118), Expect = 2.316e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 419 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 449
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415]) HSP 1 Score: 50.0618 bits (118), Expect = 2.442e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415]) HSP 1 Score: 50.0618 bits (118), Expect = 2.466e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Match: ENSXETT00000053522.1 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:100497157]) HSP 1 Score: 49.6766 bits (117), Expect = 2.661e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 408 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Match: ccdc171 (coiled-coil domain containing 171 [Source:Xenbase;Acc:XB-GENE-1003303]) HSP 1 Score: 49.6766 bits (117), Expect = 2.661e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 408 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Match: Tuba8 (tubulin, alpha 8 [Source:MGI Symbol;Acc:MGI:1858225]) HSP 1 Score: 50.447 bits (119), Expect = 1.234e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406]) HSP 1 Score: 48.9062 bits (115), Expect = 3.655e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408]) HSP 1 Score: 48.9062 bits (115), Expect = 3.655e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869]) HSP 1 Score: 48.1358 bits (113), Expect = 7.805e-7 Identity = 20/31 (64.52%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804]) HSP 1 Score: 48.1358 bits (113), Expect = 8.267e-7 Identity = 20/31 (64.52%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Match: sp|Q94572|TBA3_HOMAM (Tubulin alpha-3 chain OS=Homarus americanus OX=6706 PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.835e-7 Identity = 22/33 (66.67%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR DL ALE+DYE++ +S D Sbjct: 409 VGEGMEEGEFTEAREDLAALEKDYEEVGVDSAD 441
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Match: sp|Q5I2J3|TBA_GIBZE (Tubulin alpha chain OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 GN=TUB1 PE=3 SV=2) HSP 1 Score: 50.8322 bits (120), Expect = 6.349e-7 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++AT+S Sbjct: 409 VGEGMEEGEFSEAREDLAALERDYEEVATDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Match: sp|Q25008|TBA1_HOMAM (Tubulin alpha-1 chain OS=Homarus americanus OX=6706 PE=2 SV=1) HSP 1 Score: 50.8322 bits (120), Expect = 6.996e-7 Identity = 22/33 (66.67%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR DL ALE+DYE++ +S D Sbjct: 409 VGEGMEEGEFTEAREDLAALEKDYEEVGMDSAD 441
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Match: sp|Q25563|TBA13_NAEPR (Tubulin alpha-13 chain OS=Naegleria pringsheimi OX=234921 GN=TUBA13 PE=2 SV=1) HSP 1 Score: 50.447 bits (119), Expect = 7.784e-7 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSE 98 VGEGMEE EF EAR DL ALE+DYE++ T S+ Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTESQ 440
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Match: sp|Q2HJB8|TBA8_BOVIN (Tubulin alpha-8 chain OS=Bos taurus OX=9913 GN=TUBA8 PE=2 SV=1) HSP 1 Score: 50.447 bits (119), Expect = 7.844e-7 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. TrEMBL
Match: K7IW69 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=3 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 5.425e-6 Identity = 23/31 (74.19%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF+EAR DL ALE+DYE++AT+S Sbjct: 397 VGEGMEEVEFIEAREDLAALERDYEEVATDS 427
BLAST of Tubulin alpha chain, nucleomorph vs. TrEMBL
Match: A0A098VQM8 (Tubulin alpha chain OS=Mitosporidium daphniae OX=1485682 GN=DI09_43p40 PE=3 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 7.069e-6 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFI 107 VGEGMEE EF EAR DL ALE+DYE +AT+S DF+ Sbjct: 407 VGEGMEEGEFSEAREDLAALEKDYEQLATDSGDFM 441
BLAST of Tubulin alpha chain, nucleomorph vs. TrEMBL
Match: A0A1S0TEP5 (Tubulin alpha 2 OS=Loa loa OX=7209 GN=LOAG_15945 PE=4 SV=1) HSP 1 Score: 50.8322 bits (120), Expect = 9.410e-6 Identity = 23/33 (69.70%), Postives = 27/33 (81.82%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 +GEGMEE EF EAR DL ALE+DYE++A NS D Sbjct: 33 IGEGMEEGEFAEAREDLAALEKDYEEVALNSYD 65
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315]) HSP 1 Score: 49.6766 bits (117), Expect = 1.583e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Match: si:ch211-114n24.6 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:103034569]) HSP 1 Score: 49.6766 bits (117), Expect = 1.584e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Match: ENSAMXT00000019223.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418]) HSP 1 Score: 49.6766 bits (117), Expect = 1.598e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T++ Sbjct: 410 VGEGMEEGEFSEAREDLAALEKDYEEVGTDT 440
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418]) HSP 1 Score: 49.2914 bits (116), Expect = 2.050e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ T++ Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGTDT 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622]) HSP 1 Score: 49.2914 bits (116), Expect = 2.235e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 408 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593]) HSP 1 Score: 44.669 bits (104), Expect = 1.324e-6 Identity = 20/31 (64.52%), Postives = 24/31 (77.42%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DY ++ +S Sbjct: 410 VGEGMEEGEFTEAREDLAALERDYIEVGADS 440
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550]) HSP 1 Score: 44.669 bits (104), Expect = 1.338e-6 Identity = 20/31 (64.52%), Postives = 24/31 (77.42%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DY ++ +S Sbjct: 410 VGEGMEEGEFTEAREDLAALERDYIEVGADS 440
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Match: EDO46332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB6]) HSP 1 Score: 50.447 bits (119), Expect = 3.787e-8 Identity = 22/33 (66.67%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR DL ALE+DYE++ +S D Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGADSPD 441
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Match: EDO38064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX8]) HSP 1 Score: 48.9062 bits (115), Expect = 1.064e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 399 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 429
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Match: EDO40779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S698]) HSP 1 Score: 48.9062 bits (115), Expect = 1.154e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGADS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Match: EDO38091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY0]) HSP 1 Score: 48.9062 bits (115), Expect = 1.154e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3]) HSP 1 Score: 48.9062 bits (115), Expect = 1.154e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Match: ENSORLT00000020614.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455]) HSP 1 Score: 51.2174 bits (121), Expect = 4.835e-8 Identity = 24/41 (58.54%), Postives = 30/41 (73.17%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS-EDFIYKTEA 122 VGEGMEE EF EAR D+ ALE+DYE++ +S ED Y E+ Sbjct: 411 VGEGMEEGEFSEAREDMAALEKDYEEVGVDSIEDISYNNES 451
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Match: ENSORLT00000020468.2 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101155224]) HSP 1 Score: 50.447 bits (119), Expect = 1.060e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 451 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 481
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Match: ENSORLT00000047085.1 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101155224]) HSP 1 Score: 50.0618 bits (118), Expect = 1.177e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 473 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 503
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Match: tuba8l3 (tubulin alpha chain [Source:NCBI gene;Acc:101168255]) HSP 1 Score: 50.0618 bits (118), Expect = 1.443e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Match: ENSORLT00000000055.2 (tubulin alpha-1C chain [Source:NCBI gene;Acc:101166777]) HSP 1 Score: 49.6766 bits (117), Expect = 1.747e-7 Identity = 21/31 (67.74%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR D+ ALE+DYE++ T+S Sbjct: 409 VGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Match: SMESG000057127.1 (SMESG000057127.1) HSP 1 Score: 236.113 bits (601), Expect = 1.966e-76 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFIYKTEAHLLKKPPTFQQTSIKENTYEEREISKRSSKQKTDFEQGNFNDEKFINGKEESLEKDITVNDNNTNYSMFYKRNYR 347 VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFIYKTEAHLLKKPPTFQQTSIKENTYEEREISKRSSKQKTDFEQGNFNDEKFINGKEESLEKDITVNDNNTNYSMFYKRNYR Sbjct: 406 VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFIYKTEAHLLKKPPTFQQTSIKENTYEEREISKRSSKQKTDFEQGNFNDEKFINGKEESLEKDITVNDNNTNYSMFYKRNYR 520
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Match: SMESG000043298.1 (SMESG000043298.1) HSP 1 Score: 50.447 bits (119), Expect = 6.165e-8 Identity = 22/36 (61.11%), Postives = 29/36 (80.56%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFIY 110 VGEGMEE EFVEAR DL+ LE+DYE++ SE+ ++ Sbjct: 372 VGEGMEEGEFVEARDDLIKLEKDYEEVGLPSEENVH 407
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Match: SMESG000054547.1 (SMESG000054547.1) HSP 1 Score: 49.6766 bits (117), Expect = 1.359e-7 Identity = 22/33 (66.67%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNSED 101 VGEGMEE EF EAR DL ALE+DYE++ +S D Sbjct: 414 VGEGMEEGEFSEAREDLAALEKDYEEVGYDSAD 446
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Match: SMESG000009951.1 (SMESG000009951.1) HSP 1 Score: 48.9062 bits (115), Expect = 2.604e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGADS 439
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Match: SMESG000005505.1 (SMESG000005505.1) HSP 1 Score: 48.521 bits (114), Expect = 2.867e-7 Identity = 21/31 (67.74%), Postives = 25/31 (80.65%), Query Frame = 3 Query: 3 VGEGMEEAEFVEARSDLVALEQDYEDIATNS 95 VGEGMEE EF EAR DL ALE+DYE++ +S Sbjct: 409 VGEGMEEGEFSEAREDLAALEKDYEEVGIDS 439 The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 3
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 3
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 2
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 5
BLAST of Tubulin alpha chain, nucleomorph vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30018426 ID=SMED30018426|Name=Tubulin alpha chain, nucleomorph|organism=Schmidtea mediterranea sexual|type=transcript|length=435bpback to top protein sequence of SMED30018426-orf-1 >SMED30018426-orf-1 ID=SMED30018426-orf-1|Name=SMED30018426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp VGEGMEEAEFVEARSDLVALEQDYEDIATNSEDFIYKTEAHLLKKPPTFQback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|