Serine/threonine-protein phosphatase 2A regulatory subunit B

Overview
NameSerine/threonine-protein phosphatase 2A regulatory subunit B
Smed IDSMED30018418
Length (bp)2378
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase 2A regulatory subunit B (SMED30018418) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 2A regulatory subunit B (SMED30018418) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase 2A regulatory subunit B (SMED30018418) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 2A regulatory subunit B (SMED30018418) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018418

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018418h1SMcG0000620 dd_Smed_v4_14696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018418h1SMcG0000620 dd_Smed_v4_14696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Match: PPP2R3A (protein phosphatase 2 regulatory subunit B''alpha [Source:HGNC Symbol;Acc:HGNC:9307])

HSP 1 Score: 463.766 bits (1192), Expect = 4.787e-155
Identity = 228/436 (52.29%), Postives = 297/436 (68.12%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRE-------SNQSFRNSSN 2145
            S +IP+FYFP G P +       +  I      +E +          K+   E+ +I KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+   +H DASK   LL +     +E  DF PL+QDV+++HPGLTFL  A +FHSRYI TV+ RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LVAE+ +Q  + + + +       S   F N SN
Sbjct:   85 SINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEEQ----------KADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSN 509          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Match: PPP2R3A (protein phosphatase 2 regulatory subunit B''alpha [Source:HGNC Symbol;Acc:HGNC:9307])

HSP 1 Score: 450.669 bits (1158), Expect = 1.588e-151
Identity = 217/390 (55.64%), Postives = 280/390 (71.79%), Query Frame = 1
Query: 1009 HKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRE-------SNQSFRNSSN 2145
             K+   E+ +I KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+   +H DASK   LL +     +E  DF PL+QDV+++HPGLTFL  A +FHSRYI TV+ RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LVAE+ +Q  + + + +       S   F N SN
Sbjct:    6 QKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSN 394          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Match: PPP2R3A (protein phosphatase 2 regulatory subunit B''alpha [Source:HGNC Symbol;Acc:HGNC:9307])

HSP 1 Score: 469.929 bits (1208), Expect = 6.531e-150
Identity = 232/441 (52.61%), Postives = 304/441 (68.93%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKS---NEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFD--EVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRE-------SNQSFRNSSN 2145
            S +IP+FYFP G P +   +E+ L+ ++               TA + I + K D  E+ +I KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+   +H DASK   LL +     +E  DF PL+QDV+++HPGLTFL  A +FHSRYI TV+ RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LVAE+ +Q  + + + +       S   F N SN
Sbjct:  706 SINIPRFYFPEGLPDTCSNHEQTLSRIE---------------TAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSN 1130          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Match: PPP2R3B (protein phosphatase 2 regulatory subunit B''beta [Source:HGNC Symbol;Acc:HGNC:13417])

HSP 1 Score: 448.358 bits (1152), Expect = 2.657e-148
Identity = 213/443 (48.08%), Postives = 293/443 (66.14%), Query Frame = 1
Query:  799 DTKNLRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +  ++R T +S     V  R E       S  IP FYFPRG+P+ +  +  ++  I         +  T   + +       V +    PLYWK  LF  +GG  T   +     V+MW+KI    H DA+K   LL      ++   DF P +QDV+ +HPGL+FL  A +FHSRYI TV+ RIF+ +N SWSG+IT  EL +S  L  +  LE   DIN +T++FSYEHFYVIYCKFWELD DHDL+I   DLARHN++A+S +MI+RIFSGAVT+ R  + EG ++Y +FVWFL+SEEDKK P SIEYWFRCMDLDGDG LS++EL+YFY+EQ  R++ M IE + F+DC+CQM+D++KP+ E KI L DLK C+L ++FFDTFFN+ KYL+HEQ++  + L+D + G  E+SDW++YA+E Y+ILVAE+ + + + D +
Sbjct:   93 NAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGL-------VAKACGCPLYWKGPLFYGAGGERTG-SVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGF 527          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Match: PPP2R3B (protein phosphatase 2 regulatory subunit B''beta [Source:HGNC Symbol;Acc:HGNC:13417])

HSP 1 Score: 446.817 bits (1148), Expect = 8.128e-148
Identity = 213/443 (48.08%), Postives = 292/443 (65.91%), Query Frame = 1
Query:  799 DTKNLRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +  ++R T +S     V  R E       S  IP FYFPRG+P+ +  +  ++  I         +  T   + +       V +    PLYWK  LF  +GG  T   +     V+MW+KI    H DA+K   LL      ++   DF P +QDV+ +HPGL+FL  A +FHSRYI TV+ RIF+ +N SWSG+IT  EL +S  L  +  LE   DIN +T++FSYEHFYVIYCKFWELD DHDL+I   DLARHN++A+S +MI+RIFSGAVT+ R  + EG ++Y +FVWFL+SEEDKK P SIEYWFRCMDLDGDG LS++EL+YFY+EQ  R++ M IE + F+DC+CQM+D++KP+ E KI L DLK C+L ++FFDTFFN+ KYL+HEQ++  + L+D + G  E+SDW++YA+E Y+ILVAE+   + + D +
Sbjct:   93 NAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGL-------VAKACGCPLYWKGPLFYGAGGERTG-SVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETVGEPWEDGF 527          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Match: F43B10.1 (pep chromosome:WBcel235:X:16638278:16643061:-1 gene:WBGene00018373.1 transcript:F43B10.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F43B10.1)

HSP 1 Score: 307.375 bits (786), Expect = 6.672e-95
Identity = 158/427 (37.00%), Postives = 241/427 (56.44%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQRSENKSSDIPK--FYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGL--MTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIK-PKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            R T K  Q   V  R        PK   Y+P+GKP    +    ++ + +  +S+  +  T             V     +P+YWK  +FL    +E  L   + +  S W+ + +V H +A++    LT   + +++P DFY ++ DV+ +HPGL F   A +FH +Y   V+ RIF+    SWSG++T + L K  +L  + +L+  DDIN   +YFSYEHFYV+YCKFWE+D DHDL IS  DLA+H   A+   +++RIFSGAV  +  R + +  +   EF  FLL+EEDK HP SIEYWFR +DLDGDG+++LY+++ F+ +   ++   GI+ + F D  CQ++DM+  P   +  RLSDLK   L   F +TF N  K+   E  +   + +  +EG  E+++WDRY  E YE ++ +D
Sbjct:  116 RPTPKPTQ---VISRPLPPKPQAPKEPIYYPQGKPVPQLQNDTALRRVCEVFRSVPNQKCTL-------ENMPAVCEAAGLPMYWKMPVFLAITNDEDRLAT-QVDFTSWWKAMTSVAHDEAARFVYTLTMGSRSYLQPEDFYEMLMDVIHTHPGLAFYRDATEFHDKYCQVVMTRIFWNDAHSWSGRLTTERLRKGGVLQAIRNLQFDDDINKSLRYFSYEHFYVVYCKFWEIDSDHDLKISSTDLAQHAGGALVPMVVDRIFSGAVCTNPNRGQPVEDIGLAEFTQFLLAEEDKTHPTSIEYWFRILDLDGDGLVTLYDMELFHTQVQRKLAAEGIDSMGFADVACQLIDMLNVPGGVSAFRLSDLKKSSLRGRFINTFVNWRKFFAQETNEGSESPRIEDEGGQELTEWDRYCIEEYEAMMEDD 531          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Match: F43B10.1 (pep chromosome:WBcel235:X:16638226:16643558:-1 gene:WBGene00018373.1 transcript:F43B10.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F43B10.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.974e-94
Identity = 158/427 (37.00%), Postives = 241/427 (56.44%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQRSENKSSDIPK--FYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGL--MTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIK-PKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            R T K  Q   V  R        PK   Y+P+GKP    +    ++ + +  +S+  +  T             V     +P+YWK  +FL    +E  L   + +  S W+ + +V H +A++    LT   + +++P DFY ++ DV+ +HPGL F   A +FH +Y   V+ RIF+    SWSG++T + L K  +L  + +L+  DDIN   +YFSYEHFYV+YCKFWE+D DHDL IS  DLA+H   A+   +++RIFSGAV  +  R + +  +   EF  FLL+EEDK HP SIEYWFR +DLDGDG+++LY+++ F+ +   ++   GI+ + F D  CQ++DM+  P   +  RLSDLK   L   F +TF N  K+   E  +   + +  +EG  E+++WDRY  E YE ++ +D
Sbjct:  164 RPTPKPTQ---VISRPLPPKPQAPKEPIYYPQGKPVPQLQNDTALRRVCEVFRSVPNQKCTL-------ENMPAVCEAAGLPMYWKMPVFLAITNDEDRLAT-QVDFTSWWKAMTSVAHDEAARFVYTLTMGSRSYLQPEDFYEMLMDVIHTHPGLAFYRDATEFHDKYCQVVMTRIFWNDAHSWSGRLTTERLRKGGVLQAIRNLQFDDDINKSLRYFSYEHFYVVYCKFWEIDSDHDLKISSTDLAQHAGGALVPMVVDRIFSGAVCTNPNRGQPVEDIGLAEFTQFLLAEEDKTHPTSIEYWFRILDLDGDGLVTLYDMELFHTQVQRKLAAEGIDSMGFADVACQLIDMLNVPGGVSAFRLSDLKKSSLRGRFINTFVNWRKFFAQETNEGSESPRIEDEGGQELTEWDRYCIEEYEAMMEDD 579          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Match: F43B10.1 (pep chromosome:WBcel235:X:16638278:16662823:-1 gene:WBGene00018373.1 transcript:F43B10.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F43B10.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.558e-93
Identity = 158/427 (37.00%), Postives = 241/427 (56.44%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQRSENKSSDIPK--FYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGL--MTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIK-PKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            R T K  Q   V  R        PK   Y+P+GKP    +    ++ + +  +S+  +  T             V     +P+YWK  +FL    +E  L   + +  S W+ + +V H +A++    LT   + +++P DFY ++ DV+ +HPGL F   A +FH +Y   V+ RIF+    SWSG++T + L K  +L  + +L+  DDIN   +YFSYEHFYV+YCKFWE+D DHDL IS  DLA+H   A+   +++RIFSGAV  +  R + +  +   EF  FLL+EEDK HP SIEYWFR +DLDGDG+++LY+++ F+ +   ++   GI+ + F D  CQ++DM+  P   +  RLSDLK   L   F +TF N  K+   E  +   + +  +EG  E+++WDRY  E YE ++ +D
Sbjct:  255 RPTPKPTQ---VISRPLPPKPQAPKEPIYYPQGKPVPQLQNDTALRRVCEVFRSVPNQKCTL-------ENMPAVCEAAGLPMYWKMPVFLAITNDEDRLAT-QVDFTSWWKAMTSVAHDEAARFVYTLTMGSRSYLQPEDFYEMLMDVIHTHPGLAFYRDATEFHDKYCQVVMTRIFWNDAHSWSGRLTTERLRKGGVLQAIRNLQFDDDINKSLRYFSYEHFYVVYCKFWEIDSDHDLKISSTDLAQHAGGALVPMVVDRIFSGAVCTNPNRGQPVEDIGLAEFTQFLLAEEDKTHPTSIEYWFRILDLDGDGLVTLYDMELFHTQVQRKLAAEGIDSMGFADVACQLIDMLNVPGGVSAFRLSDLKKSSLRGRFINTFVNWRKFFAQETNEGSESPRIEDEGGQELTEWDRYCIEEYEAMMEDD 670          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Match: F43B10.1 (pep chromosome:WBcel235:X:16638226:16654507:-1 gene:WBGene00018373.1 transcript:F43B10.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F43B10.1)

HSP 1 Score: 311.227 bits (796), Expect = 1.533e-90
Identity = 158/427 (37.00%), Postives = 241/427 (56.44%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQRSENKSSDIPK--FYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGL--MTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIK-PKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            R T K  Q   V  R        PK   Y+P+GKP    +    ++ + +  +S+  +  T             V     +P+YWK  +FL    +E  L   + +  S W+ + +V H +A++    LT   + +++P DFY ++ DV+ +HPGL F   A +FH +Y   V+ RIF+    SWSG++T + L K  +L  + +L+  DDIN   +YFSYEHFYV+YCKFWE+D DHDL IS  DLA+H   A+   +++RIFSGAV  +  R + +  +   EF  FLL+EEDK HP SIEYWFR +DLDGDG+++LY+++ F+ +   ++   GI+ + F D  CQ++DM+  P   +  RLSDLK   L   F +TF N  K+   E  +   + +  +EG  E+++WDRY  E YE ++ +D
Sbjct:  884 RPTPKPTQ---VISRPLPPKPQAPKEPIYYPQGKPVPQLQNDTALRRVCEVFRSVPNQKCTL-------ENMPAVCEAAGLPMYWKMPVFLAITNDEDRLAT-QVDFTSWWKAMTSVAHDEAARFVYTLTMGSRSYLQPEDFYEMLMDVIHTHPGLAFYRDATEFHDKYCQVVMTRIFWNDAHSWSGRLTTERLRKGGVLQAIRNLQFDDDINKSLRYFSYEHFYVVYCKFWEIDSDHDLKISSTDLAQHAGGALVPMVVDRIFSGAVCTNPNRGQPVEDIGLAEFTQFLLAEEDKTHPTSIEYWFRILDLDGDGLVTLYDMELFHTQVQRKLAAEGIDSMGFADVACQLIDMLNVPGGVSAFRLSDLKKSSLRGRFINTFVNWRKFFAQETNEGSESPRIEDEGGQELTEWDRYCIEEYEAMMEDD 1299          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Match: T22D1.5 (pep chromosome:WBcel235:IV:6903950:6905546:1 gene:WBGene00020684.1 transcript:T22D1.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T22D1.5)

HSP 1 Score: 55.0694 bits (131), Expect = 1.166e-7
Identity = 36/130 (27.69%), Postives = 59/130 (45.38%), Query Frame = 1
Query: 1582 MIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHE 1971
            +++RIFS  +   R  T   +   E  W + +       +SIEYWFR +D+   GIL L +L  FY      +    ++ + FE+ I Q  D++   + N       KN +L     + F    ++LE E
Sbjct:  211 IVDRIFSSNLV--RRSTGNYLDTKEVTWLIFAMIGTDENQSIEYWFRVLDVQSTGILQLDDLRMFYDAITKFLVNNNVQSLPFENAIAQFRDILGTDKWNLQSFK--KNSQLAFRVINGFVCALRFLEQE 336          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Fly
Match: CG4733 (gene:FBgn0038744 transcript:FBtr0301117)

HSP 1 Score: 442.195 bits (1136), Expect = 2.480e-142
Identity = 206/413 (49.88%), Postives = 287/413 (69.49%), Query Frame = 1
Query:  868 KSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKK--CFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRART----EGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            KS  IP+FYFP GKP+ N  +  +++ I     S      T           DE+ RILK+   P YW+  + +      T L + R+  V  W+++    H  AS+   +L++ ++   +I P D  P+VQDV+++HPGL FL  A +FHSRY+ TV+ RIF+ +N SWSGKIT+ EL++SD+L ++  LE  +DIN I  +FSYEHFYVIYCKFWELD+DHDL+I++ DLA+H+++A+S R++ERIFSG VT+S  +     E  M+YT+FVWF+LSEEDK+ P +IEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME +GIE + FEDC+CQM+DMIKP   + I L DLK C++  +FFDTFFNL KYL+HEQRDPF + +D        SDWDR+A++ YE+L++E+
Sbjct:  490 KSVYIPRFYFPHGKPQPNIAMERVVRGILSAFDSFPNNQVTK----------DELPRILKICGLPFYWRMPVMVFCQSASTGL-VERQRFVEFWKQMNVYCHEAASRFVYILSRGQRFRSYIVPEDLVPMVQDVVDTHPGLAFLKEATEFHSRYVHTVIARIFYSVNRSWSGKITIAELKRSDLLEMISLLEEEEDINQIMAFFSYEHFYVIYCKFWELDKDHDLLINQEDLAKHSDHALSSRIVERIFSGCVTRSDNKKAPEDEAKMSYTDFVWFILSEEDKRTPTAIEYWFRCMDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLPFEDCLCQMLDMIKPANRDCITLGDLKRCKMTHVFFDTFFNLEKYLDHEQRDPFASQRD-----EYTSDWDRFAAQEYELLISEE 886          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Fly
Match: CG4733 (gene:FBgn0038744 transcript:FBtr0308829)

HSP 1 Score: 442.195 bits (1136), Expect = 2.480e-142
Identity = 206/413 (49.88%), Postives = 287/413 (69.49%), Query Frame = 1
Query:  868 KSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKK--CFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRART----EGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            KS  IP+FYFP GKP+ N  +  +++ I     S      T           DE+ RILK+   P YW+  + +      T L + R+  V  W+++    H  AS+   +L++ ++   +I P D  P+VQDV+++HPGL FL  A +FHSRY+ TV+ RIF+ +N SWSGKIT+ EL++SD+L ++  LE  +DIN I  +FSYEHFYVIYCKFWELD+DHDL+I++ DLA+H+++A+S R++ERIFSG VT+S  +     E  M+YT+FVWF+LSEEDK+ P +IEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME +GIE + FEDC+CQM+DMIKP   + I L DLK C++  +FFDTFFNL KYL+HEQRDPF + +D        SDWDR+A++ YE+L++E+
Sbjct:  490 KSVYIPRFYFPHGKPQPNIAMERVVRGILSAFDSFPNNQVTK----------DELPRILKICGLPFYWRMPVMVFCQSASTGL-VERQRFVEFWKQMNVYCHEAASRFVYILSRGQRFRSYIVPEDLVPMVQDVVDTHPGLAFLKEATEFHSRYVHTVIARIFYSVNRSWSGKITIAELKRSDLLEMISLLEEEEDINQIMAFFSYEHFYVIYCKFWELDKDHDLLINQEDLAKHSDHALSSRIVERIFSGCVTRSDNKKAPEDEAKMSYTDFVWFILSEEDKRTPTAIEYWFRCMDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLPFEDCLCQMLDMIKPANRDCITLGDLKRCKMTHVFFDTFFNLEKYLDHEQRDPFASQRD-----EYTSDWDRFAAQEYELLISEE 886          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Fly
Match: CG4733 (gene:FBgn0038744 transcript:FBtr0308828)

HSP 1 Score: 442.195 bits (1136), Expect = 2.480e-142
Identity = 206/413 (49.88%), Postives = 287/413 (69.49%), Query Frame = 1
Query:  868 KSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKK--CFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRART----EGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            KS  IP+FYFP GKP+ N  +  +++ I     S      T           DE+ RILK+   P YW+  + +      T L + R+  V  W+++    H  AS+   +L++ ++   +I P D  P+VQDV+++HPGL FL  A +FHSRY+ TV+ RIF+ +N SWSGKIT+ EL++SD+L ++  LE  +DIN I  +FSYEHFYVIYCKFWELD+DHDL+I++ DLA+H+++A+S R++ERIFSG VT+S  +     E  M+YT+FVWF+LSEEDK+ P +IEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME +GIE + FEDC+CQM+DMIKP   + I L DLK C++  +FFDTFFNL KYL+HEQRDPF + +D        SDWDR+A++ YE+L++E+
Sbjct:  490 KSVYIPRFYFPHGKPQPNIAMERVVRGILSAFDSFPNNQVTK----------DELPRILKICGLPFYWRMPVMVFCQSASTGL-VERQRFVEFWKQMNVYCHEAASRFVYILSRGQRFRSYIVPEDLVPMVQDVVDTHPGLAFLKEATEFHSRYVHTVIARIFYSVNRSWSGKITIAELKRSDLLEMISLLEEEEDINQIMAFFSYEHFYVIYCKFWELDKDHDLLINQEDLAKHSDHALSSRIVERIFSGCVTRSDNKKAPEDEAKMSYTDFVWFILSEEDKRTPTAIEYWFRCMDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLPFEDCLCQMLDMIKPANRDCITLGDLKRCKMTHVFFDTFFNLEKYLDHEQRDPFASQRD-----EYTSDWDRFAAQEYELLISEE 886          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Fly
Match: CG4733 (gene:FBgn0038744 transcript:FBtr0344260)

HSP 1 Score: 435.261 bits (1118), Expect = 8.932e-140
Identity = 205/413 (49.64%), Postives = 284/413 (68.77%), Query Frame = 1
Query:  868 KSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKK--CFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRART----EGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAED 2079
            KS  IP+FYFP GKP+ N  +  +++ I     S      T           DE+ RILK+   P YW+  + +      T L + R+  V  W+++    H  AS+   +L++ ++   +I P D  P+VQDV+++HPGL FL  A +FHSRY+ TV+ RIF+ +N SWSGKIT+ EL++SD+L      E  +DIN I  +FSYEHFYVIYCKFWELD+DHDL+I++ DLA+H+++A+S R++ERIFSG VT+S  +     E  M+YT+FVWF+LSEEDK+ P +IEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME +GIE + FEDC+CQM+DMIKP   + I L DLK C++  +FFDTFFNL KYL+HEQRDPF + +D        SDWDR+A++ YE+L++E+
Sbjct:  490 KSVYIPRFYFPHGKPQPNIAMERVVRGILSAFDSFPNNQVTK----------DELPRILKICGLPFYWRMPVMVFCQSASTGL-VERQRFVEFWKQMNVYCHEAASRFVYILSRGQRFRSYIVPEDLVPMVQDVVDTHPGLAFLKEATEFHSRYVHTVIARIFYSVNRSWSGKITIAELKRSDLL------EEEEDINQIMAFFSYEHFYVIYCKFWELDKDHDLLINQEDLAKHSDHALSSRIVERIFSGCVTRSDNKKAPEDEAKMSYTDFVWFILSEEDKRTPTAIEYWFRCMDVDGDGVLSMYELEYFYEEQQQRMEGIGIECLPFEDCLCQMLDMIKPANRDCITLGDLKRCKMTHVFFDTFFNLEKYLDHEQRDPFASQRD-----EYTSDWDRFAAQEYELLISEE 880          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Match: ppp2r3b (protein phosphatase 2, regulatory subunit B'', beta [Source:ZFIN;Acc:ZDB-GENE-070912-268])

HSP 1 Score: 468.774 bits (1205), Expect = 2.042e-156
Identity = 237/495 (47.88%), Postives = 312/495 (63.03%), Query Frame = 1
Query:  637 YKFGSNAISQDSNSGSVVSTASATXXXXXXXXXXXXQDKSTVNGDIESHEMPIADTKNLRK---TSKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +K  S  +  ++N+ ++ S  +AT      L  P     +T+     S+     + + LR+   T K  Q  K    +   S  IPKFYFPRG+P++N  I NL+  I         +  T   + +       V +    P YWK  LF  +GG+     +     V+MW+K+    H DASK   LL +    ++E  DF P +QDV++SH GL FL  A DFHSRYI TVV RIF+ +N SW+GKIT  EL +S  L  +  LE  ++IN +T++FSYEHFYVIYCKFWELD DHDL I + DL RHN+ A+S RMIERIFSGAVT+ RA   EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL YFYQEQ  ++E M IEP+ FEDC+CQM+D++KP+   KI L DLK CR+  IFFDTFFN+ KYL+HEQRDP    +D E    E+SDW+RYA+E Y+ LVAE+ + + Y+D Y
Sbjct:   52 FKGTSTLMFTENNNNNIASKINATERMSAALGAPCSPPSATLPSATGSNNRAGVNARALRRSVSTKKQAQAKKEEPVTPALSESIPKFYFPRGQPQANINIDNLISKIEKIFSQFPDERVTIKDMGL-------VAKACDCPFYWKAPLFHAAGGDRRGY-VSVHKFVAMWRKVLQTCHDDASKFLHLLAKPGCNYLEQEDFIPFLQDVVDSHTGLAFLKEASDFHSRYITTVVQRIFYNVNRSWTGKITCSELRRSTFLQNVALLEEDEEINQLTEFFSYEHFYVIYCKFWELDTDHDLYIDQRDLMRHNDQAISHRMIERIFSGAVTRGRAVHKEGRLSYGDFVWFLISEEDKKTETSIEYWFRCMDLDGDGVLSMYELQYFYQEQCQKLEAMAIEPLPFEDCLCQMLDLVKPENPGKITLRDLKRCRMSHIFFDTFFNIEKYLDHEQRDPLLAARDAEAVGQEISDWERYAAEEYDNLVAEETANEQYHDGY 538          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Match: ppp2r3b (protein phosphatase 2, regulatory subunit B'', beta [Source:ZFIN;Acc:ZDB-GENE-070912-268])

HSP 1 Score: 468.774 bits (1205), Expect = 2.042e-156
Identity = 237/495 (47.88%), Postives = 312/495 (63.03%), Query Frame = 1
Query:  637 YKFGSNAISQDSNSGSVVSTASATXXXXXXXXXXXXQDKSTVNGDIESHEMPIADTKNLRK---TSKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +K  S  +  ++N+ ++ S  +AT      L  P     +T+     S+     + + LR+   T K  Q  K    +   S  IPKFYFPRG+P++N  I NL+  I         +  T   + +       V +    P YWK  LF  +GG+     +     V+MW+K+    H DASK   LL +    ++E  DF P +QDV++SH GL FL  A DFHSRYI TVV RIF+ +N SW+GKIT  EL +S  L  +  LE  ++IN +T++FSYEHFYVIYCKFWELD DHDL I + DL RHN+ A+S RMIERIFSGAVT+ RA   EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL YFYQEQ  ++E M IEP+ FEDC+CQM+D++KP+   KI L DLK CR+  IFFDTFFN+ KYL+HEQRDP    +D E    E+SDW+RYA+E Y+ LVAE+ + + Y+D Y
Sbjct:   52 FKGTSTLMFTENNNNNIASKINATERMSAALGAPCSPPSATLPSATGSNNRAGVNARALRRSVSTKKQAQAKKEEPVTPALSESIPKFYFPRGQPQANINIDNLISKIEKIFSQFPDERVTIKDMGL-------VAKACDCPFYWKAPLFHAAGGDRRGY-VSVHKFVAMWRKVLQTCHDDASKFLHLLAKPGCNYLEQEDFIPFLQDVVDSHTGLAFLKEASDFHSRYITTVVQRIFYNVNRSWTGKITCSELRRSTFLQNVALLEEDEEINQLTEFFSYEHFYVIYCKFWELDTDHDLYIDQRDLMRHNDQAISHRMIERIFSGAVTRGRAVHKEGRLSYGDFVWFLISEEDKKTETSIEYWFRCMDLDGDGVLSMYELQYFYQEQCQKLEAMAIEPLPFEDCLCQMLDLVKPENPGKITLRDLKRCRMSHIFFDTFFNIEKYLDHEQRDPLLAARDAEAVGQEISDWERYAAEEYDNLVAEETANEQYHDGY 538          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Match: ppp2r3b (protein phosphatase 2, regulatory subunit B'', beta [Source:ZFIN;Acc:ZDB-GENE-070912-268])

HSP 1 Score: 457.218 bits (1175), Expect = 1.197e-153
Identity = 220/412 (53.40%), Postives = 280/412 (67.96%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYND 2103
            S  IPKFYFPRG+P++N  I NL+  I         +  T   + +       V +    P YWK  LF  +GG+     +     V+MW+K+    H DASK   LL +    ++E  DF P +QDV++SH GL FL  A DFHSRYI TVV RIF+ +N SW+GKIT  EL +S  L  +  LE  ++IN +T++FSYEHFYVIYCKFWELD DHDL I + DL RHN+ A+S RMIERIFSGAVT+ RA   EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL YFYQEQ  ++E M IEP+ FEDC+CQM+D++KP+   KI L DLK CR+  IFFDTFFN+ KYL+HEQRDP    +D E    E+SDW+RYA+E Y+ LVAE+ + + Y+D
Sbjct:   59 SESIPKFYFPRGQPQANINIDNLISKIEKIFSQFPDERVTIKDMGL-------VAKACDCPFYWKAPLFHAAGGDRRGY-VSVHKFVAMWRKVLQTCHDDASKFLHLLAKPGCNYLEQEDFIPFLQDVVDSHTGLAFLKEASDFHSRYITTVVQRIFYNVNRSWTGKITCSELRRSTFLQNVALLEEDEEINQLTEFFSYEHFYVIYCKFWELDTDHDLYIDQRDLMRHNDQAISHRMIERIFSGAVTRGRAVHKEGRLSYGDFVWFLISEEDKKTETSIEYWFRCMDLDGDGVLSMYELQYFYQEQCQKLEAMAIEPLPFEDCLCQMLDLVKPENPGKITLRDLKRCRMSHIFFDTFFNIEKYLDHEQRDPLLAARDAEAVGQEISDWERYAAEEYDNLVAEETANEQYHD 462          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Match: ppp2r3a (protein phosphatase 2, regulatory subunit B'', alpha [Source:ZFIN;Acc:ZDB-GENE-070912-646])

HSP 1 Score: 453.366 bits (1165), Expect = 3.039e-151
Identity = 221/453 (48.79%), Postives = 302/453 (66.67%), Query Frame = 1
Query:  844 KVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGS-----QDNYNDNYRESNQSFRNSSNTRDDEAVYENVST 2184
            KV       S +IP+FYFP+G P       N   + ++ +  +EA             +  ++ +    PLYWK  +F+ +GG  T   +   + ++ W+K+    + DASK   LL +    ++E  DF PL+QD++++HPGLTFL  A +FHSRYI TV+ RIF+ +N SW+GKI + EL +S+ L  L  LE  DDIN IT YFSYEHFYVIYCKFWELD DHDL I   DLAR+N++A S R+IER+FSGAVT+  + + EG M+Y EFVWFL+SEEDKK+P SIEYWFRCMD+DGDG+LS++EL+Y Y+EQ  RME MGIEP+ F+D +CQM+D++KP+  +KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KDL+    E SDWD+YASE YEILVAE+ +     + +++D+Y     +  +    + D+ V  ++S 
Sbjct:   76 KVVATPPPSSINIPRFYFPKGLP-------NCAANYDEAIAKIEAAFTEFEEEKADIYEMGKIAKACGCPLYWKSPMFICAGGERTGF-VSVHSFIATWRKLLHSCYDDASKFVYLLAKPGCTYLEQEDFIPLLQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWTGKINMTELRRSNFLQTLALLEEEDDINQITDYFSYEHFYVIYCKFWELDSDHDLFIDPKDLARYNDHASSSRIIERLFSGAVTRGNSVQREGRMSYAEFVWFLISEEDKKNPTSIEYWFRCMDMDGDGVLSMFELEYLYEEQCERMEGMGIEPLPFQDLLCQMLDLVKPECPSKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDLDSDGPEPSDWDKYASEEYEILVAEETANEQLREGSFDDDYESDELTVSSDIGNKMDKLVISDLSA 520          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Match: ppp2r3a (protein phosphatase 2, regulatory subunit B'', alpha [Source:ZFIN;Acc:ZDB-GENE-070912-646])

HSP 1 Score: 460.299 bits (1183), Expect = 5.174e-146
Identity = 221/453 (48.79%), Postives = 302/453 (66.67%), Query Frame = 1
Query:  844 KVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGS-----QDNYNDNYRESNQSFRNSSNTRDDEAVYENVST 2184
            KV       S +IP+FYFP+G P       N   + ++ +  +EA             +  ++ +    PLYWK  +F+ +GG  T   +   + ++ W+K+    + DASK   LL +    ++E  DF PL+QD++++HPGLTFL  A +FHSRYI TV+ RIF+ +N SW+GKI + EL +S+ L  L  LE  DDIN IT YFSYEHFYVIYCKFWELD DHDL I   DLAR+N++A S R+IER+FSGAVT+  + + EG M+Y EFVWFL+SEEDKK+P SIEYWFRCMD+DGDG+LS++EL+Y Y+EQ  RME MGIEP+ F+D +CQM+D++KP+  +KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KDL+    E SDWD+YASE YEILVAE+ +     + +++D+Y     +  +    + D+ V  ++S 
Sbjct:  748 KVVATPPPSSINIPRFYFPKGLP-------NCAANYDEAIAKIEAAFTEFEEEKADIYEMGKIAKACGCPLYWKSPMFICAGGERTGF-VSVHSFIATWRKLLHSCYDDASKFVYLLAKPGCTYLEQEDFIPLLQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWTGKINMTELRRSNFLQTLALLEEEDDINQITDYFSYEHFYVIYCKFWELDSDHDLFIDPKDLARYNDHASSSRIIERLFSGAVTRGNSVQREGRMSYAEFVWFLISEEDKKNPTSIEYWFRCMDMDGDGVLSMFELEYLYEEQCERMEGMGIEPLPFQDLLCQMLDLVKPECPSKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDLDSDGPEPSDWDKYASEEYEILVAEETANEQLREGSFDDDYESDELTVSSDIGNKMDKLVISDLSA 1192          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Match: hnrnpa0 (heterogeneous nuclear ribonucleoprotein A0 [Source:Xenbase;Acc:XB-GENE-1000573])

HSP 1 Score: 452.21 bits (1162), Expect = 6.517e-151
Identity = 217/414 (52.42%), Postives = 283/414 (68.36%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            S +IPKFYFP+G PK+N  I  ++  I         +  T   +        +V +  + PLYWK  LF  +GG  T   +     ++MW+KI    H DA+K   LL +    ++E  DF P +QDV+ +HP LTFL  A +FHSRYI TVV RIF+ +N SWSG+IT  EL KS+ L  +  LE  +DIN    YFSYEHFYVIYCKFWELD DHDL I + DLA+HN++A+S  +I+RIFSG VT+SR    EG ++Y +FVWFLLSEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  +ME M IEP+ FEDC+CQM+D++KP+ E KI L DLK C+  +IFFDTF NL KYL+HEQ+DPF+ L+  E    E+SDW++YA+E Y +LVAE+ + + +ND Y
Sbjct:   73 SQNIPKFYFPKGCPKANLNIDGIISKIEKTFSGFPLERATLEDM-------GKVAKACECPLYWKAPLFYAAGGERTGY-VSVHKFIAMWRKILHTCHDDAAKFMQLLAKPGCSYLEQEDFIPFLQDVVNTHPHLTFLREASEFHSRYITTVVQRIFYLVNRSWSGRITCSELRKSNFLQHVALLEE-EDINQSADYFSYEHFYVIYCKFWELDTDHDLYIDENDLAKHNDHAISSHVIQRIFSGTVTRSRKVHKEGKISYADFVWFLLSEEDKKTQTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKMESMAIEPLPFEDCLCQMLDLVKPQTEGKITLHDLKKCKQANIFFDTFLNLEKYLDHEQKDPFSVLRVGENEGQELSDWEKYAAEEYAVLVAEEAANEQWNDGY 477          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Match: hnrnpa0 (heterogeneous nuclear ribonucleoprotein A0 [Source:Xenbase;Acc:XB-GENE-1000573])

HSP 1 Score: 451.825 bits (1161), Expect = 1.055e-150
Identity = 222/439 (50.57%), Postives = 292/439 (66.51%), Query Frame = 1
Query:  811 LRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
             +K  K+ Q  +V  + E       S +IPKFYFP+G PK+N  I  ++  I         +  T   +        +V +  + PLYWK  LF  +GG  T   +     ++MW+KI    H DA+K   LL +    ++E  DF P +QDV+ +HP LTFL  A +FHSRYI TVV RIF+ +N SWSG+IT  EL KS+ L  +  LE  +DIN    YFSYEHFYVIYCKFWELD DHDL I + DLA+HN++A+S  +I+RIFSG VT+SR    EG ++Y +FVWFLLSEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  +ME M IEP+ FEDC+CQM+D++KP+ E KI L DLK C+  +IFFDTF NL KYL+HEQ+DPF+ L+  E    E+SDW++YA+E Y +LVAE+ + + +ND Y
Sbjct:   38 FKKRLKAFQQIQVHPKKEEPLTPALSQNIPKFYFPKGCPKANLNIDGIISKIEKTFSGFPLERATLEDMG-------KVAKACECPLYWKAPLFYAAGGERTGY-VSVHKFIAMWRKILHTCHDDAAKFMQLLAKPGCSYLEQEDFIPFLQDVVNTHPHLTFLREASEFHSRYITTVVQRIFYLVNRSWSGRITCSELRKSNFLQHVALLEE-EDINQSADYFSYEHFYVIYCKFWELDTDHDLYIDENDLAKHNDHAISSHVIQRIFSGTVTRSRKVHKEGKISYADFVWFLLSEEDKKTQTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKMESMAIEPLPFEDCLCQMLDLVKPQTEGKITLHDLKKCKQANIFFDTFLNLEKYLDHEQKDPFSVLRVGENEGQELSDWEKYAAEEYAVLVAEEAANEQWNDGY 467          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Match: hnrnpa0 (heterogeneous nuclear ribonucleoprotein A0 [Source:Xenbase;Acc:XB-GENE-1000573])

HSP 1 Score: 454.136 bits (1167), Expect = 1.294e-150
Identity = 221/440 (50.23%), Postives = 292/440 (66.36%), Query Frame = 1
Query:  793 IADTKNLRKTSKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            I  T+ + +   +V   K    +   S +IPKFYFP+G PK+N  I  ++  I         +  T   +        +V +  + PLYWK  LF  +GG  T   +     ++MW+KI    H DA+K   LL +    ++E  DF P +QDV+ +HP LTFL  A +FHSRYI TVV RIF+ +N SWSG+IT  EL KS+ L  +  LE  +DIN    YFSYEHFYVIYCKFWELD DHDL I + DLA+HN++A+S  +I+RIFSG VT+SR    EG ++Y +FVWFLLSEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  +ME M IEP+ FEDC+CQM+D++KP+ E KI L DLK C+  +IFFDTF NL KYL+HEQ+DPF+ L+  E    E+SDW++YA+E Y +LVAE+ + + +ND Y
Sbjct:   92 INSTRCVSRKKNAVHPKKEEPLTPALSQNIPKFYFPKGCPKANLNIDGIISKIEKTFSGFPLERATLEDM-------GKVAKACECPLYWKAPLFYAAGGERTGY-VSVHKFIAMWRKILHTCHDDAAKFMQLLAKPGCSYLEQEDFIPFLQDVVNTHPHLTFLREASEFHSRYITTVVQRIFYLVNRSWSGRITCSELRKSNFLQHVALLEE-EDINQSADYFSYEHFYVIYCKFWELDTDHDLYIDENDLAKHNDHAISSHVIQRIFSGTVTRSRKVHKEGKISYADFVWFLLSEEDKKTQTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKMESMAIEPLPFEDCLCQMLDLVKPQTEGKITLHDLKKCKQANIFFDTFLNLEKYLDHEQKDPFSVLRVGENEGQELSDWEKYAAEEYAVLVAEEAANEQWNDGY 522          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Match: hnrnpa0 (heterogeneous nuclear ribonucleoprotein A0 [Source:Xenbase;Acc:XB-GENE-1000573])

HSP 1 Score: 452.981 bits (1164), Expect = 2.127e-150
Identity = 225/437 (51.49%), Postives = 297/437 (67.96%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQR-SENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            R +S  V  PK  +  +   S +IPKFYFP+G PK+N  I  ++  I         KT +  PL   ++  +++ ++ K    PLYWK  LF  +GG  T   +     ++MW+KI    H DA+K   LL +    ++E  DF P +QDV+ +HP LTFL  A +FHSRYI TVV RIF+ +N SWSG+IT  EL KS+ L  +  LE  +DIN    YFSYEHFYVIYCKFWELD DHDL I + DLA+HN++A+S  +I+RIFSG VT+SR    EG ++Y +FVWFLLSEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  +ME M IEP+ FEDC+CQM+D++KP+ E KI L DLK C+  +IFFDTF NL KYL+HEQ+DPF+ L+  E    E+SDW++YA+E Y +LVAE+ + + +ND Y
Sbjct:   99 RSSSVGVVHPKKEEPLTPALSQNIPKFYFPKGCPKANLNIDGIISKIE--------KTFSGFPL--ERATLEDMGKVAKACECPLYWKAPLFYAAGGERTGY-VSVHKFIAMWRKILHTCHDDAAKFMQLLAKPGCSYLEQEDFIPFLQDVVNTHPHLTFLREASEFHSRYITTVVQRIFYLVNRSWSGRITCSELRKSNFLQHVALLEE-EDINQSADYFSYEHFYVIYCKFWELDTDHDLYIDENDLAKHNDHAISSHVIQRIFSGTVTRSRKVHKEGKISYADFVWFLLSEEDKKTQTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKMESMAIEPLPFEDCLCQMLDLVKPQTEGKITLHDLKKCKQANIFFDTFLNLEKYLDHEQKDPFSVLRVGENEGQELSDWEKYAAEEYAVLVAEEAANEQWNDGY 523          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Match: hnrnpa0 (heterogeneous nuclear ribonucleoprotein A0 [Source:Xenbase;Acc:XB-GENE-1000573])

HSP 1 Score: 452.21 bits (1162), Expect = 5.537e-150
Identity = 225/437 (51.49%), Postives = 297/437 (67.96%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQR-SENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            R +S  V  PK  +  +   S +IPKFYFP+G PK+N  I  ++  I         KT +  PL   ++  +++ ++ K    PLYWK  LF  +GG  T   +     ++MW+KI    H DA+K   LL +    ++E  DF P +QDV+ +HP LTFL  A +FHSRYI TVV RIF+ +N SWSG+IT  EL KS+ L  +  LE  +DIN    YFSYEHFYVIYCKFWELD DHDL I + DLA+HN++A+S  +I+RIFSG VT+SR    EG ++Y +FVWFLLSEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  +ME M IEP+ FEDC+CQM+D++KP+ E KI L DLK C+  +IFFDTF NL KYL+HEQ+DPF+ L+  E    E+SDW++YA+E Y +LVAE+ + + +ND Y
Sbjct:   99 RSSSVGVVHPKKEEPLTPALSQNIPKFYFPKGCPKANLNIDGIISKIE--------KTFSGFPL--ERATLEDMGKVAKACECPLYWKAPLFYAAGGERTGY-VSVHKFIAMWRKILHTCHDDAAKFMQLLAKPGCSYLEQEDFIPFLQDVVNTHPHLTFLREASEFHSRYITTVVQRIFYLVNRSWSGRITCSELRKSNFLQHVALLEE-EDINQSADYFSYEHFYVIYCKFWELDTDHDLYIDENDLAKHNDHAISSHVIQRIFSGTVTRSRKVHKEGKISYADFVWFLLSEEDKKTQTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKMESMAIEPLPFEDCLCQMLDLVKPQTEGKITLHDLKKCKQANIFFDTFLNLEKYLDHEQKDPFSVLRVGENEGQELSDWEKYAAEEYAVLVAEEAANEQWNDGY 523          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Match: Ppp2r3a (protein phosphatase 2, regulatory subunit B'', alpha [Source:MGI Symbol;Acc:MGI:2442104])

HSP 1 Score: 464.537 bits (1194), Expect = 1.722e-155
Identity = 223/410 (54.39%), Postives = 290/410 (70.73%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQ 2088
            S +IP+FYFP G P +      ++  I    + +E +          K+   E+ RI KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+ +  H DA+K   LL +    ++E  DF PL+QDV+++HPGLTFL  A +FHSRYI TVV RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDGILS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + +I L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LV E+ +Q
Sbjct:   85 SINIPQFYFPEGLPDTCSNHEQILSRIETAFKDIEDQ----------KADIHEMGRIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWKKLLSNRHDDAAKFIWLLAKPSCSYLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPASDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYEALVTEESAQ 483          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Match: Ppp2r3a (protein phosphatase 2, regulatory subunit B'', alpha [Source:MGI Symbol;Acc:MGI:2442104])

HSP 1 Score: 469.159 bits (1206), Expect = 9.276e-150
Identity = 223/410 (54.39%), Postives = 290/410 (70.73%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQ 2088
            S +IP+FYFP G P +      ++  I    + +E +          K+   E+ RI KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+ +  H DA+K   LL +    ++E  DF PL+QDV+++HPGLTFL  A +FHSRYI TVV RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDGILS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + +I L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LV E+ +Q
Sbjct:  705 SINIPQFYFPEGLPDTCSNHEQILSRIETAFKDIEDQ----------KADIHEMGRIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWKKLLSNRHDDAAKFIWLLAKPSCSYLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVVQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDGDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGILSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPASDGRITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYEALVTEESAQ 1103          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Match: Ppp2r3d (protein phosphatase 2 (formerly 2A), regulatory subunit B'', delta [Source:MGI Symbol;Acc:MGI:1335093])

HSP 1 Score: 159.458 bits (402), Expect = 4.619e-45
Identity = 73/134 (54.48%), Postives = 92/134 (68.66%), Query Frame = 1
Query: 1162 HSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNN 1563
            H DA++   LL       +   DF P +QDV+ SHPGL FL +A+DFHSRYI TV+ RIF+ +N SWSG I+ +EL +S  L  +  LE   DIN +T +FSYEHFYVIYCKFWELD D DL I ++DLARH +
Sbjct:    7 HDDAARFVRLLGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYITTVIQRIFYTVNRSWSGMISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKFWELDLDRDLTIDRSDLARHGD 140          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Match: Ppp2r3d (protein phosphatase 2 (formerly 2A), regulatory subunit B'', delta [Source:MGI Symbol;Acc:MGI:1335093])

HSP 1 Score: 159.458 bits (402), Expect = 4.619e-45
Identity = 73/134 (54.48%), Postives = 92/134 (68.66%), Query Frame = 1
Query: 1162 HSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNN 1563
            H DA++   LL       +   DF P +QDV+ SHPGL FL +A+DFHSRYI TV+ RIF+ +N SWSG I+ +EL +S  L  +  LE   DIN +T +FSYEHFYVIYCKFWELD D DL I ++DLARH +
Sbjct:    7 HDDAARFVRLLGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYITTVIQRIFYTVNRSWSGMISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKFWELDLDRDLTIDRSDLARHGD 140          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Match: Ppp2r3d (protein phosphatase 2 (formerly 2A), regulatory subunit B'', delta [Source:MGI Symbol;Acc:MGI:1335093])

HSP 1 Score: 149.828 bits (377), Expect = 7.740e-42
Identity = 66/118 (55.93%), Postives = 84/118 (71.19%), Query Frame = 1
Query: 1627 RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRD 1980
            R  G ++Y +FVWFLLSEEDK  P S EYWFRCMDLDGDG LS++EL++FY+EQ  RM   G+EP+ F D   Q++D++ P+   +I L DLK C L   FFD FFN+ KYL  EQR+
Sbjct:    6 RKVGKLSYADFVWFLLSEEDKTTPTSTEYWFRCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLDLVAPRCPGRITLRDLKQCGLAGEFFDAFFNVDKYLAREQRE 123          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Match: sp|Q06190|P2R3A_HUMAN (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 3.136e-149
Identity = 232/441 (52.61%), Postives = 304/441 (68.93%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKS---NEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFD--EVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRE-------SNQSFRNSSN 2145
            S +IP+FYFP G P +   +E+ L+ ++               TA + I + K D  E+ +I KV   PLYWK  +F  +GG +T   +  ++ ++MW+K+   +H DASK   LL +     +E  DF PL+QDV+++HPGLTFL  A +FHSRYI TV+ RIF+ +N SWSGKIT  E+ KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL IS+ADL+R+N+ A S R+IERIFSGAVT+ +  + EG M+Y +FVWFL+SEEDK++P SIEYWFRCMD+DGDG+LS+YEL+YFY+EQ  RME MGIEP+ F D +CQM+D++KP  + KI L DLK CR+  IF+DTFFNL KYL+HEQRDPF   KD+E    E SDWDR+A+E YE LVAE+ +Q  + + + +       S   F N SN
Sbjct:  706 SINIPRFYFPEGLPDTCSNHEQTLSRIE---------------TAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGF-VTAQSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSN 1130          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Match: sp|Q9Y5P8|P2R3B_HUMAN (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 1.276e-147
Identity = 213/443 (48.08%), Postives = 293/443 (66.14%), Query Frame = 1
Query:  799 DTKNLRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +  ++R T +S     V  R E       S  IP FYFPRG+P+ +  +  ++  I         +  T   + +       V +    PLYWK  LF  +GG  T   +     V+MW+KI    H DA+K   LL      ++   DF P +QDV+ +HPGL+FL  A +FHSRYI TV+ RIF+ +N SWSG+IT  EL +S  L  +  LE   DIN +T++FSYEHFYVIYCKFWELD DHDL+I   DLARHN++A+S +MI+RIFSGAVT+ R  + EG ++Y +FVWFL+SEEDKK P SIEYWFRCMDLDGDG LS++EL+YFY+EQ  R++ M IE + F+DC+CQM+D++KP+ E KI L DLK C+L ++FFDTFFN+ KYL+HEQ++  + L+D + G  E+SDW++YA+E Y+ILVAE+ + + + D +
Sbjct:   93 NAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGL-------VAKACGCPLYWKGPLFYGAGGERTG-SVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGF 527          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Match: sp|Q9Z176|P2R3D_MOUSE (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.022e-126
Identity = 193/406 (47.54%), Postives = 253/406 (62.32%), Query Frame = 1
Query:  880 IPKFYFPRGKP----KSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDG 2082
            +P FYFP G+P    +  E+ + L++   + L    A     A           V +    PLYWK  LF  +GG  T   +     V+MW+K+    H DA++   LL       +   DF P +QDV+ SHPGL FL +A+DFHSRYI TV+ RIF+ +N SWSG I+ +EL +S  L  +  LE   DIN +T +FSYEHFYVIYCKFWELD D DL I ++DLARH + A+S RMI+RIFSGAVT++R  R  G ++Y +FVWFLLSEEDK  P S EYWFRCMDLDGDG LS++EL++FY+EQ  RM   G+EP+ F D   Q++D++ P+   +I L DLK C L   FFD FFN+ KYL  EQR+     +D +      S WDRYA+E Y+ LVAE+ 
Sbjct:   67 VPAFYFPCGRPPPRPQDTEDAIALVECAFEGLPRGRAGLGDMA----------VVAKACGCPLYWKAPLFYAAGGERTG-SVSVHMFVAMWRKVLLTCHDDAARFVRLLGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYITTVIQRIFYTVNRSWSGMISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKFWELDLDRDLTIDRSDLARHGDGAISSRMIDRIFSGAVTRARLPRKVGKLSYADFVWFLLSEEDKTTPTSTEYWFRCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLDLVAPRCPGRITLRDLKQCGLAGEFFDAFFNVDKYLAREQREQAGTPQDTDSD-PAASAWDRYAAEEYDFLVAEEA 460          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Match: sp|Q9XGR4|2AB2A_ARATH (Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 4.325e-101
Identity = 166/430 (38.60%), Postives = 267/430 (62.09%), Query Frame = 1
Query:  814 RKTSKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTR-ILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYN 2100
            +KTS S+Q P  + R E K   IP+FYF  G+P + E        + ++  S+  +  +     +H  +F  +T+ + K+P +   +LF     + T + + R+  +  W     +    AS+++++L Q    ++   DF P++ ++L +HPGL FL +  +F  RY  TV+YRIF+ IN S +G ITL+EL++ +++  ++ ++  DDIN + +YFSYEHFYVIYC+FWELD DHD +I K +L ++ N+A++ R+++RIFS    K  ++ EG M+Y +F +F+L+EEDK    S+EYWF+C+DLDGDG+++  E+ +FY+EQL RME +  EP+ FED +CQ+ DMIKP++EN I L DLK  +L    F+  FNL K++  E RDPF   ++ E     +++WDR+A   Y  L  E+  ++  N
Sbjct:  107 QKTSPSLQSPLKSVR-EPKRQLIPQFYFQHGRPPAKE--------LREQCISMVDQFFSNYIDGLHMDEFKSITKEVCKLPSFLSSVLFRKIDTSGTGI-VTRDAFIKYWVDGHMLAMDVASQIYNILRQPGCKYLRQADFKPVLDELLTTHPGLEFLRNTPEFQERYAETVIYRIFYYINRSGTGCITLRELKRGNLITAMQQVDEEDDINKVIRYFSYEHFYVIYCRFWELDGDHDFLIDKENLIKYGNHALTYRIVDRIFSQVPRKFTSKVEGKMSYEDFAYFILAEEDKSSEPSLEYWFKCIDLDGDGVITPNEMQFFYEEQLHRMECITQEPVLFEDILCQIFDMIKPEKENCITLQDLKASKLSGNIFNILFNLNKFMAFETRDPFLIRQERENP--TLTEWDRFAQREYVRLSMEEDVEEVSN 524          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Match: sp|Q9SLI8|2AB2D_ARATH (Probable serine/threonine protein phosphatase 2A regulatory subunit B''delta OS=Arabidopsis thaliana OX=3702 GN=B''DELTA PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.606e-98
Identity = 168/414 (40.58%), Postives = 248/414 (59.90%), Query Frame = 1
Query:  880 IPKFYFPRGKPKSNEEILNLMKSIN-------DKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYN 2100
            IP+FYF  G+P  N+     +  IN       D LQ  E K  TT               I KVP ++   +F     N T   + RE+ +  W K   +     S++F++L Q    ++   DF P++Q++L +HPGL FL    +F  RY  TV+YRI++ IN S +G +TL+EL++ +++  ++  +  +DIN + +YFSYEHFYVIYCKFWELD DHD +I K +L R++N+A++ R+++RIFS    K  ++TEG M Y +FV+F+L+EEDK    S+EYWF+C+DLD +G+L+  EL +FY+EQL RME M  E + FED +CQ+ DM+KP++E  I L+DLK  +L    F+  FNL K++  E RDPF  L   E      ++WDR+A   Y  L  E+  +D  N
Sbjct:  125 IPQFYFEDGRPPPNDLKEQCIAKINSLFYGHEDGLQLQEFKLVTT--------------EICKVPSFFSTSIFKKVDTNNTGF-VKREDFIDYWVKGNMLTKEITSQVFTILKQPDHNYLVQDDFKPVLQELLATHPGLEFLQGTPEFQDRYAETVIYRIYYYINRSGNGHLTLRELKRGNLVDAMQHADEEEDINKVLRYFSYEHFYVIYCKFWELDTDHDFLIDKENLIRYSNHALTYRIVDRIFSQVPRKFTSKTEGKMGYEDFVYFILAEEDKSSEPSLEYWFKCIDLDANGVLTRNELQFFYEEQLHRMECMAQEAVLFEDILCQLFDMVKPEDEGFICLNDLKGSKLSGNVFNILFNLNKFMAFETRDPF--LIRQERANPTWTEWDRFAHREYIRLSMEEDVEDASN 521          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Match: A0A095CDJ7 (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Schistosoma haematobium OX=6185 GN=MS3_09211 PE=4 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 4.219e-180
Identity = 258/426 (60.56%), Postives = 318/426 (74.65%), Query Frame = 1
Query:  823 SKSVQIPKVAQRSENKSSDIPKFYFPRGKPK-SNEEILNLMKSINDKL-QSLEAKTNT---TAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGS 2085
            +K   IP    R       +P F+FP G  + SNEEI   ++ +  +L Q +++  N+   + PL  H S F +V ++L  PLYWKH +++N+GG      +   NL+  W         +ASK   LLT  +  F+   DF  L+QD+LESHPGL FL +A+DFHSRY+ATVV RIFF +N SWSG+I+L EL +S+ L VL SLE  DDIN +TQYFSYEHFYVIYCKFWELDEDHDL+IS++DLARHNNYA+SERMI+RIFSGAVT+  A  EG+MTY +FVWFLL+EEDK HPRSIEYWFRCMDLDGDG+LS+YEL+YFY EQL RMEEMGIEPISFEDC+CQ +DM+KP   +KIRLSD+K CRL  IFFDTFFNL KYL+HEQRDPF NL+D+EEGLNE+SDWDRYA+E YE+LV  +G 
Sbjct:  354 NKGFAIPSSPTRIHKA---LPAFHFPLGTTRMSNEEINTELERVKQELNQFIDSSLNSGKYSDPLISH-SCFGQVAKVLNCPLYWKHAIYMNAGGTPDRQPVTLSNLLKSWSHTLNTCPDEASKFVHLLTHGRATFLVQSDFNTLIQDILESHPGLAFLEAAKDFHSRYVATVVARIFFNVNISWSGRISLGELRRSNFLPVLASLENEDDINLVTQYFSYEHFYVIYCKFWELDEDHDLIISRSDLARHNNYAISERMIDRIFSGAVTRGTAFKEGVMTYPDFVWFLLAEEDKHHPRSIEYWFRCMDLDGDGLLSMYELEYFYSEQLARMEEMGIEPISFEDCLCQCLDMVKPALTDKIRLSDMKQCRLCHIFFDTFFNLPKYLQHEQRDPFANLRDIEEGLNELSDWDRYAAETYEMLVNVEGG 775          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Match: A0A430Q837 (Serine/threonine-protein phosphatase 2A regulatory subunit B OS=Schistosoma bovis OX=6184 GN=DC041_0004292 PE=4 SV=1)

HSP 1 Score: 548.895 bits (1413), Expect = 7.144e-179
Identity = 253/406 (62.32%), Postives = 314/406 (77.34%), Query Frame = 1
Query:  880 IPKFYFPRGKPK-SNEEILNLMKSINDKL-QSLEAKTNT---TAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDG 2082
            +P F+FP G  + SNEEI   ++ +  +L Q +++  N+   + PL  H S F +V ++L  PLYWKH +++N+GG      +   +L+  W         +ASK   LLT+ +  F+   DF  L+QD+LESHPGL FL +A+DFHSRY+ATVV RIFF +N SWSG+I+L EL +S+ L VL SLE  DDIN +TQYFSYEHFYVIYCKFWELDEDHDL+IS++DLARHNNYA+SERMI+RIFSGAVT+  A  EG+MTY +FVWFLL+EEDK HPRSIEYWFRCMDLDGDG+LS+YEL+YFY EQL RMEEMGIEPISFEDC+CQ +DM+KP   +KIRLSD+K CRL  IFFDTFFNL KYL+HEQRDPF NL+D+EEGLNE+SDWDRYA+E YE+LV  +G
Sbjct:  482 LPAFHFPLGTTRMSNEEINTELERVKQELNQFIDSSLNSGKYSDPLISH-SCFGQVAKVLNCPLYWKHAIYMNAGGTPDRQPVTLSSLLKSWSHTLNTCPDEASKFIHLLTRGRATFLVQSDFNTLIQDILESHPGLAFLEAAKDFHSRYVATVVARIFFNVNISWSGRISLGELRRSNFLPVLASLENEDDINLVTQYFSYEHFYVIYCKFWELDEDHDLIISRSDLARHNNYAISERMIDRIFSGAVTRGTAFKEGVMTYPDFVWFLLAEEDKHHPRSIEYWFRCMDLDGDGLLSMYELEYFYSEQLARMEEMGIEPISFEDCLCQCLDMVKPALTDKIRLSDMKQCRLCHIFFDTFFNLPKYLQHEQRDPFANLRDIEEGLNELSDWDRYAAETYEMLVNVEG 886          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Match: A0A183QP93 (EF-hand domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 1.692e-178
Identity = 253/406 (62.32%), Postives = 314/406 (77.34%), Query Frame = 1
Query:  880 IPKFYFPRGKPK-SNEEILNLMKSINDKL-QSLEAKTNT---TAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDG 2082
            +P F+FP G  + SNE+I   ++ +  +L Q +++  ++   + PL  H S F +V ++L  PLYWKH +++N+GG      I   NL+  W         +ASK   LLT+ +  F+   DF  L+QD+LESHPGL FL +A+DFHSRY+ATVV RIFF +N SWSG+I+L EL +S+ L VL SLE  DDIN +TQYFSYEHFYVIYCKFWELDEDHDL+IS++DLARHNNYA+SERMI+RIFSGAVT+  A  EG+MTY +FVWFLL+EEDK HPRSIEYWFRCMDLDGDG+LS+YEL+YFY EQL RMEEMGIEPISFEDC+CQ +DM+KP   +KIRLSD+K CRL  IFFDTFFNL KYL+HEQRDPF NL+D+EEGLNE+SDWDRYA+E YE+LV  +G
Sbjct:  476 LPAFHFPLGTTRMSNEDINTELERVKQELNQFIDSSLDSGKYSDPLIPH-SCFGQVAKVLNCPLYWKHAIYMNAGGTPDRQPITLSNLLKSWSHTLNTCPDEASKFVHLLTRGRATFLVQSDFNTLIQDILESHPGLAFLEAAKDFHSRYVATVVARIFFNVNISWSGRISLGELRRSNFLPVLASLENEDDINLVTQYFSYEHFYVIYCKFWELDEDHDLIISRSDLARHNNYAISERMIDRIFSGAVTRGTAFKEGVMTYPDFVWFLLAEEDKHHPRSIEYWFRCMDLDGDGLLSMYELEYFYSEQLARMEEMGIEPISFEDCLCQCLDMVKPALTDKIRLSDMKQCRLCHIFFDTFFNLPKYLQHEQRDPFANLRDIEEGLNELSDWDRYAAETYEMLVNVEG 880          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Match: A0A4Z2CRS0 (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008076 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 3.198e-178
Identity = 249/401 (62.09%), Postives = 307/401 (76.56%), Query Frame = 1
Query:  880 IPKFYFPRGKPKSNEEILNL-MKSINDKLQSLEAKTNTTAPLT---IHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILV 2070
            +P F+FP G  + + E +N+ ++ I  +L  L   +  +   +   I  S F +V ++L  PLYWKH +++N+GG      +   NL+  W  I      +ASK   LLT+ +  ++   DF  L+QD+LESHPGL FL +A+DFHSRY+ATVV RIFF +N SWSG+ITL EL +S+ L VL SLE  DDIN +TQYFSYEHFYVIYCKFWELDEDHDL+IS+ DLARHNNYA+SERMI+RIFSGAVT+  A  EG+MTY +FVWFLL+EEDK HPRSIEYWFRCMDLDGDG+LS+YEL+YFY EQL RMEEMGIEPISFEDC+CQ +DM+KP   +KIRLSD+K CRL  IFFDTFFNL KYL+HEQRDPF NL+D+EEGLNE+SDWDRYA+E YE+LV
Sbjct:  341 LPSFHFPFGTTRLSVEEINVELERIKRELNQLVDSSLNSGKYSDSLISHSCFGQVAKVLNCPLYWKHAIYINAGGTSDRQPVTLSNLLKSWSTILNTCPDEASKFVQLLTRGRATYLVQSDFNSLIQDILESHPGLAFLEAAKDFHSRYVATVVARIFFNVNISWSGRITLGELRRSNFLPVLASLEMEDDINLVTQYFSYEHFYVIYCKFWELDEDHDLIISRTDLARHNNYAISERMIDRIFSGAVTRGTAFKEGVMTYPDFVWFLLAEEDKHHPRSIEYWFRCMDLDGDGLLSMYELEYFYSEQLARMEEMGIEPISFEDCLCQCLDMVKPALADKIRLSDMKQCRLCHIFFDTFFNLPKYLQHEQRDPFANLRDIEEGLNELSDWDRYAAETYEMLV 741          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Match: A0A3Q0KJ13 (Phosphatase 2a regulatory subunit-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 3.929e-178
Identity = 252/406 (62.07%), Postives = 314/406 (77.34%), Query Frame = 1
Query:  880 IPKFYFPRGKPK-SNEEILNLMKSINDKL-QSLEAKTNT---TAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDG 2082
            +P F+FP G  + SNE+I   ++ +  +L Q +++  ++   + PL  H S F +V ++L  PLYWKH +++N+GG      +   NL+  W         +ASK   LLT+ +  F+   DF  L+QD+LESHPGL FL +A+DFHSRY+ATVV RIFF +N SWSG+I+L EL +S+ L VL SLE  DDIN +TQYFSYEHFYVIYCKFWELDEDHDL+IS++DLARHNNYA+SERMI+RIFSGAVT+  A  EG+MTY +FVWFLL+EEDK HPRSIEYWFRCMDLDGDG+LS+YEL+YFY EQL RMEEMGIEPISFEDC+CQ +DM+KP   +KIRLSD+K CRL  IFFDTFFNL KYL+HEQRDPF NL+D+EEGLNE+SDWDRYA+E YE+LV  +G
Sbjct:  477 LPAFHFPLGTTRMSNEDINTELERVKQELNQFIDSPLDSGKYSDPLIPH-SCFGQVAKVLNCPLYWKHAIYMNAGGTPDRQPVTLSNLLKSWSHTLNTCPDEASKFVHLLTRGRATFLVQSDFNTLIQDILESHPGLAFLEAAKDFHSRYVATVVARIFFNVNISWSGRISLGELRRSNFLPVLASLENEDDINLVTQYFSYEHFYVIYCKFWELDEDHDLIISRSDLARHNNYAISERMIDRIFSGAVTRGTAFKEGVMTYPDFVWFLLAEEDKHHPRSIEYWFRCMDLDGDGLLSMYELEYFYSEQLARMEEMGIEPISFEDCLCQCLDMVKPALTDKIRLSDMKQCRLCHIFFDTFFNLPKYLQHEQRDPFANLRDIEEGLNELSDWDRYAAETYEMLVNVEG 881          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Cavefish
Match: ppp2r3b (serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta [Source:NCBI gene;Acc:103041758])

HSP 1 Score: 469.544 bits (1207), Expect = 9.780e-157
Identity = 228/442 (51.58%), Postives = 293/442 (66.29%), Query Frame = 1
Query:  808 NLRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRE 2115
            N R   +SV + K   + E       S  IPKFYFPRG+PK+N  I NL+  I         +  T   + +       V +  + PLYWK  LF  +GG+     +     V+MW+K+    H DA+K   LL +    ++E  DF P +QDV+++H GL +L  A DFH RYI TV+ RIF+ +N SW+GKIT  EL KS  L  +  LE  DD++ +T+YFSYEHFYVIYCKFWELD DHDL I + DLARHN+ A+S RMIERIFSG VT+ R  R EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL +FYQEQ  ++E M IEP+ FEDC+CQM+D+++P+   KI L DLK C+L  IFFDTFFN+ KYL+ EQRDPF   KD E    E+SDW+RYA+E Y+ILVAED + + YND Y +
Sbjct:  104 NSRALRRSVSVKKAQVKKEEAVTPALSESIPKFYFPRGQPKANTNIDNLISKIEKIFSQFPNERVTIEDMGM-------VAKACECPLYWKAPLFYAAGGDRRGY-VSVHKFVAMWRKVLQTCHDDAAKFLHLLAKPGCPYLEQEDFIPFLQDVVDTHKGLAYLKEASDFHIRYITTVIQRIFYNVNRSWTGKITCSELRKSTFLQNVALLEEEDDVSQLTEYFSYEHFYVIYCKFWELDTDHDLYIDQRDLARHNDQAISLRMIERIFSGTVTRDRKVRKEGRLSYADFVWFLISEEDKKTETSIEYWFRCMDLDGDGVLSMYELQHFYQEQCQKLETMAIEPLPFEDCLCQMLDLVRPEIPGKITLRDLKRCKLAHIFFDTFFNIEKYLDREQRDPFLVAKDTETLGQEISDWERYAAEEYDILVAEDTANEQYNDGYEQ 537          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Cavefish
Match: ppp2r3b (serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta [Source:NCBI gene;Acc:103041758])

HSP 1 Score: 467.618 bits (1202), Expect = 1.282e-156
Identity = 227/439 (51.71%), Postives = 291/439 (66.29%), Query Frame = 1
Query:  808 NLRKTSKSVQIPKVAQRSENK-----SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDN 2106
            N R   +SV + K   + E       S  IPKFYFPRG+PK+N  I NL+  I         +  T   + +       V +  + PLYWK  LF  +GG+     +     V+MW+K+    H DA+K   LL +    ++E  DF P +QDV+++H GL +L  A DFH RYI TV+ RIF+ +N SW+GKIT  EL KS  L  +  LE  DD++ +T+YFSYEHFYVIYCKFWELD DHDL I + DLARHN+ A+S RMIERIFSG VT+ R  R EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL +FYQEQ  ++E M IEP+ FEDC+CQM+D+++P+   KI L DLK C+L  IFFDTFFN+ KYL+ EQRDPF   KD E    E+SDW+RYA+E Y+ILVAED + + YND 
Sbjct:  104 NSRALRRSVSVKKAQVKKEEAVTPALSESIPKFYFPRGQPKANTNIDNLISKIEKIFSQFPNERVTIEDMGM-------VAKACECPLYWKAPLFYAAGGDRRGY-VSVHKFVAMWRKVLQTCHDDAAKFLHLLAKPGCPYLEQEDFIPFLQDVVDTHKGLAYLKEASDFHIRYITTVIQRIFYNVNRSWTGKITCSELRKSTFLQNVALLEEEDDVSQLTEYFSYEHFYVIYCKFWELDTDHDLYIDQRDLARHNDQAISLRMIERIFSGTVTRDRKVRKEGRLSYADFVWFLISEEDKKTETSIEYWFRCMDLDGDGVLSMYELQHFYQEQCQKLETMAIEPLPFEDCLCQMLDLVRPEIPGKITLRDLKRCKLAHIFFDTFFNIEKYLDREQRDPFLVAKDTETLGQEISDWERYAAEEYDILVAEDTANEQYNDG 534          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Cavefish
Match: ppp2r3a (protein phosphatase 2 regulatory subunit B''alpha [Source:NCBI gene;Acc:103045434])

HSP 1 Score: 460.299 bits (1183), Expect = 4.071e-146
Identity = 219/416 (52.64%), Postives = 287/416 (68.99%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTK-SRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDN 2106
            S +IP+FYFP G P        ++  I       E +          K+   E+ +I K    PLYWK  +F  +GG  T   +     ++ W+K+    + DASK   LL +    ++E  DF PL+QD++++HPGLTFL  A +FHSRYI TV+ RIF+ +N SW+G+IT+ EL +++ L  L  LE  DDIN IT YFSYEHFYVIYCKFWELD DHDL I   DLAR+N++A S R+IER+FSGAVT+ S  + +G M+Y EFVWFL+SEEDKK+P S+EYWFRCMDLDGDG+LS+YEL+YFY+EQ  RME MGIEP+ F+D +CQM+D++KP+ + KI L DLK+CR+  IFFDTFFNL KYL+HEQRDPF   KDL+    E SDWD+YA+E YEILVAE+ + +  +D 
Sbjct:  762 SINIPRFYFPTGLPTCAANYDEIIAKIETAFSEFEEE----------KADIYEMGKIAKACGCPLYWKAPMFNCAGGERTGF-VSVHTFIATWRKLLHSCYDDASKFVYLLAKPGCNYLEQEDFIPLLQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSWTGRITMTELRRNNFLQTLALLEEEDDINQITDYFSYEHFYVIYCKFWELDTDHDLFIDPKDLARYNDHASSSRIIERLFSGAVTRGSSVQRDGRMSYAEFVWFLISEEDKKNPTSVEYWFRCMDLDGDGVLSMYELEYFYEEQCERMEGMGIEPLPFQDLLCQMLDLVKPEYQGKITLRDLKHCRMAHIFFDTFFNLEKYLDHEQRDPFAVQKDLDGDGPEPSDWDKYAAEEYEILVAEETASEQLHDG 1166          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Cavefish
Match: ppp2r3c (protein phosphatase 2, regulatory subunit B'', gamma [Source:NCBI gene;Acc:393100])

HSP 1 Score: 110.923 bits (276), Expect = 1.110e-25
Identity = 70/247 (28.34%), Postives = 135/247 (54.66%), Query Frame = 1
Query: 1252 VLESHPGLTFLLSA-RDFHSRYIATVVYRIFFGINSSWSGKITLQELEKS---DILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRD 1980
            +LE  P L  L    + F+S Y+ T V + FF ++   +GKI +Q++      D LL L   E + +    + +FS      +Y ++  LD+DH+ ++SK +L+R+    ++   ++R++   +T      +G M Y  ++ F+L+ E++K P +++Y F+ +D++  G L+++ L+YF++    +M+  G EP+SF+D   ++ DM+KP++  KI L DL N            +L  +  +E R+
Sbjct:  143 ILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQE-SNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSRYGTGTLTSVFLDRVYQECLT-----YDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDMENKGYLNVFALNYFFRAIQEQMKIHGQEPVSFQDVKDEIFDMVKPRDPYKITLQDLVNSGQGDTVTSILIDLNGFWTYENRE 383          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009667.1 (pep scaffold:Pmarinus_7.0:GL481607:3149:22110:1 gene:ENSPMAG00000008732.1 transcript:ENSPMAT00000009667.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 400.979 bits (1029), Expect = 9.431e-134
Identity = 196/392 (50.00%), Postives = 262/392 (66.84%), Query Frame = 1
Query:  841 PKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNY--AVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLK 1998
            P+VA       S +P+FYFP G+P       +         Q +E    +  P    ++   ++  + K    P+YWK  LF  + G  T   +     V+MW+K+    H D++K  +LL +   C++   DF PL+QD+++SHPGLTFL  A +FHSRYI TV+ R+F+ +N SWSG+I+L EL KS+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL I + DL +HN++  A+S RMI+RIFSGAVT+  A + E  M+Y +FVWFL+SEEDKK   +  YWFRCMDLDGDG+LS+YEL++FY EQ  RM+++GIEP+   DC+CQM+D++KP+ E KI L DLK CR+  +FFDTFFNL KYLEHEQ+DPF+  K
Sbjct:    6 PQVAP----AHSLVPRFYFPHGRPAPTGPTSD---------QMIERVEESFTPYPDERADIHQMATVAKACGCPVYWKSALFHAASGERTGF-VSVHTFVAMWRKLLRTCHDDSAKFVALLAR-PGCYLVQEDFIPLLQDIVDSHPGLTFLKEAPEFHSRYITTVIQRVFYTVNRSWSGRISLTELRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYIDRKDLEKHNDHAAAISSRMIDRIFSGAVTRGPATKREKRMSYADFVWFLISEEDKK--TATRYWFRCMDLDGDGVLSMYELEHFYGEQCARMDKLGIEPLPLSDCLCQMLDLVKPQVEGKITLKDLKRCRMAYVFFDTFFNLEKYLEHEQKDPFSVQK 380          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000655.1 (pep scaffold:Pmarinus_7.0:GL477040:104030:108297:-1 gene:ENSPMAG00000000598.1 transcript:ENSPMAT00000000655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 1.566e-52
Identity = 84/164 (51.22%), Postives = 111/164 (67.68%), Query Frame = 1
Query: 1072 LFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNN 1563
            LFL + G ET   +  E     W ++   +  DA++  SLL +     +   DF PLVQD++++HPGL FL  A +FHSRYI TV+ RIF+ +N SWSG+IT+ EL +S+ L  L  +   DDIN +T+YFSYEHFYVIYCKFWELD DHDL IS +DLARH++
Sbjct:    2 LFLAAHGEETGF-VTMETFTLTWLRVTRASEDDAARFVSLLARPGVAGLTQEDFIPLVQDIVDTHPGLAFLKDAPEFHSRYITTVIQRIFYTVNRSWSGRITVNELRRSNFLQTLALVAEEDDINQVTEYFSYEHFYVIYCKFWELDTDHDLYISASDLARHSD 164          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Sea Lamprey
Match: ppp2r3c (protein phosphatase 2, regulatory subunit B'', gamma [Source:NCBI gene;Acc:393100])

HSP 1 Score: 91.2781 bits (225), Expect = 3.289e-21
Identity = 47/174 (27.01%), Postives = 99/174 (56.90%), Query Frame = 1
Query: 1459 YFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRD 1980
            +FS      +  ++  LD+DH+ ++SK +L+R+    ++   ++R+F   +T      +G M Y  ++ F+L+ E++K P +++Y+F+ +D+   G L+++ L+YF++    +M   G EP+SF+D   ++ DM+KP++   I L+DL +            +L  +  +E+R+
Sbjct:   22 WFSAPSAICVTGQYLNLDKDHNGMLSKEELSRYGTGTLTGIFLDRLFQECLT-----YDGEMDYKTYLDFVLALENRKEPAALQYFFKLLDVQSKGYLNVFSLNYFFRAIQDQMRAHGQEPVSFQDVKDEVFDMVKPQDPLHITLADLISSNQGDTVVSILIDLNGFWTYEKRE 190          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Nematostella
Match: EDO33669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ2])

HSP 1 Score: 473.781 bits (1218), Expect = 3.266e-160
Identity = 217/410 (52.93%), Postives = 299/410 (72.93%), Query Frame = 1
Query:  871 SSDIPKFYFPRGKPKSNEEILNL-MKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEG-LNEMSDWDRYASEAYEILVAEDGSQDN 2094
            +++IP+FYFP G P  + + L L  K +++     E            K +F  VT+   +PLYWK  LF  +GGN+    +      SMW++++A  H DAS+   LL +  +  ++  DF PL+QD+++SHPGL+FL  A +FHSRY+ TV+ RIF+ +NSSW+GKIT+ E+  S+ L VL SLE  +DIN + +YFSYEHFYVIYCKFWELD DHDL+I + DL +H+N+A+S RM++R+FSG VT+ +   EG MTY E+VWFLLSEEDKKHPRSIEYWFRCMDLDGDG+LS+YEL+YFY+EQ+ +M+ +GIE ++FEDC+CQ++DM+KPK E KI L+DLKNC++  IFF+TFFNL KYLE EQRDPF + +++ +  L   +DW+RYA E YE+LVAE+G+ + 
Sbjct:   84 AANIPQFYFPNGPPPPSGKRLELTFKRVSEVFGVFEGGK-------AKKEQFSSVTKACNLPLYWKQPLFACAGGNKNGF-VTLPMFTSMWRRVSATCHDDASRFVRLLAKPGRSHLDSEDFVPLIQDIVQSHPGLSFLEDAPEFHSRYVHTVIARIFYSVNSSWTGKITIPEVRHSNFLEVLASLEEEEDINEVLEYFSYEHFYVIYCKFWELDTDHDLLIDEKDLCKHSNHALSSRMVKRLFSGCVTRGKTYLEGKMTYPEYVWFLLSEEDKKHPRSIEYWFRCMDLDGDGVLSMYELEYFYEEQVAKMDALGIETMAFEDCLCQILDMVKPKTEGKITLTDLKNCKMAFIFFNTFFNLDKYLEFEQRDPFGSAREVADSDLPPPTDWERYAQEEYELLVAEEGAAEQ 485          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Nematostella
Match: EDO46756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX9])

HSP 1 Score: 110.923 bits (276), Expect = 8.250e-26
Identity = 74/257 (28.79%), Postives = 136/257 (52.92%), Query Frame = 1
Query: 1252 VLESHPGLTFLLSA-RDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQ---YFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEE 2010
            +LE  P L  L    + F+S Y+ T V + FF ++   +GKI +Q++     L  L  L   +D++   Q   +FS      +Y ++  LD DH+ ++SK +LAR+ +  +++  I+R+F   +T      +G M Y  ++ F+L+ E++K P++++Y FR +D+   G L+++ L+YF++     M + G EP+ F D   +  DM+KP +  +I L DL N            +L  +  +E R+ F + +  +E
Sbjct:  198 ILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRD-EDLSKEQQDANWFSAPSALRVYGQYLNLDTDHNGMLSKEELARYGSGTLTKVFIDRVFQECLT-----YDGEMDYKTYLDFVLALENRKEPQALQYLFRILDVQAAGFLNIFSLNYFFRAIQEDMSKHGHEPVKFLDVKEEKFDMVKPVDPYRITLQDLINSGQGETVSSILIDLNGFWSYENREVFASPEGADE 448          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Nematostella
Match: EDO29215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T499])

HSP 1 Score: 58.151 bits (139), Expect = 2.080e-9
Identity = 44/136 (32.35%), Postives = 60/136 (44.12%), Query Frame = 1
Query: 1048 VPLYWKHLLFLNSGGNETNLCIYRENLVSMWQK-IAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTI 1452
            +PLYWK  LF  +GGN+    +      SMW++ I AV   DA +                              G T  L            V+ RIF+ +NSSW+GKIT+ E+  S+ L VL SLE  +DIN +
Sbjct:  144 LPLYWKQPLFACAGGNKNGF-VTLPMFTSMWRRNICAV---DALRWM----------------------------GCTGALGV-------ALKVIARIFYSVNSSWTGKITIPEVRHSNFLEVLASLEEEEDINEV 240          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Medaka
Match: PPP2R3B (serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta [Source:NCBI gene;Acc:101157896])

HSP 1 Score: 469.544 bits (1207), Expect = 7.586e-157
Identity = 228/452 (50.44%), Postives = 303/452 (67.04%), Query Frame = 1
Query:  763 NGDIESHEMPIADTKNLRKT--SKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSR-ARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNY 2109
            +G   +  +P    + LR++  SK  Q+      +  +S +IPKFYFP+G+P++N  I  L+  I         +  T   +         V +  + PLYWK  LF  +GG+ T   +     V++W+K     H DASK   LL +    ++E  DF P +QDV+ SH GL FL  A DFHSRYI TV+ RIF+ +N SW+GKIT  EL KS+ L  +  LE  +D+N +T+YFSYEHFYVIYCKFWELD DHDL I + DLARHN+ A+S+RMIERIFSG VT+ R  R EG ++Y +FVWFL+SEEDKK   SIEYWFRCMDLDGDG+LS+YEL+YFY+EQ  ++E M IEP+ FEDC+CQM D++KP+ E KI L DLK C+L  IFFDTFF++ KYL+HEQRDPF+ +++ E    E+SDW++YA+E Y+ILVAE+ + D  ND Y
Sbjct:   94 SGSNSNSRVPGPGGRLLRRSVSSKKAQVRTEVPVTTAQSENIPKFYFPQGRPQANLNIDGLISRIEKTFSQFPNERATIEDMGA-------VAKACECPLYWKVPLFCLAGGDRTGF-VSVHKFVAVWRKTLQTCHDDASKFVHLLAKPGCNYLEQDDFIPFLQDVVNSHAGLAFLKEAPDFHSRYITTVIQRIFYNVNRSWTGKITCNELRKSNFLQNVVLLEQEEDVNQLTEYFSYEHFYVIYCKFWELDSDHDLYIDQNDLARHNDQAISQRMIERIFSGTVTRDRRVRKEGRISYADFVWFLISEEDKKTDTSIEYWFRCMDLDGDGVLSMYELEYFYEEQCQKLEAMAIEPLPFEDCLCQMFDLVKPEVEGKITLRDLKRCKLSHIFFDTFFDIEKYLDHEQRDPFSVIREAETEGQEVSDWEKYAAEEYDILVAEEAANDQCNDVY 537          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Medaka
Match: ppp2r3a (protein phosphatase 2 regulatory subunit B''alpha [Source:NCBI gene;Acc:101155892])

HSP 1 Score: 451.825 bits (1161), Expect = 8.659e-151
Identity = 221/420 (52.62%), Postives = 292/420 (69.52%), Query Frame = 1
Query:  877 DIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGS-----QDNYNDNY 2109
            +IP+FY+PRG P         M        ++ A     A L   K+   E+ +I KV   PLYWK  +F  +GG +T   +  ++ V+ W+K+    + DASK   LL +    ++E  DF PL+QD++++HPGLTFL  A +FHSRYI TV+ RI++ +N SW+G+IT+ EL +S+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL I   DL R+N++A S R+IER+FSGAVT+  A + EG M+Y EFVWFL+SEEDKK+  SIEYWFRCMDLDGDG+LS++EL+YFY+EQ  RME MGIEP+ F+D +CQM+D++KP+   KI L DLK CR+  IFFDTFFNL KYL+HEQRDPF   KD+E    E SDWD+YA+E YEILVAE+ +     + +++D+Y
Sbjct:   88 NIPRFYYPRGLPA--------MGPAATHDSTIAAIETAFAELEEEKADIYEMGKIAKVCGCPLYWKAPMFYTAGGEKTGF-VTVQSFVATWKKLLHGCNDDASKFIHLLAKPGFNYLEQEDFIPLLQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIYYVVNRSWTGRITMMELRRSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYIDPKDLGRYNDHASSHRIIERLFSGAVTRGNAVQREGRMSYAEFVWFLISEEDKKNLTSIEYWFRCMDLDGDGVLSMFELEYFYEEQCERMERMGIEPLPFQDLLCQMLDLVKPESTGKITLGDLKRCRMAHIFFDTFFNLEKYLDHEQRDPFAVQKDIESEGPEPSDWDKYAAEEYEILVAEETANEQLHEGSFDDDY 498          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Medaka
Match: ppp2r3a (protein phosphatase 2 regulatory subunit B''alpha [Source:NCBI gene;Acc:101155892])

HSP 1 Score: 461.84 bits (1187), Expect = 3.014e-145
Identity = 221/420 (52.62%), Postives = 292/420 (69.52%), Query Frame = 1
Query:  877 DIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKV---PLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRA-RTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGS-----QDNYNDNY 2109
            +IP+FY+PRG P         M        ++ A     A L   K+   E+ +I KV   PLYWK  +F  +GG +T   +  ++ V+ W+K+    + DASK   LL +    ++E  DF PL+QD++++HPGLTFL  A +FHSRYI TV+ RI++ +N SW+G+IT+ EL +S+ L  L  LE  +DIN IT YFSYEHFYVIYCKFWELD DHDL I   DL R+N++A S R+IER+FSGAVT+  A + EG M+Y EFVWFL+SEEDKK+  SIEYWFRCMDLDGDG+LS++EL+YFY+EQ  RME MGIEP+ F+D +CQM+D++KP+   KI L DLK CR+  IFFDTFFNL KYL+HEQRDPF   KD+E    E SDWD+YA+E YEILVAE+ +     + +++D+Y
Sbjct:  938 NIPRFYYPRGLPA--------MGPAATHDSTIAAIETAFAELEEEKADIYEMGKIAKVCGCPLYWKAPMFYTAGGEKTGF-VTVQSFVATWKKLLHGCNDDASKFIHLLAKPGFNYLEQEDFIPLLQDIVDTHPGLTFLKDAPEFHSRYITTVIQRIYYVVNRSWTGRITMMELRRSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYIDPKDLGRYNDHASSHRIIERLFSGAVTRGNAVQREGRMSYAEFVWFLISEEDKKNLTSIEYWFRCMDLDGDGVLSMFELEYFYEEQCERMERMGIEPLPFQDLLCQMLDLVKPESTGKITLGDLKRCRMAHIFFDTFFNLEKYLDHEQRDPFAVQKDIESEGPEPSDWDKYAAEEYEILVAEETANEQLHEGSFDDDY 1348          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Medaka
Match: ppp2r3c (protein phosphatase 2 regulatory subunit B''gamma [Source:NCBI gene;Acc:101168662])

HSP 1 Score: 120.553 bits (301), Expect = 1.423e-28
Identity = 79/263 (30.04%), Postives = 142/263 (53.99%), Query Frame = 1
Query: 1252 VLESHPGLTFLLSA-RDFHSRYIATVVYRIFFGINSSWSGKITLQELEKS---DILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQR------DPFTNLKDLEE 2010
            +LE  P L  L    + F+S Y+ T V + FF ++   +GKI +Q++      D LL L   E + +    + +FS      +Y ++  LD+DH+ ++SK +L+R+    ++   ++R+F   +T      +G M Y  ++ F+L+ E+KK P +I+Y F+ +D++  G L+++ L+YF++    +M++ G EP+SF+D   ++ DM+KP++  KI   DL NC           +L  +  +E R      D  +N  DLEE
Sbjct:  191 ILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKIQDILACSFLDDLLELRDEELSKESQE-SNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSRYGTATLTSVFLDRVFQECLT-----YDGEMDYKTYLDFVLALENKKEPAAIQYIFKLLDMENQGYLNVFSLNYFFRAIQEQMKQHGQEPVSFQDVKDEIFDMVKPQDPYKITFQDLVNCCQGDTVVGILIDLNGFWTYENREVLVANDDSSNTVDLEE 447          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Match: SMESG000015273.1 (SMESG000015273.1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 454/458 (99.13%), Postives = 456/458 (99.56%), Query Frame = 1
Query:  940 MKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRESNQSFRNSSNTRDDEAVYENVSTKLNVSGKKPEKIYESSRYNDFVNDKLSEMTDSSSPSQFAVGNN 2313
            MKS+NDKLQSLEAK+N TAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRESNQSFRNSSNTRDDEAVYENVSTKLNV GKKPEKIYESSRYNDFVNDKLSEMTDSSSPSQFAVGNN
Sbjct:    1 MKSVNDKLQSLEAKSNMTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRESNQSFRNSSNTRDDEAVYENVSTKLNVLGKKPEKIYESSRYNDFVNDKLSEMTDSSSPSQFAVGNN 458          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Match: SMESG000024576.1 (SMESG000024576.1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.359e-163
Identity = 231/405 (57.04%), Postives = 306/405 (75.56%), Query Frame = 1
Query:  877 DIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDK-KCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQ 2088
            DIP+F++ RGKP + +E  + + +I + L  +      +  L I +SK  ++ ++LKVPLYWK  ++L  GG E N  I  ++++S W+ +     ++A+K   ++T+   + F+E  DF PLVQDVLE+HPGL FL S+ DFH  YI TV+ RIFF ++  W+ +I+L ELEKSD+  V++ LET DDIN +TQYFSYEHFYVIYCKFWELD DH+L+ISK DL RHNN+A+SE  I+RIFSG V +  +  +  MTY EFVWFLL+EEDK+HPRSIEYWFR MDLDGDG+LSL+EL+ FY EQL +M+E+ IEP+SF DC+C M+DMIKP++E++I L+DLK CRL  IFFDTF NL KYL+HEQRDPF NL+D+EEGL E+SDWDRYA+E YE+LV+EDG Q
Sbjct:  156 DIPRFFYLRGKPGNIKETESALAAIRESLLGI-----ASYDLGIPRSKLADLVKVLKVPLYWKQPVYLCCGGTE-NKPIKVDDVISFWRTMLTNCGTEAAKFMHIMTRGSTRNFLERSDFEPLVQDVLETHPGLQFLQSSVDFHIHYINTVIARIFFNLDRYWNDRISLTELEKSDLCWVIKFLETHDDINVVTQYFSYEHFYVIYCKFWELDNDHNLIISKNDLLRHNNFALSELAIDRIFSGTVLRKLSDNKS-MTYPEFVWFLLAEEDKRHPRSIEYWFRLMDLDGDGVLSLHELECFYSEQLKKMDELAIEPVSFTDCMCMMLDMIKPRQEHRIMLADLKACRLCHIFFDTFLNLPKYLDHEQRDPFNNLRDIEEGLTEISDWDRYANETYELLVSEDGQQ 553          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Match: SMESG000024576.1 (SMESG000024576.1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.449e-163
Identity = 231/405 (57.04%), Postives = 306/405 (75.56%), Query Frame = 1
Query:  877 DIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDK-KCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRDPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQ 2088
            DIP+F++ RGKP + +E  + + +I + L  +      +  L I +SK  ++ ++LKVPLYWK  ++L  GG E N  I  ++++S W+ +     ++A+K   ++T+   + F+E  DF PLVQDVLE+HPGL FL S+ DFH  YI TV+ RIFF ++  W+ +I+L ELEKSD+  V++ LET DDIN +TQYFSYEHFYVIYCKFWELD DH+L+ISK DL RHNN+A+SE  I+RIFSG V +  +  +  MTY EFVWFLL+EEDK+HPRSIEYWFR MDLDGDG+LSL+EL+ FY EQL +M+E+ IEP+SF DC+C M+DMIKP++E++I L+DLK CRL  IFFDTF NL KYL+HEQRDPF NL+D+EEGL E+SDWDRYA+E YE+LV+EDG Q
Sbjct:  157 DIPRFFYLRGKPGNIKETESALAAIRESLLGI-----ASYDLGIPRSKLADLVKVLKVPLYWKQPVYLCCGGTE-NKPIKVDDVISFWRTMLTNCGTEAAKFMHIMTRGSTRNFLERSDFEPLVQDVLETHPGLQFLQSSVDFHIHYINTVIARIFFNLDRYWNDRISLTELEKSDLCWVIKFLETHDDINVVTQYFSYEHFYVIYCKFWELDNDHNLIISKNDLLRHNNFALSELAIDRIFSGTVLRKLSDNKS-MTYPEFVWFLLAEEDKRHPRSIEYWFRLMDLDGDGVLSLHELECFYSEQLKKMDELAIEPVSFTDCMCMMLDMIKPRQEHRIMLADLKACRLCHIFFDTFLNLPKYLDHEQRDPFNNLRDIEEGLTEISDWDRYANETYELLVSEDGQQ 554          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Match: SMESG000033212.1 (SMESG000033212.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.960e-26
Identity = 90/376 (23.94%), Postives = 176/376 (46.81%), Query Frame = 1
Query:  859 SENKSSDIPKFYFPRGKPKSNEEILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLFLNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPPDFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESL--ETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRD 1980
            +ENK++ +PKFY     P  +      + + ND++             ++    +   T   K  LY K  L     G    +  +   +  +W     +  S    L+ +L Q    +++  D    + +++ + P L+ +   + F S Y+ T V + FF ++   +G++ +  +     L  L  L  E  ++    + +FS +  Y +Y  +  LD D + ++SK +LAR+    +++  I+++F   +T +     G M Y  ++   L+ E+K  P+SI++ FR +D+D  G L++++L+YF+Q    R+ E  ++P  F D   ++ DM+KPK   KI L DL +C       +   +L  +  +E R+
Sbjct:   29 NENKNTSLPKFYQADLWPILDRHCT--VTNCNDQMIDFNDFMKAGKEASVKARPYFTATVFFK--LYTKDPL-----GRIPIITFFNYVMKKVWLHQTRIGLS----LYDVLGQG---YLKESDLENYILELIPTLPQLSKM--EKSFESFYVCTAVRKFFFFLDPMRTGRVKISHILSCSFLDDLLELRDEVMNERKQDSNWFSAKSAYRVYGTYLHLDRDQNGMLSKDELARYETGTLTQVFIDQVFQTLLTYN-----GEMDYKTYLDLTLALENKSEPQSIQFLFRIIDIDSKGYLTVWDLNYFFQGIQDRLREQNVDPQPFSDIQDEIFDMVKPKNPCKITLDDLIDCGKGDTVVNILIDLNGFWTYENRE 381          
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Match: SMESG000049345.1 (SMESG000049345.1)

HSP 1 Score: 113.235 bits (282), Expect = 2.416e-26
Identity = 70/246 (28.46%), Postives = 128/246 (52.03%), Query Frame = 1
Query: 1252 VLESHPGLTFLLSA-RDFHSRYIATVVYRIFFGINSSWSGKITLQELEKSDILLVLESL--ETTDDINTITQYFSYEHFYVIYCKFWELDEDHDLVISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLSEEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPISFEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQRD 1980
            +LE  P L  L    + F S Y+ T V + FF ++   +G++ +  +     L  L  L  E  ++    + +FS +  Y +Y  +  LD D + ++SK +LAR+    +++  I+++F   +T +     G M Y  ++   L+ E+K  P+SI++ FR +D+D  G L++++L+YF+Q    R+ E  ++P  F D   ++ DM+KPK   KI L DL +C       +   +L  +  +E R+
Sbjct:  176 ILELIPTLPQLSKMEKSFESFYVCTAVRKFFFFLDPMRTGRVKISHILSCSFLDDLLELRDEVMNERKQDSNWFSAKSAYRVYGTYLHLDRDQNGMLSKDELARYETGTLTQVFIDQVFQTLLTYN-----GEMDYKTYLDLTLALENKSEPQSIQFLFRIIDIDSKGYLTVWDLNYFFQGIQDRLREQNVDPQPFSDIQDEIFDMVKPKNPCKITLDDLIDCGKGDTVVNILIDLNGFWTYENRE 416          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP2R3A4.787e-15552.29protein phosphatase 2 regulatory subunit B''alpha ... [more]
PPP2R3A1.588e-15155.64protein phosphatase 2 regulatory subunit B''alpha ... [more]
PPP2R3A6.531e-15052.61protein phosphatase 2 regulatory subunit B''alpha ... [more]
PPP2R3B2.657e-14848.08protein phosphatase 2 regulatory subunit B''beta [... [more]
PPP2R3B8.128e-14848.08protein phosphatase 2 regulatory subunit B''beta [... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F43B10.16.672e-9537.00pep chromosome:WBcel235:X:16638278:16643061:-1 gen... [more]
F43B10.12.974e-9437.00pep chromosome:WBcel235:X:16638226:16643558:-1 gen... [more]
F43B10.12.558e-9337.00pep chromosome:WBcel235:X:16638278:16662823:-1 gen... [more]
F43B10.11.533e-9037.00pep chromosome:WBcel235:X:16638226:16654507:-1 gen... [more]
T22D1.51.166e-727.69pep chromosome:WBcel235:IV:6903950:6905546:1 gene:... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG47332.480e-14249.88gene:FBgn0038744 transcript:FBtr0301117[more]
CG47332.480e-14249.88gene:FBgn0038744 transcript:FBtr0308829[more]
CG47332.480e-14249.88gene:FBgn0038744 transcript:FBtr0308828[more]
CG47338.932e-14049.64gene:FBgn0038744 transcript:FBtr0344260[more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp2r3b2.042e-15647.88protein phosphatase 2, regulatory subunit B'', bet... [more]
ppp2r3b2.042e-15647.88protein phosphatase 2, regulatory subunit B'', bet... [more]
ppp2r3b1.197e-15353.40protein phosphatase 2, regulatory subunit B'', bet... [more]
ppp2r3a3.039e-15148.79protein phosphatase 2, regulatory subunit B'', alp... [more]
ppp2r3a5.174e-14648.79protein phosphatase 2, regulatory subunit B'', alp... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa06.517e-15152.42heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
hnrnpa01.055e-15050.57heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
hnrnpa01.294e-15050.23heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
hnrnpa02.127e-15051.49heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
hnrnpa05.537e-15051.49heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp2r3a1.722e-15554.39protein phosphatase 2, regulatory subunit B'', alp... [more]
Ppp2r3a9.276e-15054.39protein phosphatase 2, regulatory subunit B'', alp... [more]
Ppp2r3d4.619e-4554.48protein phosphatase 2 (formerly 2A), regulatory su... [more]
Ppp2r3d4.619e-4554.48protein phosphatase 2 (formerly 2A), regulatory su... [more]
Ppp2r3d7.740e-4255.93protein phosphatase 2 (formerly 2A), regulatory su... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06190|P2R3A_HUMAN3.136e-14952.61Serine/threonine-protein phosphatase 2A regulatory... [more]
sp|Q9Y5P8|P2R3B_HUMAN1.276e-14748.08Serine/threonine-protein phosphatase 2A regulatory... [more]
sp|Q9Z176|P2R3D_MOUSE3.022e-12647.54Serine/threonine-protein phosphatase 2A regulatory... [more]
sp|Q9XGR4|2AB2A_ARATH4.325e-10138.60Serine/threonine protein phosphatase 2A regulatory... [more]
sp|Q9SLI8|2AB2D_ARATH1.606e-9840.58Probable serine/threonine protein phosphatase 2A r... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095CDJ74.219e-18060.56Serine/threonine-protein phosphatase 2A regulatory... [more]
A0A430Q8377.144e-17962.32Serine/threonine-protein phosphatase 2A regulatory... [more]
A0A183QP931.692e-17862.32EF-hand domain-containing protein OS=Schistosoma r... [more]
A0A4Z2CRS03.198e-17862.09Serine/threonine-protein phosphatase 2A regulatory... [more]
A0A3Q0KJ133.929e-17862.07Phosphatase 2a regulatory subunit-related OS=Schis... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ppp2r3b9.780e-15751.58serine/threonine-protein phosphatase 2A regulatory... [more]
ppp2r3b1.282e-15651.71serine/threonine-protein phosphatase 2A regulatory... [more]
ppp2r3a4.071e-14652.64protein phosphatase 2 regulatory subunit B''alpha ... [more]
ppp2r3c1.110e-2528.34protein phosphatase 2, regulatory subunit B'', gam... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009667.19.431e-13450.00pep scaffold:Pmarinus_7.0:GL481607:3149:22110:1 ge... [more]
ENSPMAT00000000655.11.566e-5251.22pep scaffold:Pmarinus_7.0:GL477040:104030:108297:-... [more]
ppp2r3c3.289e-2127.01protein phosphatase 2, regulatory subunit B'', gam... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO336693.266e-16052.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467568.250e-2628.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292152.080e-932.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PPP2R3B7.586e-15750.44serine/threonine-protein phosphatase 2A regulatory... [more]
ppp2r3a8.659e-15152.62protein phosphatase 2 regulatory subunit B''alpha ... [more]
ppp2r3a3.014e-14552.62protein phosphatase 2 regulatory subunit B''alpha ... [more]
ppp2r3c1.423e-2830.04protein phosphatase 2 regulatory subunit B''gamma ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2A regulatory subunit B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015273.10.000e+099.13SMESG000015273.1[more]
SMESG000024576.11.359e-16357.04SMESG000024576.1[more]
SMESG000024576.11.449e-16357.04SMESG000024576.1[more]
SMESG000033212.11.960e-2623.94SMESG000033212.1[more]
SMESG000049345.12.416e-2628.46SMESG000049345.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018418 ID=SMED30018418|Name=Serine/threonine-protein phosphatase 2A regulatory subunit B|organism=Schmidtea mediterranea sexual|type=transcript|length=2378bp
AAAATGTGGATCTACTTTCAAAGAGTAAGTAGATAAGAAAAGTAATATTA
ATTGATTATTAAACTGTAAATTCAATTATATTAGTATTAATATCAGTCAA
CCAATAGAAATCGTTGAATTAATAAGTAGATGGAAGAATTGCAAAATAAA
CCGTTTGCTTGTACTAAGCAGCATCAATAAATTTTCAGGTATGCTGTAAT
TTACACGCATGCATCCGATGGATTTATTTATTAATTTGTATTTGTGTGAA
TTGATTTTTTTTGGAATTGAATGACTTTAGATTGATCATATGAAAATATA
TTTATTGGGAAATTAATCGTTTTACAAATGTCGGTTATTTGCGTTCCTTA
CTATGTTTTGGTATCAGAGATATCTGTCTATCGGAGTCATATTGTGGATT
TAGGATTTTCTCGCTCTGCGCATTGTTGTCACAAGTGCAATTTAACTGGA
TTTAATAATTGTCCATCTGAAATTCATGTCGGTCATTGTACACCAGCTGC
ACATATCGGAGTTTTTGCTGGTTCAATGTCTCCAAACAGTTTACTTTCTG
ATTTGTCGTCATCACGTCTTTATCCGTCTAATTTACCATTACCCTTGCCT
AATACATCTTATAAGTCATCAAGAACCATTCATAACTATAAATTCGGTTC
CAATGCTATATCGCAGGACTCCAATTCTGGTTCCGTAGTTTCCACAGCTT
CAGCAACAATTATTCCAAAACGTAAACTTCCTCCTCCTATCATTCAAGAT
AAATCGACTGTAAATGGAGATATTGAATCACACGAGATGCCAATTGCTGA
TACGAAAAATTTACGGAAAACCTCAAAGTCAGTGCAAATTCCAAAAGTTG
CTCAACGCTCGGAAAATAAATCTTCAGATATTCCGAAATTTTATTTTCCA
CGAGGGAAACCGAAGTCAAATGAAGAAATACTAAATCTAATGAAATCAAT
TAATGATAAACTTCAGTCGTTGGAGGCAAAAACTAATACGACAGCTCCTT
TAACAATTCACAAATCGAAATTCGATGAAGTAACACGGATTTTAAAAGTT
CCTTTATACTGGAAGCATTTACTTTTTTTGAATTCTGGTGGCAATGAAAC
TAATTTATGTATTTATAGAGAAAATCTGGTATCCATGTGGCAAAAAATTG
CCGCTGTAAATCATAGCGATGCTTCCAAATTATTTTCTCTTTTGACTCAA
GATAAAAAGTGTTTCATCGAACCTCCAGATTTTTATCCTTTAGTGCAGGA
TGTTTTAGAAAGTCATCCGGGCTTGACATTTTTGCTCTCTGCCCGAGATT
TTCACTCTCGATACATTGCTACAGTTGTATATAGAATATTTTTCGGTATC
AATTCATCGTGGTCGGGTAAAATCACTTTGCAAGAATTGGAAAAATCCGA
CATATTATTAGTATTGGAATCGTTAGAAACAACAGACGATATCAACACAA
TTACACAGTATTTCTCATATGAACATTTCTATGTCATTTATTGCAAGTTC
TGGGAATTGGACGAAGATCACGATTTGGTCATTAGTAAAGCAGATTTAGC
TCGGCATAACAATTATGCTGTCTCAGAACGTATGATTGAAAGGATATTTA
GTGGAGCTGTGACGAAAAGTCGCGCTCGAACAGAAGGCCTAATGACATAC
ACGGAATTTGTATGGTTTTTGTTATCGGAAGAAGATAAAAAACACCCTAG
GAGTATTGAATATTGGTTTCGTTGCATGGATTTGGACGGAGATGGGATTT
TATCACTTTATGAATTGGATTATTTTTACCAAGAACAGTTATTCCGAATG
GAAGAGATGGGAATTGAACCTATCAGTTTTGAAGATTGCATATGTCAAAT
GATGGACATGATTAAACCAAAAGAAGAAAATAAAATCCGTTTATCAGATC
TCAAAAATTGTCGATTAGTCTCGATATTTTTTGATACGTTTTTTAATTTG
ACCAAATACCTTGAACATGAACAACGTGATCCATTTACAAATTTAAAAGA
CTTAGAAGAAGGTCTTAACGAAATGTCTGATTGGGACCGATATGCATCTG
AAGCCTATGAAATCTTGGTAGCAGAAGATGGTTCACAGGATAATTATAAT
GATAATTATCGTGAATCAAATCAGAGTTTTAGAAACTCGAGTAATACTCG
TGATGATGAAGCTGTTTATGAAAATGTAAGCACCAAGCTAAATGTGTCAG
GGAAAAAACCAGAGAAAATCTATGAATCATCGAGATATAATGATTTTGTC
AATGATAAATTATCCGAAATGACTGATAGTTCGTCCCCATCTCAGTTTGC
AGTGGGAAACAATTAGTCACTACTCGATTTTTTGTTGTGTATAATCTTCT
ATATAATACAATGTTAATTATAAAAAAA
back to top

protein sequence of SMED30018418-orf-1

>SMED30018418-orf-1 ID=SMED30018418-orf-1|Name=SMED30018418-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MSVICVPYYVLVSEISVYRSHIVDLGFSRSAHCCHKCNLTGFNNCPSEIH
VGHCTPAAHIGVFAGSMSPNSLLSDLSSSRLYPSNLPLPLPNTSYKSSRT
IHNYKFGSNAISQDSNSGSVVSTASATIIPKRKLPPPIIQDKSTVNGDIE
SHEMPIADTKNLRKTSKSVQIPKVAQRSENKSSDIPKFYFPRGKPKSNEE
ILNLMKSINDKLQSLEAKTNTTAPLTIHKSKFDEVTRILKVPLYWKHLLF
LNSGGNETNLCIYRENLVSMWQKIAAVNHSDASKLFSLLTQDKKCFIEPP
DFYPLVQDVLESHPGLTFLLSARDFHSRYIATVVYRIFFGINSSWSGKIT
LQELEKSDILLVLESLETTDDINTITQYFSYEHFYVIYCKFWELDEDHDL
VISKADLARHNNYAVSERMIERIFSGAVTKSRARTEGLMTYTEFVWFLLS
EEDKKHPRSIEYWFRCMDLDGDGILSLYELDYFYQEQLFRMEEMGIEPIS
FEDCICQMMDMIKPKEENKIRLSDLKNCRLVSIFFDTFFNLTKYLEHEQR
DPFTNLKDLEEGLNEMSDWDRYASEAYEILVAEDGSQDNYNDNYRESNQS
FRNSSNTRDDEAVYENVSTKLNVSGKKPEKIYESSRYNDFVNDKLSEMTD
SSSPSQFAVGNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR041534EF-hand_13
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041534PP2A regulatory subunit B'', EF-hand domainPFAMPF17958EF-hand_13coord: 77..163
e-value: 2.6E-29
score: 100.9
NoneNo IPR availableGENE3DG3DSA:1.10.238.220coord: 88..174
e-value: 1.2E-30
score: 107.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.230coord: 2..85
e-value: 7.5E-11
score: 44.3
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 175..346
e-value: 7.1E-70
score: 236.5
NoneNo IPR availablePANTHERPTHR14095PHOSPHATASE 2A REGULATORY SUBUNIT-RELATEDcoord: 21..386
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 180..281
e-value: 5.4E-18
score: 65.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 251..286
score: 9.492
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 264..276
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 54..152
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 170..325